The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

EDVPQPPISQFYVQGQVYCDTCRTRFITEFSEFIPGAGVRLQCKDGENGKITFTEVGYTR
AEGLYSMLIERDHKNEFCEITLLSSSRKDCDEIPTEGWVKPSVKFILNTVNGTTRTINPL
GFFKKEALPKCPQVFNKLGMYPPNM
Sequence Info Allergen Name Length Opt Bits Score E Value
X76397 Ole e 1.0104 145 1007 316.7 1.6e-88
CAA54819 Lig v 1.0102 145 980 308.3 5.3e-86
O82015 Lig v 1 145 964 303.4 1.6e-84
X76396 Ole e 1.0103 145 953 300.0 1.7e-83
AAQ08947 Fra e 1.0101 145 931 293.1 1.9e-81
AAV74343 Fra e 1.0102 145 921 290.0 1.7e-80
CAA73036 Ole e 1.0107 146 914 287.9 7.6e-80
X76395 Ole e 1.0102 145 912 287.3 1.1e-79
CAA73037 Ole e 1.0106 146 900 283.5 1.5e-78
P19963 Ole e 1 145 898 282.9 2.3e-78
CAA73038 Ole e 1.0105 146 895 282.0 4.5e-78
AAQ83588 Fra e 1.0201 146 891 280.8 1.1e-77
AAB32652 Ole e 1.0101 130 792 250.2 1.5e-68
A0A0K1SC24 Aca f 1 150 448 143.6 2.2e-36
AKV72167 Pro j 1.0101 150 410 131.8 7.5e-33
A0A0K1SC10 Ama r 1.0101 168 394 126.7 2.8e-31
ADK22842 Sal k 5.0101 151 377 121.6 9e-30
AAL07319 Che a 1 168 354 114.4 1.5e-27
CAA33854 Lyc e LAT52 161 350 113.2 3.3e-27
A0A0K1SC44 Koc s 1.0101 167 347 112.2 6.6e-27
P82242 Pla l 1 131 285 93.2 2.7e-21
CAC41635 Pla l 1.0103 131 279 91.3 9.8e-21
Q7M1X5 Lol p 11.0101 134 262 86.1 3.9e-19
AAN32987 Phl p 11.0101 143 256 84.2 1.6e-18
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ole e 1.0104 Sequence ID: X76397

 Score = 316.7 bits 1007,  Expect = 2e-88
 Identities = 145/145 100%, Positives = 145/145 100%, Gaps = 0/145 0%
Query  1    EDVPQPPISQFYVQGQVYCDTCRTRFITEFSEFIPGAGVRLQCKDGENGKITFTEVGYTR 60
            EDVPQPPISQFYVQGQVYCDTCRTRFITEFSEFIPGAGVRLQCKDGENGKITFTEVGYTR
Sbjct  1    EDVPQPPISQFYVQGQVYCDTCRTRFITEFSEFIPGAGVRLQCKDGENGKITFTEVGYTR 60
Query  61   AEGLYSMLIERDHKNEFCEITLLSSSRKDCDEIPTEGWVKPSVKFILNTVNGTTRTINPL 120
            AEGLYSMLIERDHKNEFCEITLLSSSRKDCDEIPTEGWVKPSVKFILNTVNGTTRTINPL
Sbjct  61   AEGLYSMLIERDHKNEFCEITLLSSSRKDCDEIPTEGWVKPSVKFILNTVNGTTRTINPL 120
Query  121  GFFKKEALPKCPQVFNKLGMYPPNM 145
            GFFKKEALPKCPQVFNKLGMYPPNM
Sbjct  121  GFFKKEALPKCPQVFNKLGMYPPNM 145

