The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

EDIPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTR
AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNTVNGTTRTVNPL
GFFKKEALPKCAQVYNKLGMYPPNM
Sequence Info Allergen Name Length Opt Bits Score E Value
P19963 Ole e 1 145 1002 281.3 7.4e-78
X76395 Ole e 1.0102 145 987 277.1 1.3e-76
CAA73037 Ole e 1.0106 146 977 274.4 8.7e-76
CAA73038 Ole e 1.0105 146 972 273.0 2.2e-75
CAA73036 Ole e 1.0107 146 951 267.3 1.2e-73
AAQ83588 Fra e 1.0201 146 929 261.2 8e-72
X76396 Ole e 1.0103 145 921 259.0 3.6e-71
CAA54819 Lig v 1.0102 145 908 255.5 4.3e-70
AAQ08947 Fra e 1.0101 145 902 253.8 1.3e-69
AAV74343 Fra e 1.0102 145 900 253.3 2e-69
X76397 Ole e 1.0104 145 898 252.7 2.9e-69
O82015 Lig v 1 145 897 252.5 3.5e-69
AAB32652 Ole e 1.0101 130 858 241.9 4.8e-66
A0A0K1SC24 Aca f 1 150 456 131.5 9.4e-33
AKV72167 Pro j 1.0101 150 420 121.6 8.9e-30
A0A0K1SC10 Ama r 1.0101 168 401 116.3 3.9e-28
ADK22842 Sal k 5.0101 151 378 110.1 2.6e-26
CAA33854 Lyc e LAT52 161 360 105.1 8.9e-25
AAL07319 Che a 1 168 353 103.1 3.6e-24
A0A0K1SC44 Koc s 1.0101 167 352 102.8 4.3e-24
Q7M1X5 Lol p 11.0101 134 285 84.7 1e-18
CAC41635 Pla l 1.0103 131 283 84.1 1.5e-18
P82242 Pla l 1 131 276 82.2 5.5e-18
AAN32987 Phl p 11.0101 143 272 81.0 1.4e-17
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ole e 1 Sequence ID: P19963

 Score = 281.3 bits 1002,  Expect = 7e-78
 Identities = 145/145 100%, Positives = 145/145 100%, Gaps = 0/145 0%
Query  1    EDIPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTR 60
            EDIPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTR
Sbjct  1    EDIPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTR 60
Query  61   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNTVNGTTRTVNPL 120
            AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNTVNGTTRTVNPL
Sbjct  61   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNTVNGTTRTVNPL 120
Query  121  GFFKKEALPKCAQVYNKLGMYPPNM 145
            GFFKKEALPKCAQVYNKLGMYPPNM
Sbjct  121  GFFKKEALPKCAQVYNKLGMYPPNM 145

Sequence Alignment: 2. Allergen Name: Ole e 1.0102 Sequence ID: X76395

 Score = 277.1 bits 987,  Expect = 1e-76
 Identities = 142/145 97%, Positives = 143/145 98%, Gaps = 0/145 0%
Query  1    EDIPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTR 60
            ED+PQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTR
Sbjct  1    EDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTR 60
Query  61   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNTVNGTTRTVNPL 120
            AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGW KPSLKF LNTVNGTTRTVNPL
Sbjct  61   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWVKPSLKFILNTVNGTTRTVNPL 120
Query  121  GFFKKEALPKCAQVYNKLGMYPPNM 145
            GFFKKEALPKCAQVYNKLGMYPPNM
Sbjct  121  GFFKKEALPKCAQVYNKLGMYPPNM 145

