The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

EDVPQPPVSQFHIQGQVYCDTCRARFITELSEFIPGASVRLQCKDGENGSITFTEVGYTR
AEGLYSMLIERDHKDEFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNTVNGTTRTINPL
GFFKKEALPKCPQVFNKLGMYPPNM
Sequence Info Allergen Name Length Opt Bits Score E Value
X76396 Ole e 1.0103 145 1005 307.7 8e-86
CAA54819 Lig v 1.0102 145 977 299.3 2.7e-83
X76397 Ole e 1.0104 145 953 292.1 4e-81
O82015 Lig v 1 145 949 290.9 9.3e-81
CAA73036 Ole e 1.0107 146 937 287.3 1.1e-79
X76395 Ole e 1.0102 145 931 285.5 3.9e-79
P19963 Ole e 1 145 921 282.5 3.2e-78
CAA73037 Ole e 1.0106 146 919 281.9 4.8e-78
CAA73038 Ole e 1.0105 146 914 280.4 1.4e-77
AAQ83588 Fra e 1.0201 146 914 280.4 1.4e-77
AAQ08947 Fra e 1.0101 145 908 278.6 4.7e-77
AAV74343 Fra e 1.0102 145 898 275.6 3.8e-76
AAB32652 Ole e 1.0101 130 801 246.5 1.9e-67
A0A0K1SC24 Aca f 1 150 470 146.9 2.1e-37
AKV72167 Pro j 1.0101 150 435 136.4 3.1e-34
A0A0K1SC10 Ama r 1.0101 168 419 131.5 1e-32
ADK22842 Sal k 5.0101 151 397 125.0 8.5e-31
AAL07319 Che a 1 168 370 116.8 2.8e-28
A0A0K1SC44 Koc s 1.0101 167 366 115.6 6.4e-28
CAA33854 Lyc e LAT52 161 364 115.0 9.1e-28
P82242 Pla l 1 131 297 95.0 7.6e-22
CAC41635 Pla l 1.0103 131 291 93.2 2.6e-21
Q7M1X5 Lol p 11.0101 134 268 86.3 3.3e-19
AAN32987 Phl p 11.0101 143 260 83.8 1.9e-18
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ole e 1.0103 Sequence ID: X76396

 Score = 307.7 bits 1005,  Expect = 8e-86
 Identities = 145/145 100%, Positives = 145/145 100%, Gaps = 0/145 0%
Query  1    EDVPQPPVSQFHIQGQVYCDTCRARFITELSEFIPGASVRLQCKDGENGSITFTEVGYTR 60
            EDVPQPPVSQFHIQGQVYCDTCRARFITELSEFIPGASVRLQCKDGENGSITFTEVGYTR
Sbjct  1    EDVPQPPVSQFHIQGQVYCDTCRARFITELSEFIPGASVRLQCKDGENGSITFTEVGYTR 60
Query  61   AEGLYSMLIERDHKDEFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNTVNGTTRTINPL 120
            AEGLYSMLIERDHKDEFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNTVNGTTRTINPL
Sbjct  61   AEGLYSMLIERDHKDEFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNTVNGTTRTINPL 120
Query  121  GFFKKEALPKCPQVFNKLGMYPPNM 145
            GFFKKEALPKCPQVFNKLGMYPPNM
Sbjct  121  GFFKKEALPKCPQVFNKLGMYPPNM 145