Sequence Alignment: 2. Allergen Name: Lig v 1.0102 Sequence ID: CAA54819

 Score = 308.3 bits 980,  Expect = 5e-86
 Identities = 138/145 95%, Positives = 143/145 98%, Gaps = 0/145 0%
Query  1    EDVPQPPISQFYVQGQVYCDTCRTRFITEFSEFIPGAGVRLQCKDGENGKITFTEVGYTR 60
            EDVPQPP+SQFY+QGQVYCDTCR RFITE+SEFIPGAGVRLQCKDGENGKITFTEVGYTR
Sbjct  1    EDVPQPPVSQFYIQGQVYCDTCRARFITELSEFIPGAGVRLQCKDGENGKITFTEVGYTR 60
Query  61   AEGLYSMLIERDHKNEFCEITLLSSSRKDCDEIPTEGWVKPSVKFILNTVNGTTRTINPL 120
            AEGLYSMLIERDHKNEFCEITLLSSSRKDCDEIP EGWVKPS+KF+LNTVNGTTRTINPL
Sbjct  61   AEGLYSMLIERDHKNEFCEITLLSSSRKDCDEIPIEGWVKPSLKFMLNTVNGTTRTINPL 120
Query  121  GFFKKEALPKCPQVFNKLGMYPPNM 145
            GFFKKEALPKCPQVFNKLGMYPPNM
Sbjct  121  GFFKKEALPKCPQVFNKLGMYPPNM 145

Sequence Alignment: 3. Allergen Name: Lig v 1 Sequence ID: O82015

 Score = 303.4 bits 964,  Expect = 2e-84
 Identities = 133/145 91%, Positives = 143/145 98%, Gaps = 0/145 0%
Query  1    EDVPQPPISQFYVQGQVYCDTCRTRFITEFSEFIPGAGVRLQCKDGENGKITFTEVGYTR 60
            EDVPQPP+SQFY+QGQVYCDTCR RFITE+SEFIPGAGVRLQCKDGENGK+TFTEVGYT+
Sbjct  1    EDVPQPPVSQFYIQGQVYCDTCRARFITELSEFIPGAGVRLQCKDGENGKVTFTEVGYTK 60
Query  61   AEGLYSMLIERDHKNEFCEITLLSSSRKDCDEIPTEGWVKPSVKFILNTVNGTTRTINPL 120
            AEGLY+MLIERDHKNEFCEITL+SSSRKDCDEIPTEGWVKPS+KF+LNTVNGTTRTINPL
Sbjct  61   AEGLYNMLIERDHKNEFCEITLISSSRKDCDEIPTEGWVKPSLKFVLNTVNGTTRTINPL 120
Query  121  GFFKKEALPKCPQVFNKLGMYPPNM 145
            GF+KKE LPKCPQVFNKLGMYPPNM
Sbjct  121  GFLKKEVLPKCPQVFNKLGMYPPNM 145

Sequence Alignment: 4. Allergen Name: Ole e 1.0103 Sequence ID: X76396

 Score = 300.0 bits 953,  Expect = 2e-83
 Identities = 133/145 91%, Positives = 141/145 97%, Gaps = 0/145 0%
Query  1    EDVPQPPISQFYVQGQVYCDTCRTRFITEFSEFIPGAGVRLQCKDGENGKITFTEVGYTR 60
            EDVPQPP+SQF++QGQVYCDTCR RFITE+SEFIPGA VRLQCKDGENG ITFTEVGYTR
Sbjct  1    EDVPQPPVSQFHIQGQVYCDTCRARFITELSEFIPGASVRLQCKDGENGSITFTEVGYTR 60
Query  61   AEGLYSMLIERDHKNEFCEITLLSSSRKDCDEIPTEGWVKPSVKFILNTVNGTTRTINPL 120
            AEGLYSMLIERDHK+EFCEITL+SSSRKDCDEIP EGWVKPS+KF+LNTVNGTTRTINPL
Sbjct  61   AEGLYSMLIERDHKDEFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNTVNGTTRTINPL 120
Query  121  GFFKKEALPKCPQVFNKLGMYPPNM 145
            GFFKKEALPKCPQVFNKLGMYPPNM
Sbjct  121  GFFKKEALPKCPQVFNKLGMYPPNM 145