Sequence Alignment: 3. Allergen Name: Ole e 1.0106 Sequence ID: CAA73037

 Score = 274.4 bits 977,  Expect = 9e-76
 Identities = 139/145 95%, Positives = 144/145 99%, Gaps = 0/145 0%
Query  1    EDIPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTR 60
            ED+PQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGAS+RLQCKDKENGDVTFTE+GYTR
Sbjct  2    EDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTR 61
Query  61   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNTVNGTTRTVNPL 120
            AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKF L+TVNGTTRTVNPL
Sbjct  62   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILSTVNGTTRTVNPL 121
Query  121  GFFKKEALPKCAQVYNKLGMYPPNM 145
            GF+KKEALPKCAQVYNKLGMYPPNM
Sbjct  122  GFYKKEALPKCAQVYNKLGMYPPNM 146

Sequence Alignment: 4. Allergen Name: Ole e 1.0105 Sequence ID: CAA73038

 Score = 273.0 bits 972,  Expect = 2e-75
 Identities = 139/145 95%, Positives = 143/145 98%, Gaps = 0/145 0%
Query  1    EDIPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTR 60
            ED+PQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGAS+RLQCKDKENGDVTFTE+GYTR
Sbjct  2    EDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTR 61
Query  61   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNTVNGTTRTVNPL 120
            AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKF LNTVNGTTRTVNPL
Sbjct  62   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILNTVNGTTRTVNPL 121
Query  121  GFFKKEALPKCAQVYNKLGMYPPNM 145
             F+KKEALPKCAQVYNKLGMYPPNM
Sbjct  122  RFYKKEALPKCAQVYNKLGMYPPNM 146

Sequence Alignment: 5. Allergen Name: Ole e 1.0107 Sequence ID: CAA73036

 Score = 267.3 bits 951,  Expect = 1e-73
 Identities = 134/145 92%, Positives = 142/145 97%, Gaps = 0/145 0%
Query  1    EDIPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTR 60
            ED+PQPPVSQFHIQGQVYCDTCR+ FITELSEFIPGAS+RLQC++KENGD+TFTE+GYTR
Sbjct  2    EDVPQPPVSQFHIQGQVYCDTCRSRFITELSEFIPGASVRLQCREKENGDITFTEIGYTR 61
Query  61   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNTVNGTTRTVNPL 120
            AEGLYSMLVERDHKNEFCEITLISSGRKDC+EIP EGWAKPSLKF LNTVNGTTRTVNPL
Sbjct  62   AEGLYSMLVERDHKNEFCEITLISSGRKDCDEIPIEGWAKPSLKFILNTVNGTTRTVNPL 121
Query  121  GFFKKEALPKCAQVYNKLGMYPPNM 145
            GFFKKEALPKCAQVYNKLGMYPPNM
Sbjct  122  GFFKKEALPKCAQVYNKLGMYPPNM 146

Sequence Alignment: 6. Allergen Name: Fra e 1.0201 Sequence ID: AAQ83588

 Score = 261.2 bits 929,  Expect = 8e-72
 Identities = 130/145 89%, Positives = 139/145 95%, Gaps = 0/145 0%
Query  1    EDIPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTR 60
            ED+PQPPVSQFHIQGQVYCDTCRA FIT+LSEFI GAS+RLQC+DKENGDVTFTE+GYTR
Sbjct  2    EDVPQPPVSQFHIQGQVYCDTCRARFITKLSEFITGASVRLQCRDKENGDVTFTEIGYTR 61
Query  61   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNTVNGTTRTVNPL 120
             EGLYSM+VERDHKNEFCEITL+SSGRKDCNEIP EGW KPSLKF LNTVNGTTRT+NPL
Sbjct  62   GEGLYSMFVERDHKNEFCEITLLSSGRKDCNEIPIEGWVKPSLKFILNTVNGTTRTINPL 121
Query  121  GFFKKEALPKCAQVYNKLGMYPPNM 145
            GFFKKEALP+CAQVYNKLGMYPPNM
Sbjct  122  GFFKKEALPQCAQVYNKLGMYPPNM 146