Sequence Alignment: 2. Allergen Name: Lig v 1.0102 Sequence ID: CAA54819

 Score = 299.3 bits 977,  Expect = 3e-83
 Identities = 139/145 95%, Positives = 143/145 98%, Gaps = 0/145 0%
Query  1    EDVPQPPVSQFHIQGQVYCDTCRARFITELSEFIPGASVRLQCKDGENGSITFTEVGYTR 60
            EDVPQPPVSQF+IQGQVYCDTCRARFITELSEFIPGA VRLQCKDGENG ITFTEVGYTR
Sbjct  1    EDVPQPPVSQFYIQGQVYCDTCRARFITELSEFIPGAGVRLQCKDGENGKITFTEVGYTR 60
Query  61   AEGLYSMLIERDHKDEFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNTVNGTTRTINPL 120
            AEGLYSMLIERDHK+EFCEITL+SSSRKDCDEIP+EGWVKPSLKFMLNTVNGTTRTINPL
Sbjct  61   AEGLYSMLIERDHKNEFCEITLLSSSRKDCDEIPIEGWVKPSLKFMLNTVNGTTRTINPL 120
Query  121  GFFKKEALPKCPQVFNKLGMYPPNM 145
            GFFKKEALPKCPQVFNKLGMYPPNM
Sbjct  121  GFFKKEALPKCPQVFNKLGMYPPNM 145

Sequence Alignment: 3. Allergen Name: Ole e 1.0104 Sequence ID: X76397

 Score = 292.1 bits 953,  Expect = 4e-81
 Identities = 133/145 91%, Positives = 141/145 97%, Gaps = 0/145 0%
Query  1    EDVPQPPVSQFHIQGQVYCDTCRARFITELSEFIPGASVRLQCKDGENGSITFTEVGYTR 60
            EDVPQPP+SQF++QGQVYCDTCR RFITE+SEFIPGA VRLQCKDGENG ITFTEVGYTR
Sbjct  1    EDVPQPPISQFYVQGQVYCDTCRTRFITEFSEFIPGAGVRLQCKDGENGKITFTEVGYTR 60
Query  61   AEGLYSMLIERDHKDEFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNTVNGTTRTINPL 120
            AEGLYSMLIERDHK+EFCEITL+SSSRKDCDEIP EGWVKPS+KF+LNTVNGTTRTINPL
Sbjct  61   AEGLYSMLIERDHKNEFCEITLLSSSRKDCDEIPTEGWVKPSVKFILNTVNGTTRTINPL 120
Query  121  GFFKKEALPKCPQVFNKLGMYPPNM 145
            GFFKKEALPKCPQVFNKLGMYPPNM
Sbjct  121  GFFKKEALPKCPQVFNKLGMYPPNM 145

Sequence Alignment: 4. Allergen Name: Lig v 1 Sequence ID: O82015

 Score = 290.9 bits 949,  Expect = 9e-81
 Identities = 134/145 92%, Positives = 141/145 97%, Gaps = 0/145 0%
Query  1    EDVPQPPVSQFHIQGQVYCDTCRARFITELSEFIPGASVRLQCKDGENGSITFTEVGYTR 60
            EDVPQPPVSQF+IQGQVYCDTCRARFITELSEFIPGA VRLQCKDGENG +TFTEVGYT+
Sbjct  1    EDVPQPPVSQFYIQGQVYCDTCRARFITELSEFIPGAGVRLQCKDGENGKVTFTEVGYTK 60
Query  61   AEGLYSMLIERDHKDEFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNTVNGTTRTINPL 120
            AEGLY+MLIERDHK+EFCEITLISSSRKDCDEIP EGWVKPSLKF+LNTVNGTTRTINPL
Sbjct  61   AEGLYNMLIERDHKNEFCEITLISSSRKDCDEIPTEGWVKPSLKFVLNTVNGTTRTINPL 120
Query  121  GFFKKEALPKCPQVFNKLGMYPPNM 145
            GF+KKE LPKCPQVFNKLGMYPPNM
Sbjct  121  GFLKKEVLPKCPQVFNKLGMYPPNM 145