Sequence Alignment: 5. Allergen Name: Fra e 1.0101 Sequence ID: AAQ08947

 Score = 293.1 bits 931,  Expect = 2e-81
 Identities = 132/145 91%, Positives = 138/145 95%, Gaps = 0/145 0%
Query  1    EDVPQPPISQFYVQGQVYCDTCRTRFITEFSEFIPGAGVRLQCKDGENGKITFTEVGYTR 60
            EDVPQPP+S FYVQGQVYCDTCR  FITE+SEFI GAGVRLQCKD ENGK+TFTEVGYTR
Sbjct  1    EDVPQPPVSLFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKDKENGKVTFTEVGYTR 60
Query  61   AEGLYSMLIERDHKNEFCEITLLSSSRKDCDEIPTEGWVKPSVKFILNTVNGTTRTINPL 120
            AEGLYSM+IERDHKNEFCEI LLSSSRKDCDEIPTEGWVKPS+KFILNTVNGTTRTINPL
Sbjct  61   AEGLYSMVIERDHKNEFCEIVLLSSSRKDCDEIPTEGWVKPSLKFILNTVNGTTRTINPL 120
Query  121  GFFKKEALPKCPQVFNKLGMYPPNM 145
            GFFKKE LPKCPQV+NKLGMYPPNM
Sbjct  121  GFFKKEVLPKCPQVYNKLGMYPPNM 145

Sequence Alignment: 6. Allergen Name: Fra e 1.0102 Sequence ID: AAV74343

 Score = 290.0 bits 921,  Expect = 2e-80
 Identities = 131/145 90%, Positives = 138/145 95%, Gaps = 0/145 0%
Query  1    EDVPQPPISQFYVQGQVYCDTCRTRFITEFSEFIPGAGVRLQCKDGENGKITFTEVGYTR 60
            EDVPQPP+S FYVQGQVYCDTCR  FITE+SEFI GAGVRLQCK+ ENGK+TFTEVGYTR
Sbjct  1    EDVPQPPVSLFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKEKENGKVTFTEVGYTR 60
Query  61   AEGLYSMLIERDHKNEFCEITLLSSSRKDCDEIPTEGWVKPSVKFILNTVNGTTRTINPL 120
            AEGLYSM+IERDHKNEFCEI LLSSSRKDC EIPTEGWVKPS+KFILNTVNGTTRTINPL
Sbjct  61   AEGLYSMVIERDHKNEFCEIVLLSSSRKDCHEIPTEGWVKPSLKFILNTVNGTTRTINPL 120
Query  121  GFFKKEALPKCPQVFNKLGMYPPNM 145
            GFFKKEALPKCPQV+NKLGMYPPNM
Sbjct  121  GFFKKEALPKCPQVYNKLGMYPPNM 145

Sequence Alignment: 7. Allergen Name: Ole e 1.0107 Sequence ID: CAA73036

 Score = 287.9 bits 914,  Expect = 8e-80
 Identities = 125/145 86%, Positives = 138/145 95%, Gaps = 0/145 0%
Query  1    EDVPQPPISQFYVQGQVYCDTCRTRFITEFSEFIPGAGVRLQCKDGENGKITFTEVGYTR 60
            EDVPQPP+SQF++QGQVYCDTCR+RFITE+SEFIPGA VRLQC++ ENG ITFTE+GYTR
Sbjct  2    EDVPQPPVSQFHIQGQVYCDTCRSRFITELSEFIPGASVRLQCREKENGDITFTEIGYTR 61
Query  61   AEGLYSMLIERDHKNEFCEITLLSSSRKDCDEIPTEGWVKPSVKFILNTVNGTTRTINPL 120
            AEGLYSML+ERDHKNEFCEITL+SS RKDCDEIP EGW KPS+KFILNTVNGTTRT+NPL
Sbjct  62   AEGLYSMLVERDHKNEFCEITLISSGRKDCDEIPIEGWAKPSLKFILNTVNGTTRTVNPL 121
Query  121  GFFKKEALPKCPQVFNKLGMYPPNM 145
            GFFKKEALPKC QV+NKLGMYPPNM
Sbjct  122  GFFKKEALPKCAQVYNKLGMYPPNM 146