Sequence Alignment: 7. Allergen Name: Ole e 1.0103 Sequence ID: X76396

 Score = 259.0 bits 921,  Expect = 4e-71
 Identities = 129/145 88%, Positives = 137/145 94%, Gaps = 0/145 0%
Query  1    EDIPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTR 60
            ED+PQPPVSQFHIQGQVYCDTCRA FITELSEFIPGAS+RLQCKD ENG +TFTEVGYTR
Sbjct  1    EDVPQPPVSQFHIQGQVYCDTCRARFITELSEFIPGASVRLQCKDGENGSITFTEVGYTR 60
Query  61   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNTVNGTTRTVNPL 120
            AEGLYSML+ERDHK+EFCEITLISS RKDC+EIP EGW KPSLKF LNTVNGTTRT+NPL
Sbjct  61   AEGLYSMLIERDHKDEFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNTVNGTTRTINPL 120
Query  121  GFFKKEALPKCAQVYNKLGMYPPNM 145
            GFFKKEALPKC QV+NKLGMYPPNM
Sbjct  121  GFFKKEALPKCPQVFNKLGMYPPNM 145

Sequence Alignment: 8. Allergen Name: Lig v 1.0102 Sequence ID: CAA54819

 Score = 255.5 bits 908,  Expect = 4e-70
 Identities = 127/145 87%, Positives = 136/145 93%, Gaps = 0/145 0%
Query  1    EDIPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTR 60
            ED+PQPPVSQF+IQGQVYCDTCRA FITELSEFIPGA +RLQCKD ENG +TFTEVGYTR
Sbjct  1    EDVPQPPVSQFYIQGQVYCDTCRARFITELSEFIPGAGVRLQCKDGENGKITFTEVGYTR 60
Query  61   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNTVNGTTRTVNPL 120
            AEGLYSML+ERDHKNEFCEITL+SS RKDC+EIP EGW KPSLKF LNTVNGTTRT+NPL
Sbjct  61   AEGLYSMLIERDHKNEFCEITLLSSSRKDCDEIPIEGWVKPSLKFMLNTVNGTTRTINPL 120
Query  121  GFFKKEALPKCAQVYNKLGMYPPNM 145
            GFFKKEALPKC QV+NKLGMYPPNM
Sbjct  121  GFFKKEALPKCPQVFNKLGMYPPNM 145

Sequence Alignment: 9. Allergen Name: Fra e 1.0101 Sequence ID: AAQ08947

 Score = 253.8 bits 902,  Expect = 1e-69
 Identities = 126/145 86%, Positives = 135/145 93%, Gaps = 0/145 0%
Query  1    EDIPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTR 60
            ED+PQPPVS F++QGQVYCDTCRAGFITELSEFI GA +RLQCKDKENG VTFTEVGYTR
Sbjct  1    EDVPQPPVSLFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKDKENGKVTFTEVGYTR 60
Query  61   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNTVNGTTRTVNPL 120
            AEGLYSM++ERDHKNEFCEI L+SS RKDC+EIPTEGW KPSLKF LNTVNGTTRT+NPL
Sbjct  61   AEGLYSMVIERDHKNEFCEIVLLSSSRKDCDEIPTEGWVKPSLKFILNTVNGTTRTINPL 120
Query  121  GFFKKEALPKCAQVYNKLGMYPPNM 145
            GFFKKE LPKC QVYNKLGMYPPNM
Sbjct  121  GFFKKEVLPKCPQVYNKLGMYPPNM 145

Sequence Alignment: 10. Allergen Name: Fra e 1.0102 Sequence ID: AAV74343

 Score = 253.3 bits 900,  Expect = 2e-69
 Identities = 126/145 86%, Positives = 136/145 93%, Gaps = 0/145 0%
Query  1    EDIPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTR 60
            ED+PQPPVS F++QGQVYCDTCRAGFITELSEFI GA +RLQCK+KENG VTFTEVGYTR
Sbjct  1    EDVPQPPVSLFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKEKENGKVTFTEVGYTR 60
Query  61   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNTVNGTTRTVNPL 120
            AEGLYSM++ERDHKNEFCEI L+SS RKDC+EIPTEGW KPSLKF LNTVNGTTRT+NPL
Sbjct  61   AEGLYSMVIERDHKNEFCEIVLLSSSRKDCHEIPTEGWVKPSLKFILNTVNGTTRTINPL 120
Query  121  GFFKKEALPKCAQVYNKLGMYPPNM 145
            GFFKKEALPKC QVYNKLGMYPPNM
Sbjct  121  GFFKKEALPKCPQVYNKLGMYPPNM 145