Sequence Alignment: 5. Allergen Name: Ole e 1.0107 Sequence ID: CAA73036

 Score = 287.3 bits 937,  Expect = 1e-79
 Identities = 130/145 89%, Positives = 140/145 96%, Gaps = 0/145 0%
Query  1    EDVPQPPVSQFHIQGQVYCDTCRARFITELSEFIPGASVRLQCKDGENGSITFTEVGYTR 60
            EDVPQPPVSQFHIQGQVYCDTCR+RFITELSEFIPGASVRLQC++ ENG ITFTE+GYTR
Sbjct  2    EDVPQPPVSQFHIQGQVYCDTCRSRFITELSEFIPGASVRLQCREKENGDITFTEIGYTR 61
Query  61   AEGLYSMLIERDHKDEFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNTVNGTTRTINPL 120
            AEGLYSML+ERDHK+EFCEITLISS RKDCDEIP+EGW KPSLKF+LNTVNGTTRT+NPL
Sbjct  62   AEGLYSMLVERDHKNEFCEITLISSGRKDCDEIPIEGWAKPSLKFILNTVNGTTRTVNPL 121
Query  121  GFFKKEALPKCPQVFNKLGMYPPNM 145
            GFFKKEALPKC QV+NKLGMYPPNM
Sbjct  122  GFFKKEALPKCAQVYNKLGMYPPNM 146

Sequence Alignment: 6. Allergen Name: Ole e 1.0102 Sequence ID: X76395

 Score = 285.5 bits 931,  Expect = 4e-79
 Identities = 131/145 90%, Positives = 139/145 95%, Gaps = 0/145 0%
Query  1    EDVPQPPVSQFHIQGQVYCDTCRARFITELSEFIPGASVRLQCKDGENGSITFTEVGYTR 60
            EDVPQPPVSQFHIQGQVYCDTCRA FITELSEFIPGAS+RLQCKD ENG +TFTEVGYTR
Sbjct  1    EDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTR 60
Query  61   AEGLYSMLIERDHKDEFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNTVNGTTRTINPL 120
            AEGLYSML+ERDHK+EFCEITLISS RKDC+EIP EGWVKPSLKF+LNTVNGTTRT+NPL
Sbjct  61   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWVKPSLKFILNTVNGTTRTVNPL 120
Query  121  GFFKKEALPKCPQVFNKLGMYPPNM 145
            GFFKKEALPKC QV+NKLGMYPPNM
Sbjct  121  GFFKKEALPKCAQVYNKLGMYPPNM 145

Sequence Alignment: 7. Allergen Name: Ole e 1 Sequence ID: P19963

 Score = 282.5 bits 921,  Expect = 3e-78
 Identities = 129/145 88%, Positives = 137/145 94%, Gaps = 0/145 0%
Query  1    EDVPQPPVSQFHIQGQVYCDTCRARFITELSEFIPGASVRLQCKDGENGSITFTEVGYTR 60
            ED+PQPPVSQFHIQGQVYCDTCRA FITELSEFIPGAS+RLQCKD ENG +TFTEVGYTR
Sbjct  1    EDIPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTR 60
Query  61   AEGLYSMLIERDHKDEFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNTVNGTTRTINPL 120
            AEGLYSML+ERDHK+EFCEITLISS RKDC+EIP EGW KPSLKF LNTVNGTTRT+NPL
Sbjct  61   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNTVNGTTRTVNPL 120
Query  121  GFFKKEALPKCPQVFNKLGMYPPNM 145
            GFFKKEALPKC QV+NKLGMYPPNM
Sbjct  121  GFFKKEALPKCAQVYNKLGMYPPNM 145

Sequence Alignment: 8. Allergen Name: Ole e 1.0106 Sequence ID: CAA73037

 Score = 281.9 bits 919,  Expect = 5e-78
 Identities = 128/145 88%, Positives = 138/145 95%, Gaps = 0/145 0%
Query  1    EDVPQPPVSQFHIQGQVYCDTCRARFITELSEFIPGASVRLQCKDGENGSITFTEVGYTR 60
            EDVPQPPVSQFHIQGQVYCDTCRA FITELSEFIPGASVRLQCKD ENG +TFTE+GYTR
Sbjct  2    EDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTR 61
Query  61   AEGLYSMLIERDHKDEFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNTVNGTTRTINPL 120
            AEGLYSML+ERDHK+EFCEITLISS RKDC+EIP EGW KPSLKF+L+TVNGTTRT+NPL
Sbjct  62   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILSTVNGTTRTVNPL 121
Query  121  GFFKKEALPKCPQVFNKLGMYPPNM 145
            GF+KKEALPKC QV+NKLGMYPPNM
Sbjct  122  GFYKKEALPKCAQVYNKLGMYPPNM 146