Sequence Alignment: 8. Allergen Name: Ole e 1.0102 Sequence ID: X76395

 Score = 287.3 bits 912,  Expect = 1e-79
 Identities = 126/145 86%, Positives = 138/145 95%, Gaps = 0/145 0%
Query  1    EDVPQPPISQFYVQGQVYCDTCRTRFITEFSEFIPGAGVRLQCKDGENGKITFTEVGYTR 60
            EDVPQPP+SQF++QGQVYCDTCR  FITE+SEFIPGA +RLQCKD ENG +TFTEVGYTR
Sbjct  1    EDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTR 60
Query  61   AEGLYSMLIERDHKNEFCEITLLSSSRKDCDEIPTEGWVKPSVKFILNTVNGTTRTINPL 120
            AEGLYSML+ERDHKNEFCEITL+SS RKDC+EIPTEGWVKPS+KFILNTVNGTTRT+NPL
Sbjct  61   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWVKPSLKFILNTVNGTTRTVNPL 120
Query  121  GFFKKEALPKCPQVFNKLGMYPPNM 145
            GFFKKEALPKC QV+NKLGMYPPNM
Sbjct  121  GFFKKEALPKCAQVYNKLGMYPPNM 145

Sequence Alignment: 9. Allergen Name: Ole e 1.0106 Sequence ID: CAA73037

 Score = 283.5 bits 900,  Expect = 2e-78
 Identities = 123/145 84%, Positives = 137/145 94%, Gaps = 0/145 0%
Query  1    EDVPQPPISQFYVQGQVYCDTCRTRFITEFSEFIPGAGVRLQCKDGENGKITFTEVGYTR 60
            EDVPQPP+SQF++QGQVYCDTCR  FITE+SEFIPGA VRLQCKD ENG +TFTE+GYTR
Sbjct  2    EDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTR 61
Query  61   AEGLYSMLIERDHKNEFCEITLLSSSRKDCDEIPTEGWVKPSVKFILNTVNGTTRTINPL 120
            AEGLYSML+ERDHKNEFCEITL+SS RKDC+EIPTEGW KPS+KFIL+TVNGTTRT+NPL
Sbjct  62   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILSTVNGTTRTVNPL 121
Query  121  GFFKKEALPKCPQVFNKLGMYPPNM 145
            GF+KKEALPKC QV+NKLGMYPPNM
Sbjct  122  GFYKKEALPKCAQVYNKLGMYPPNM 146

Sequence Alignment: 10. Allergen Name: Ole e 1 Sequence ID: P19963

 Score = 282.9 bits 898,  Expect = 2e-78
 Identities = 123/145 84%, Positives = 136/145 93%, Gaps = 0/145 0%
Query  1    EDVPQPPISQFYVQGQVYCDTCRTRFITEFSEFIPGAGVRLQCKDGENGKITFTEVGYTR 60
            ED+PQPP+SQF++QGQVYCDTCR  FITE+SEFIPGA +RLQCKD ENG +TFTEVGYTR
Sbjct  1    EDIPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTR 60
Query  61   AEGLYSMLIERDHKNEFCEITLLSSSRKDCDEIPTEGWVKPSVKFILNTVNGTTRTINPL 120
            AEGLYSML+ERDHKNEFCEITL+SS RKDC+EIPTEGW KPS+KF LNTVNGTTRT+NPL
Sbjct  61   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNTVNGTTRTVNPL 120
Query  121  GFFKKEALPKCPQVFNKLGMYPPNM 145
            GFFKKEALPKC QV+NKLGMYPPNM
Sbjct  121  GFFKKEALPKCAQVYNKLGMYPPNM 145

Sequence Alignment: 11. Allergen Name: Ole e 1.0105 Sequence ID: CAA73038

 Score = 282.0 bits 895,  Expect = 4e-78
 Identities = 123/145 84%, Positives = 136/145 93%, Gaps = 0/145 0%
Query  1    EDVPQPPISQFYVQGQVYCDTCRTRFITEFSEFIPGAGVRLQCKDGENGKITFTEVGYTR 60
            EDVPQPP+SQF++QGQVYCDTCR  FITE+SEFIPGA VRLQCKD ENG +TFTE+GYTR
Sbjct  2    EDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTR 61
Query  61   AEGLYSMLIERDHKNEFCEITLLSSSRKDCDEIPTEGWVKPSVKFILNTVNGTTRTINPL 120
            AEGLYSML+ERDHKNEFCEITL+SS RKDC+EIPTEGW KPS+KFILNTVNGTTRT+NPL
Sbjct  62   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILNTVNGTTRTVNPL 121
Query  121  GFFKKEALPKCPQVFNKLGMYPPNM 145
             F+KKEALPKC QV+NKLGMYPPNM
Sbjct  122  RFYKKEALPKCAQVYNKLGMYPPNM 146