Sequence Alignment: 11. Allergen Name: Ole e 1.0104 Sequence ID: X76397

 Score = 252.7 bits 898,  Expect = 3e-69
 Identities = 123/145 84%, Positives = 136/145 93%, Gaps = 0/145 0%
Query  1    EDIPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTR 60
            ED+PQPP+SQF++QGQVYCDTCR  FITE+SEFIPGA +RLQCKD ENG +TFTEVGYTR
Sbjct  1    EDVPQPPISQFYVQGQVYCDTCRTRFITEFSEFIPGAGVRLQCKDGENGKITFTEVGYTR 60
Query  61   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNTVNGTTRTVNPL 120
            AEGLYSML+ERDHKNEFCEITL+SS RKDC+EIPTEGW KPS+KF LNTVNGTTRT+NPL
Sbjct  61   AEGLYSMLIERDHKNEFCEITLLSSSRKDCDEIPTEGWVKPSVKFILNTVNGTTRTINPL 120
Query  121  GFFKKEALPKCAQVYNKLGMYPPNM 145
            GFFKKEALPKC QV+NKLGMYPPNM
Sbjct  121  GFFKKEALPKCPQVFNKLGMYPPNM 145

Sequence Alignment: 12. Allergen Name: Lig v 1 Sequence ID: O82015

 Score = 252.5 bits 897,  Expect = 3e-69
 Identities = 126/145 86%, Positives = 136/145 93%, Gaps = 0/145 0%
Query  1    EDIPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTR 60
            ED+PQPPVSQF+IQGQVYCDTCRA FITELSEFIPGA +RLQCKD ENG VTFTEVGYT+
Sbjct  1    EDVPQPPVSQFYIQGQVYCDTCRARFITELSEFIPGAGVRLQCKDGENGKVTFTEVGYTK 60
Query  61   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNTVNGTTRTVNPL 120
            AEGLY+ML+ERDHKNEFCEITLISS RKDC+EIPTEGW KPSLKF LNTVNGTTRT+NPL
Sbjct  61   AEGLYNMLIERDHKNEFCEITLISSSRKDCDEIPTEGWVKPSLKFVLNTVNGTTRTINPL 120
Query  121  GFFKKEALPKCAQVYNKLGMYPPNM 145
            GF+KKE LPKC QV+NKLGMYPPNM
Sbjct  121  GFLKKEVLPKCPQVFNKLGMYPPNM 145

Sequence Alignment: 13. Allergen Name: Ole e 1.0101 Sequence ID: AAB32652

 Score = 241.9 bits 858,  Expect = 5e-66
 Identities = 124/130 95%, Positives = 128/130 98%, Gaps = 0/130 0%
Query  16   QVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLYSMLVERDHKN 75
            QVYCDTCRAGFITELSEFIPGAS+RLQCK+K+NGD+TFTEVGYTRAEGLYSMLVERDHKN
Sbjct  1    QVYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHKN 60
Query  76   EFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNTVNGTTRTVNPLGFFKKEALPKCAQVY 135
            EFCEITLISSG KDCNEIPTEGWAKPSLKF LNTVNGTTRTVNPLGFFKKEALPKCAQVY
Sbjct  61   EFCEITLISSGSKDCNEIPTEGWAKPSLKFILNTVNGTTRTVNPLGFFKKEALPKCAQVY 120
Query  136  NKLGMYPPNM 145
            NKLGMYPPNM
Sbjct  121  NKLGMYPPNM 130