Sequence Alignment: 9. Allergen Name: Ole e 1.0105 Sequence ID: CAA73038

 Score = 280.4 bits 914,  Expect = 1e-77
 Identities = 128/145 88%, Positives = 137/145 94%, Gaps = 0/145 0%
Query  1    EDVPQPPVSQFHIQGQVYCDTCRARFITELSEFIPGASVRLQCKDGENGSITFTEVGYTR 60
            EDVPQPPVSQFHIQGQVYCDTCRA FITELSEFIPGASVRLQCKD ENG +TFTE+GYTR
Sbjct  2    EDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTR 61
Query  61   AEGLYSMLIERDHKDEFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNTVNGTTRTINPL 120
            AEGLYSML+ERDHK+EFCEITLISS RKDC+EIP EGW KPSLKF+LNTVNGTTRT+NPL
Sbjct  62   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILNTVNGTTRTVNPL 121
Query  121  GFFKKEALPKCPQVFNKLGMYPPNM 145
             F+KKEALPKC QV+NKLGMYPPNM
Sbjct  122  RFYKKEALPKCAQVYNKLGMYPPNM 146

Sequence Alignment: 10. Allergen Name: Fra e 1.0201 Sequence ID: AAQ83588

 Score = 280.4 bits 914,  Expect = 1e-77
 Identities = 126/145 86%, Positives = 139/145 95%, Gaps = 0/145 0%
Query  1    EDVPQPPVSQFHIQGQVYCDTCRARFITELSEFIPGASVRLQCKDGENGSITFTEVGYTR 60
            EDVPQPPVSQFHIQGQVYCDTCRARFIT+LSEFI GASVRLQC+D ENG +TFTE+GYTR
Sbjct  2    EDVPQPPVSQFHIQGQVYCDTCRARFITKLSEFITGASVRLQCRDKENGDVTFTEIGYTR 61
Query  61   AEGLYSMLIERDHKDEFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNTVNGTTRTINPL 120
             EGLYSM++ERDHK+EFCEITL+SS RKDC+EIP+EGWVKPSLKF+LNTVNGTTRTINPL
Sbjct  62   GEGLYSMFVERDHKNEFCEITLLSSGRKDCNEIPIEGWVKPSLKFILNTVNGTTRTINPL 121
Query  121  GFFKKEALPKCPQVFNKLGMYPPNM 145
            GFFKKEALP+C QV+NKLGMYPPNM
Sbjct  122  GFFKKEALPQCAQVYNKLGMYPPNM 146

Sequence Alignment: 11. Allergen Name: Fra e 1.0101 Sequence ID: AAQ08947

 Score = 278.6 bits 908,  Expect = 5e-77
 Identities = 128/145 88%, Positives = 136/145 93%, Gaps = 0/145 0%
Query  1    EDVPQPPVSQFHIQGQVYCDTCRARFITELSEFIPGASVRLQCKDGENGSITFTEVGYTR 60
            EDVPQPPVS F++QGQVYCDTCRA FITELSEFI GA VRLQCKD ENG +TFTEVGYTR
Sbjct  1    EDVPQPPVSLFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKDKENGKVTFTEVGYTR 60
Query  61   AEGLYSMLIERDHKDEFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNTVNGTTRTINPL 120
            AEGLYSM+IERDHK+EFCEI L+SSSRKDCDEIP EGWVKPSLKF+LNTVNGTTRTINPL
Sbjct  61   AEGLYSMVIERDHKNEFCEIVLLSSSRKDCDEIPTEGWVKPSLKFILNTVNGTTRTINPL 120
Query  121  GFFKKEALPKCPQVFNKLGMYPPNM 145
            GFFKKE LPKCPQV+NKLGMYPPNM
Sbjct  121  GFFKKEVLPKCPQVYNKLGMYPPNM 145