Sequence Alignment: 12. Allergen Name: Fra e 1.0201 Sequence ID: AAQ83588

 Score = 280.8 bits 891,  Expect = 1e-77
 Identities = 122/145 84%, Positives = 136/145 93%, Gaps = 0/145 0%
Query  1    EDVPQPPISQFYVQGQVYCDTCRTRFITEFSEFIPGAGVRLQCKDGENGKITFTEVGYTR 60
            EDVPQPP+SQF++QGQVYCDTCR RFIT++SEFI GA VRLQC+D ENG +TFTE+GYTR
Sbjct  2    EDVPQPPVSQFHIQGQVYCDTCRARFITKLSEFITGASVRLQCRDKENGDVTFTEIGYTR 61
Query  61   AEGLYSMLIERDHKNEFCEITLLSSSRKDCDEIPTEGWVKPSVKFILNTVNGTTRTINPL 120
             EGLYSM++ERDHKNEFCEITLLSS RKDC+EIP EGWVKPS+KFILNTVNGTTRTINPL
Sbjct  62   GEGLYSMFVERDHKNEFCEITLLSSGRKDCNEIPIEGWVKPSLKFILNTVNGTTRTINPL 121
Query  121  GFFKKEALPKCPQVFNKLGMYPPNM 145
            GFFKKEALP+C QV+NKLGMYPPNM
Sbjct  122  GFFKKEALPQCAQVYNKLGMYPPNM 146

Sequence Alignment: 13. Allergen Name: Ole e 1.0101 Sequence ID: AAB32652

 Score = 250.2 bits 792,  Expect = 1e-68
 Identities = 112/130 86%, Positives = 121/130 93%, Gaps = 0/130 0%
Query  16   QVYCDTCRTRFITEFSEFIPGAGVRLQCKDGENGKITFTEVGYTRAEGLYSMLIERDHKN 75
            QVYCDTCR  FITE+SEFIPGA VRLQCK+ +NG ITFTEVGYTRAEGLYSML+ERDHKN
Sbjct  1    QVYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHKN 60
Query  76   EFCEITLLSSSRKDCDEIPTEGWVKPSVKFILNTVNGTTRTINPLGFFKKEALPKCPQVF 135
            EFCEITL+SS  KDC+EIPTEGW KPS+KFILNTVNGTTRT+NPLGFFKKEALPKC QV+
Sbjct  61   EFCEITLISSGSKDCNEIPTEGWAKPSLKFILNTVNGTTRTVNPLGFFKKEALPKCAQVY 120
Query  136  NKLGMYPPNM 145
            NKLGMYPPNM
Sbjct  121  NKLGMYPPNM 130

Sequence Alignment: 14. Allergen Name: Aca f 1 Sequence ID: A0A0K1SC24

 Score = 143.6 bits 448,  Expect = 2e-36
 Identities = 68/141 48%, Positives = 92/141 65%, Gaps = 4/141 2%
Query  1    EDVPQPPISQFYVQGQVYCDTCRTRFITEFSEFIPGAGVRLQCKDGENGKITFTEVGYTR 60
            +DVP+PP+SQF+VQG VYCDTCR  FITE S  + GA V+L+C++   G  TF     T 
Sbjct  1    DDVPKPPVSQFHVQGLVYCDTCRYPFITEASPIMEGATVKLECRNITAGTQTFKAEAVTD 60
Query  61   AEGLYSMLIERDHKNEFCEITLLSSSRKDCDEIPTEGWVKPSVKFILNTVNGTT---RTI 117
              G YS+ ++ DH+++ CEI L+ S    C EIP + + K S K  L + NG     R+ 
Sbjct  61   KVGQYSIPVDGDHEDDICEIELVKSPDNQCSEIPHDVYAKQSAKVSLTSNNGEASDVRSA 120
Query  118  NPLGFFKKEALPKCPQVFN-KLGMY 141
            N LGF +KE LP+CP+V+  KL MY
Sbjct  121  NALGFMRKEPLPECPEVLKEKLDMY 145