Sequence Alignment: 14. Allergen Name: Aca f 1 Sequence ID: A0A0K1SC24

 Score = 131.5 bits 456,  Expect = 9e-33
 Identities = 68/141 48%, Positives = 93/141 65%, Gaps = 4/141 2%
Query  1    EDIPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTR 60
            +D+P+PPVSQFH+QG VYCDTCR  FITE S  + GA+++L+C++   G  TF     T 
Sbjct  1    DDVPKPPVSQFHVQGLVYCDTCRYPFITEASPIMEGATVKLECRNITAGTQTFKAEAVTD 60
Query  61   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNTVNGTT---RTV 117
              G YS+ V+ DH+++ CEI L+ S    C+EIP + +AK S K  L + NG     R+ 
Sbjct  61   KVGQYSIPVDGDHEDDICEIELVKSPDNQCSEIPHDVYAKQSAKVSLTSNNGEASDVRSA 120
Query  118  NPLGFFKKEALPKCAQVYN-KLGMY 141
            N LGF +KE LP+C +V   KL MY
Sbjct  121  NALGFMRKEPLPECPEVLKEKLDMY 145

Sequence Alignment: 15. Allergen Name: Pro j 1.0101 Sequence ID: AKV72167

 Score = 121.6 bits 420,  Expect = 9e-30
 Identities = 64/141 45%, Positives = 90/141 63%, Gaps = 4/141 2%
Query  1    EDIPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTR 60
            +D+ +PPVSQFHIQG VYCDTCR  F+T +S  + GA+++L+C++   G  TF     T 
Sbjct  1    DDVAKPPVSQFHIQGLVYCDTCRIQFMTRVSTIMEGATVKLECRNITAGTQTFKAEAVTD 60
Query  61   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNTVNGTT---RTV 117
              G YS+ V  D +++ CEI L+ S   DC+EIP + +AK S K  L + NG     R+ 
Sbjct  61   KVGQYSIPVNGDFEDDICEIELVKSPNSDCSEIPHDVYAKQSAKVSLTSNNGEASDIRSA 120
Query  118  NPLGFFKKEALPKCAQVYNK-LGMY 141
            N LGF +KE L +C +V  + L MY
Sbjct  121  NALGFMRKEPLKECPEVSKEPLDMY 145

Sequence Alignment: 16. Allergen Name: Ama r 1.0101 Sequence ID: A0A0K1SC10

 Score = 116.3 bits 401,  Expect = 4e-28
 Identities = 59/141 41%, Positives = 88/141 62%, Gaps = 3/141 2%
Query  1    EDIPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTR 60
            +D+ + PVSQFHIQG VYCDTCR  F+T +S  + GA+++L+C++   G  TF     T 
Sbjct  20   DDVAKAPVSQFHIQGLVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVTD 79
Query  61   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNTVNGTT---RTV 117
              G YS+ V  D +++ CEI L+ S   +C+E+  + +AK S K  L + NG     R+ 
Sbjct  80   KVGQYSIPVNGDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRSA 139
Query  118  NPLGFFKKEALPKCAQVYNKLGMY 141
            N LGF +KE L +C +V  +L +Y
Sbjct  140  NALGFMRKEPLEECPEVLKELDLY 163

Sequence Alignment: 17. Allergen Name: Sal k 5.0101 Sequence ID: ADK22842

 Score = 110.1 bits 378,  Expect = 3e-26
 Identities = 53/131 40%, Positives = 84/131 64%, Gaps = 3/131 2%
Query  11   FHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLYSMLVE 70
            +H++G VYCDTCR  FIT +S  + GA++ LQC++   G  TF     T   G+Y++ V+
Sbjct  9    YHVKGMVYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKLGMYTIKVD 68
Query  71   RDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNTVNGTT---RTVNPLGFFKKEA 127
             DH+++ C+I L+ S  ++C+EIP + +++ + K  L + NG     R  N LGF+KK  
Sbjct  69   GDHEDDICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNGEASDVRNANALGFLKKAP 128
Query  128  LPKCAQVYNKLGMY 141
            LP+C +V  +L MY
Sbjct  129  LPECPEVLKELDMY 142