Sequence Alignment: 12. Allergen Name: Fra e 1.0102 Sequence ID: AAV74343

 Score = 275.6 bits 898,  Expect = 4e-76
 Identities = 127/145 87%, Positives = 136/145 93%, Gaps = 0/145 0%
Query  1    EDVPQPPVSQFHIQGQVYCDTCRARFITELSEFIPGASVRLQCKDGENGSITFTEVGYTR 60
            EDVPQPPVS F++QGQVYCDTCRA FITELSEFI GA VRLQCK+ ENG +TFTEVGYTR
Sbjct  1    EDVPQPPVSLFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKEKENGKVTFTEVGYTR 60
Query  61   AEGLYSMLIERDHKDEFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNTVNGTTRTINPL 120
            AEGLYSM+IERDHK+EFCEI L+SSSRKDC EIP EGWVKPSLKF+LNTVNGTTRTINPL
Sbjct  61   AEGLYSMVIERDHKNEFCEIVLLSSSRKDCHEIPTEGWVKPSLKFILNTVNGTTRTINPL 120
Query  121  GFFKKEALPKCPQVFNKLGMYPPNM 145
            GFFKKEALPKCPQV+NKLGMYPPNM
Sbjct  121  GFFKKEALPKCPQVYNKLGMYPPNM 145

Sequence Alignment: 13. Allergen Name: Ole e 1.0101 Sequence ID: AAB32652

 Score = 246.5 bits 801,  Expect = 2e-67
 Identities = 114/130 87%, Positives = 122/130 93%, Gaps = 0/130 0%
Query  16   QVYCDTCRARFITELSEFIPGASVRLQCKDGENGSITFTEVGYTRAEGLYSMLIERDHKD 75
            QVYCDTCRA FITELSEFIPGASVRLQCK+ +NG ITFTEVGYTRAEGLYSML+ERDHK+
Sbjct  1    QVYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHKN 60
Query  76   EFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNTVNGTTRTINPLGFFKKEALPKCPQVF 135
            EFCEITLISS  KDC+EIP EGW KPSLKF+LNTVNGTTRT+NPLGFFKKEALPKC QV+
Sbjct  61   EFCEITLISSGSKDCNEIPTEGWAKPSLKFILNTVNGTTRTVNPLGFFKKEALPKCAQVY 120
Query  136  NKLGMYPPNM 145
            NKLGMYPPNM
Sbjct  121  NKLGMYPPNM 130

Sequence Alignment: 14. Allergen Name: Aca f 1 Sequence ID: A0A0K1SC24

 Score = 146.9 bits 470,  Expect = 2e-37
 Identities = 70/141 49%, Positives = 94/141 66%, Gaps = 4/141 2%
Query  1    EDVPQPPVSQFHIQGQVYCDTCRARFITELSEFIPGASVRLQCKDGENGSITFTEVGYTR 60
            +DVP+PPVSQFH+QG VYCDTCR  FITE S  + GA+V+L+C++   G+ TF     T 
Sbjct  1    DDVPKPPVSQFHVQGLVYCDTCRYPFITEASPIMEGATVKLECRNITAGTQTFKAEAVTD 60
Query  61   AEGLYSMLIERDHKDEFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNTVNGTT---RTI 117
              G YS+ ++ DH+D+ CEI L+ S    C EIP + + K S K  L + NG     R+ 
Sbjct  61   KVGQYSIPVDGDHEDDICEIELVKSPDNQCSEIPHDVYAKQSAKVSLTSNNGEASDVRSA 120
Query  118  NPLGFFKKEALPKCPQVFN-KLGMY 141
            N LGF +KE LP+CP+V+  KL MY
Sbjct  121  NALGFMRKEPLPECPEVLKEKLDMY 145