Sequence Alignment: 15. Allergen Name: Pro j 1.0101 Sequence ID: AKV72167

 Score = 131.8 bits 410,  Expect = 7e-33
 Identities = 62/141 43%, Positives = 88/141 62%, Gaps = 4/141 2%
Query  1    EDVPQPPISQFYVQGQVYCDTCRTRFITEFSEFIPGAGVRLQCKDGENGKITFTEVGYTR 60
            +DV +PP+SQF++QG VYCDTCR +F+T  S  + GA V+L+C++   G  TF     T 
Sbjct  1    DDVAKPPVSQFHIQGLVYCDTCRIQFMTRVSTIMEGATVKLECRNITAGTQTFKAEAVTD 60
Query  61   AEGLYSMLIERDHKNEFCEITLLSSSRKDCDEIPTEGWVKPSVKFILNTVNGTT---RTI 117
              G YS+ +  D +++ CEI L+ S   DC EIP + + K S K  L + NG     R+ 
Sbjct  61   KVGQYSIPVNGDFEDDICEIELVKSPNSDCSEIPHDVYAKQSAKVSLTSNNGEASDIRSA 120
Query  118  NPLGFFKKEALPKCPQVFNK-LGMY 141
            N LGF +KE L +CP+V  + L MY
Sbjct  121  NALGFMRKEPLKECPEVSKEPLDMY 145

Sequence Alignment: 16. Allergen Name: Ama r 1.0101 Sequence ID: A0A0K1SC10

 Score = 126.7 bits 394,  Expect = 3e-31
 Identities = 57/141 40%, Positives = 87/141 61%, Gaps = 3/141 2%
Query  1    EDVPQPPISQFYVQGQVYCDTCRTRFITEFSEFIPGAGVRLQCKDGENGKITFTEVGYTR 60
            +DV + P+SQF++QG VYCDTCR +F+T  S  + GA V+L+C++   G  TF     T 
Sbjct  20   DDVAKAPVSQFHIQGLVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVTD 79
Query  61   AEGLYSMLIERDHKNEFCEITLLSSSRKDCDEIPTEGWVKPSVKFILNTVNGTT---RTI 117
              G YS+ +  D +++ CEI L+ S   +C E+  + + K S K  L + NG     R+ 
Sbjct  80   KVGQYSIPVNGDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRSA 139
Query  118  NPLGFFKKEALPKCPQVFNKLGMY 141
            N LGF +KE L +CP+V+ +L +Y
Sbjct  140  NALGFMRKEPLEECPEVLKELDLY 163

Sequence Alignment: 17. Allergen Name: Sal k 5.0101 Sequence ID: ADK22842

 Score = 121.6 bits 377,  Expect = 9e-30
 Identities = 54/131 41%, Positives = 83/131 63%, Gaps = 3/131 2%
Query  11   FYVQGQVYCDTCRTRFITEFSEFIPGAGVRLQCKDGENGKITFTEVGYTRAEGLYSMLIE 70
            ++V+G VYCDTCR +FIT  S  + GA V LQC++   G  TF     T   G+Y++ ++
Sbjct  9    YHVKGMVYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKLGMYTIKVD 68
Query  71   RDHKNEFCEITLLSSSRKDCDEIPTEGWVKPSVKFILNTVNGTT---RTINPLGFFKKEA 127
             DH+++ C+I L+ S  ++C EIP + + + + K  L + NG     R  N LGF+KK  
Sbjct  69   GDHEDDICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNGEASDVRNANALGFLKKAP 128
Query  128  LPKCPQVFNKLGMY 141
            LP+CP+V+ +L MY
Sbjct  129  LPECPEVLKELDMY 142