Sequence Alignment: 18. Allergen Name: Lyc e LAT52 Sequence ID: CAA33854

 Score = 105.1 bits 360,  Expect = 9e-25
 Identities = 53/135 39%, Positives = 85/135 62%, Gaps = 4/135 2%
Query  5    QPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGL 64
            +P V  F ++G+VYCDTCR  F T+LSE + GA+++LQC++      TF+  G T  +G 
Sbjct  23   RPEV--FDVEGKVYCDTCRVQFETKLSENLEGATVKLQCRNISTEAETFSVEGVTDKDGK 80
Query  65   YSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNT-VNGTTRTVNPLGFF 123
            Y + V  DH+N+ CE+T++ S R+DC E    G+ K  ++   N  ++   R  NPL F 
Sbjct  81   YKLTVNGDHENDICEVTVVKSPREDCKE-SVSGYEKARIECSDNVGIHNAVRFANPLFFM 139
Query  124  KKEALPKCAQVYNKLGMYP 142
            K E++  C +  ++LG++P
Sbjct  140  KAESVQGCKEALDELGLFP 158

Sequence Alignment: 19. Allergen Name: Che a 1 Sequence ID: AAL07319

 Score = 103.1 bits 353,  Expect = 4e-24
 Identities = 52/133 39%, Positives = 81/133 60%, Gaps = 3/133 2%
Query  9    SQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLYSML 68
            ++F +QG VYCDTCR  F+T +S  + GA+++L+C++   G  TF     T   G YS+ 
Sbjct  28   NHFKVQGMVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIP 87
Query  69   VERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNTVNGTT---RTVNPLGFFKK 125
            V  D +++ CEI L+ S   +C+E+  + +AK S K  L + NG     R+ N LGF +K
Sbjct  88   VNGDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRSANALGFMRK 147
Query  126  EALPKCAQVYNKLGMY 141
            E L +C +V  +L +Y
Sbjct  148  EPLKECPEVLKELDLY 163

Sequence Alignment: 20. Allergen Name: Koc s 1.0101 Sequence ID: A0A0K1SC44

 Score = 102.8 bits 352,  Expect = 4e-24
 Identities = 56/138 40%, Positives = 86/138 62%, Gaps = 8/138 5%
Query  1    EDIPQPPVSQFHIQGQVYCDTCR--AGFITELSEFIPGASLRLQCKDKENGDVTFTEVGY 58
            +D+ + PVSQFHIQG VYCDTC   + ++  + E   GA+++L+C++   G  TF     
Sbjct  20   DDVAKAPVSQFHIQGLVYCDTCPYPSSYVLPMLE---GATVKLECRNITAGTQTFKAEAV 76
Query  59   TRAEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNTVNGTT---R 115
            T   G YS+ V+ D +++ CEI L+ S    C+E+  + +AK S K  L + NG     R
Sbjct  77   TDKVGQYSIPVDGDFEDDICEIELLKSPDNQCSEVSHDVYAKQSAKVSLTSNNGEASDVR 136
Query  116  TVNPLGFFKKEALPKCAQVYNKLGMY 141
            + N LGF +KE L +C +V  +L +Y
Sbjct  137  SANALGFMRKEPLEECPEVLKELDLY 162