Sequence Alignment: 18. Allergen Name: Che a 1 Sequence ID: AAL07319

 Score = 114.4 bits 354,  Expect = 1e-27
 Identities = 53/133 39%, Positives = 80/133 60%, Gaps = 3/133 2%
Query  9    SQFYVQGQVYCDTCRTRFITEFSEFIPGAGVRLQCKDGENGKITFTEVGYTRAEGLYSML 68
            ++F VQG VYCDTCR +F+T  S  + GA V+L+C++   G  TF     T   G YS+ 
Sbjct  28   NHFKVQGMVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIP 87
Query  69   IERDHKNEFCEITLLSSSRKDCDEIPTEGWVKPSVKFILNTVNGTT---RTINPLGFFKK 125
            +  D +++ CEI L+ S   +C E+  + + K S K  L + NG     R+ N LGF +K
Sbjct  88   VNGDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRSANALGFMRK 147
Query  126  EALPKCPQVFNKLGMY 141
            E L +CP+V+ +L +Y
Sbjct  148  EPLKECPEVLKELDLY 163

Sequence Alignment: 19. Allergen Name: Lyc e LAT52 Sequence ID: CAA33854

 Score = 113.2 bits 350,  Expect = 3e-27
 Identities = 51/131 38%, Positives = 83/131 63%, Gaps = 2/131 1%
Query  11   FYVQGQVYCDTCRTRFITEFSEFIPGAGVRLQCKDGENGKITFTEVGYTRAEGLYSMLIE 70
            F V+G+VYCDTCR +F T++SE + GA V+LQC++      TF+  G T  +G Y + + 
Sbjct  27   FDVEGKVYCDTCRVQFETKLSENLEGATVKLQCRNISTEAETFSVEGVTDKDGKYKLTVN 86
Query  71   RDHKNEFCEITLLSSSRKDCDEIPTEGWVKPSVKFILNT-VNGTTRTINPLGFFKKEALP 129
             DH+N+ CE+T++ S R+DC E    G+ K  ++   N  ++   R  NPL F K E++ 
Sbjct  87   GDHENDICEVTVVKSPREDCKE-SVSGYEKARIECSDNVGIHNAVRFANPLFFMKAESVQ 145
Query  130  KCPQVFNKLGMYP 142
             C + +++LG++P
Sbjct  146  GCKEALDELGLFP 158

Sequence Alignment: 20. Allergen Name: Koc s 1.0101 Sequence ID: A0A0K1SC44

 Score = 112.2 bits 347,  Expect = 7e-27
 Identities = 55/138 39%, Positives = 84/138 60%, Gaps = 8/138 5%
Query  1    EDVPQPPISQFYVQGQVYCDTCR--TRFITEFSEFIPGAGVRLQCKDGENGKITFTEVGY 58
            +DV + P+SQF++QG VYCDTC   + ++    E   GA V+L+C++   G  TF     
Sbjct  20   DDVAKAPVSQFHIQGLVYCDTCPYPSSYVLPMLE---GATVKLECRNITAGTQTFKAEAV 76
Query  59   TRAEGLYSMLIERDHKNEFCEITLLSSSRKDCDEIPTEGWVKPSVKFILNTVNGTT---R 115
            T   G YS+ ++ D +++ CEI LL S    C E+  + + K S K  L + NG     R
Sbjct  77   TDKVGQYSIPVDGDFEDDICEIELLKSPDNQCSEVSHDVYAKQSAKVSLTSNNGEASDVR 136
Query  116  TINPLGFFKKEALPKCPQVFNKLGMY 141
            + N LGF +KE L +CP+V+ +L +Y
Sbjct  137  SANALGFMRKEPLEECPEVLKELDLY 162

Sequence Alignment: 21. Allergen Name: Pla l 1 Sequence ID: P82242

 Score = 93.2 bits 285,  Expect = 3e-21
 Identities = 50/120 41%, Positives = 79/120 65%, Gaps = 8/120 6%
Query  9    SQFYVQGQVYCDTCRTR-FITEFSEFIPGAGVRLQCKDGENGKITFTEVGYTRAEGLYSM 67
            ++F+V+G+VYC+ C +R +I E+SE + GA V+L CKD ++ K+ ++  G T  +G+Y +
Sbjct  7    AKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKD-DSKKVIYSIGGETDQDGVYRL 65
Query  68   LIERDHKNEFCEITLLSSSRKDCDEIP--TEGWVKPS-VKFILNT-VNGTTRTINPLGFF 123
             +   H++  CEI L+ SSR DC EIP   +G ++ S V +  NT +   TR + PL F 
Sbjct  66   PVVGYHED--CEIKLVKSSRPDCSEIPKLAKGTIQTSKVDLSKNTTITEKTRHVKPLSFR 123
Query  124  KKEALPKC 131
             K   P C
Sbjct  124  AKTDAPGC 131

Sequence Alignment: 22. Allergen Name: Pla l 1.0103 Sequence ID: CAC41635

 Score = 91.3 bits 279,  Expect = 1e-20
 Identities = 49/120 40%, Positives = 78/120 65%, Gaps = 8/120 6%
Query  9    SQFYVQGQVYCDTCRTR-FITEFSEFIPGAGVRLQCKDGENGKITFTEVGYTRAEGLYSM 67
            ++F+V+G+VYC+ C +R +I E+SE + GA V+L CKD ++ K+ ++  G T  +G+Y +
Sbjct  7    AKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKD-DSKKVIYSIGGETGQDGVYRL 65
Query  68   LIERDHKNEFCEITLLSSSRKDCDEIP--TEGWVKPS-VKFILNT-VNGTTRTINPLGFF 123
             +   H++  CEI L+ S R DC EIP   +G ++ S V +  NT +   TR + PL F 
Sbjct  66   PVVGYHED--CEIKLVKSGRPDCSEIPKLAKGTIQTSKVDLSKNTTITEKTRHVKPLSFR 123
Query  124  KKEALPKC 131
             K   P C
Sbjct  124  AKTDAPGC 131

Sequence Alignment: 23. Allergen Name: Lol p 11.0101 Sequence ID: Q7M1X5

 Score = 86.1 bits 262,  Expect = 4e-19
 Identities = 43/122 35%, Positives = 64/122 52%, Gaps = 7/122 5%
Query  11   FYVQGQVYCDTCRTRFITEFSEFIPGAGVRLQCKDGENGKITFTEVGYTRAEGLYSMLIE 70
            F V G+VYCD CR  F T  S  + GA V + C+  + G+  +     T  +G Y + I+
Sbjct  6    FVVTGRVYCDPCRAGFETNVSHNVEGATVAVDCRPFDGGESKLKAEATTDKDGWYKIEID 65
Query  71   RDHKNEFCEITLLSSSRKDCDEIPTEGWVKPSVKFILNTVNGTT----RTINPLGFFKKE 126
            +DH+ E CE+ L  S  K C EI      +   +  L +  G      R  NP+ FF+KE
Sbjct  66   QDHQEEICEVVLAKSPDKSCSEIEE---FRDRARVPLTSNXGIKQQGIRYANPIAFFRKE 122
Query  127  ALPKCPQVF 135
             L +C  ++
Sbjct  123  PLKECGGIL 131

Sequence Alignment: 24. Allergen Name: Phl p 11.0101 Sequence ID: AAN32987

 Score = 84.2 bits 256,  Expect = 2e-18
 Identities = 43/122 35%, Positives = 62/122 50%, Gaps = 7/122 5%
Query  11   FYVQGQVYCDTCRTRFITEFSEFIPGAGVRLQCKDGENGKITFTEVGYTRAEGLYSMLIE 70
            F V G+VYCD CR  F T  S  + GA V + C+    G+  +     T   G Y + I+
Sbjct  6    FVVTGRVYCDPCRAGFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGLGWYKIEID 65
Query  71   RDHKNEFCEITLLSSSRKDCDEIPTEGWVKPSVKFILNTVNGTT----RTINPLGFFKKE 126
            +DH+ E CE+ L  S    C EI      +   +  L + NG      R  NP+ FF+KE
Sbjct  66   QDHQEEICEVVLAKSPDTTCSEIEE---FRDRARVPLTSNNGIKQQGIRYANPIAFFRKE 122
Query  127  ALPKCPQVF 135
             L +C  ++
Sbjct  123  PLKECGGIL 131

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.