Sequence Alignment: 21. Allergen Name: Lol p 11.0101 Sequence ID: Q7M1X5

 Score = 84.7 bits 285,  Expect = 1e-18
 Identities = 42/124 33%, Positives = 66/124 53%, Gaps = 1/124 0%
Query  11   FHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLYSMLVE 70
            F + G+VYCD CRAGF T +S  + GA++ + C+  + G+  +     T  +G Y + ++
Sbjct  6    FVVTGRVYCDPCRAGFETNVSHNVEGATVAVDCRPFDGGESKLKAEATTDKDGWYKIEID 65
Query  71   RDHKNEFCEITLISSGRKDCNEIPT-EGWAKPSLKFKLNTVNGTTRTVNPLGFFKKEALP 129
            +DH+ E CE+ L  S  K C+EI      A+  L           R  NP+ FF+KE L 
Sbjct  66   QDHQEEICEVVLAKSPDKSCSEIEEFRDRARVPLTSNXGIKQQGIRYANPIAFFRKEPLK 125
Query  130  KCAQV 134
            +C  +
Sbjct  126  ECGGI 130

Sequence Alignment: 22. Allergen Name: Pla l 1.0103 Sequence ID: CAC41635

 Score = 84.1 bits 283,  Expect = 1e-18
 Identities = 51/119 42%, Positives = 77/119 64%, Gaps = 10/119 8%
Query  9    SQFHIQGQVYCDTCRA-GFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLYSM 67
            ++FH++G+VYC+ C +  +I ELSE + GA ++L CKD ++  V ++  G T  +G+Y +
Sbjct  7    AKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKD-DSKKVIYSIGGETGQDGVYRL 65
Query  68   LVERDHKNEFCEITLISSGRKDCNEIP--TEGWAKPSLKFKLN---TVNGTTRTVNPLGF 122
             V   H++  CEI L+ SGR DC+EIP   +G  + S K  L+   T+   TR V PL F
Sbjct  66   PVVGYHED--CEIKLVKSGRPDCSEIPKLAKGTIQTS-KVDLSKNTTITEKTRHVKPLSF 122
Query  123  FKKEALPKC 131
              K   P C
Sbjct  123  RAKTDAPGC 131

Sequence Alignment: 23. Allergen Name: Pla l 1 Sequence ID: P82242

 Score = 82.2 bits 276,  Expect = 6e-18
 Identities = 50/119 42%, Positives = 76/119 63%, Gaps = 10/119 8%
Query  9    SQFHIQGQVYCDTCRA-GFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLYSM 67
            ++FH++G+VYC+ C +  +I ELSE + GA ++L CKD ++  V ++  G T  +G+Y +
Sbjct  7    AKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKD-DSKKVIYSIGGETDQDGVYRL 65
Query  68   LVERDHKNEFCEITLISSGRKDCNEIP--TEGWAKPSLKFKLN---TVNGTTRTVNPLGF 122
             V   H++  CEI L+ S R DC+EIP   +G  + S K  L+   T+   TR V PL F
Sbjct  66   PVVGYHED--CEIKLVKSSRPDCSEIPKLAKGTIQTS-KVDLSKNTTITEKTRHVKPLSF 122
Query  123  FKKEALPKC 131
              K   P C
Sbjct  123  RAKTDAPGC 131

Sequence Alignment: 24. Allergen Name: Phl p 11.0101 Sequence ID: AAN32987

 Score = 81.0 bits 272,  Expect = 1e-17
 Identities = 42/121 34%, Positives = 66/121 54%, Gaps = 7/121 5%
Query  11   FHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLYSMLVE 70
            F + G+VYCD CRAGF T +S  + GA++ + C+    G+  +     T   G Y + ++
Sbjct  6    FVVTGRVYCDPCRAGFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGLGWYKIEID 65
Query  71   RDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNTVNGTT----RTVNPLGFFKKE 126
            +DH+ E CE+ L  S    C+EI      +   +  L + NG      R  NP+ FF+KE
Sbjct  66   QDHQEEICEVVLAKSPDTTCSEIEEF---RDRARVPLTSNNGIKQQGIRYANPIAFFRKE 122
Query  127  ALPKCAQV 134
             L +C  +
Sbjct  123  PLKECGGI 130

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.