Sequence Alignment: 15. Allergen Name: Pro j 1.0101 Sequence ID: AKV72167

 Score = 136.4 bits 435,  Expect = 3e-34
 Identities = 66/141 46%, Positives = 91/141 64%, Gaps = 4/141 2%
Query  1    EDVPQPPVSQFHIQGQVYCDTCRARFITELSEFIPGASVRLQCKDGENGSITFTEVGYTR 60
            +DV +PPVSQFHIQG VYCDTCR +F+T +S  + GA+V+L+C++   G+ TF     T 
Sbjct  1    DDVAKPPVSQFHIQGLVYCDTCRIQFMTRVSTIMEGATVKLECRNITAGTQTFKAEAVTD 60
Query  61   AEGLYSMLIERDHKDEFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNTVNGTT---RTI 117
              G YS+ +  D +D+ CEI L+ S   DC EIP + + K S K  L + NG     R+ 
Sbjct  61   KVGQYSIPVNGDFEDDICEIELVKSPNSDCSEIPHDVYAKQSAKVSLTSNNGEASDIRSA 120
Query  118  NPLGFFKKEALPKCPQVFNK-LGMY 141
            N LGF +KE L +CP+V  + L MY
Sbjct  121  NALGFMRKEPLKECPEVSKEPLDMY 145

Sequence Alignment: 16. Allergen Name: Ama r 1.0101 Sequence ID: A0A0K1SC10

 Score = 131.5 bits 419,  Expect = 1e-32
 Identities = 61/141 43%, Positives = 90/141 63%, Gaps = 3/141 2%
Query  1    EDVPQPPVSQFHIQGQVYCDTCRARFITELSEFIPGASVRLQCKDGENGSITFTEVGYTR 60
            +DV + PVSQFHIQG VYCDTCR +F+T +S  + GA+V+L+C++   G+ TF     T 
Sbjct  20   DDVAKAPVSQFHIQGLVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVTD 79
Query  61   AEGLYSMLIERDHKDEFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNTVNGTT---RTI 117
              G YS+ +  D +D+ CEI L+ S   +C E+  + + K S K  L + NG     R+ 
Sbjct  80   KVGQYSIPVNGDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRSA 139
Query  118  NPLGFFKKEALPKCPQVFNKLGMY 141
            N LGF +KE L +CP+V+ +L +Y
Sbjct  140  NALGFMRKEPLEECPEVLKELDLY 163

Sequence Alignment: 17. Allergen Name: Sal k 5.0101 Sequence ID: ADK22842

 Score = 125.0 bits 397,  Expect = 9e-31
 Identities = 55/131 41%, Positives = 86/131 65%, Gaps = 3/131 2%
Query  11   FHIQGQVYCDTCRARFITELSEFIPGASVRLQCKDGENGSITFTEVGYTRAEGLYSMLIE 70
            +H++G VYCDTCR +FIT +S  + GA+V LQC++   G+ TF     T   G+Y++ ++
Sbjct  9    YHVKGMVYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKLGMYTIKVD 68
Query  71   RDHKDEFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNTVNGTT---RTINPLGFFKKEA 127
             DH+D+ C+I L+ S  ++C EIP + + + + K  L + NG     R  N LGF+KK  
Sbjct  69   GDHEDDICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNGEASDVRNANALGFLKKAP 128
Query  128  LPKCPQVFNKLGMY 141
            LP+CP+V+ +L MY
Sbjct  129  LPECPEVLKELDMY 142

Sequence Alignment: 18. Allergen Name: Che a 1 Sequence ID: AAL07319

 Score = 116.8 bits 370,  Expect = 3e-28
 Identities = 53/133 39%, Positives = 83/133 62%, Gaps = 3/133 2%
Query  9    SQFHIQGQVYCDTCRARFITELSEFIPGASVRLQCKDGENGSITFTEVGYTRAEGLYSML 68
            ++F +QG VYCDTCR +F+T +S  + GA+V+L+C++   G+ TF     T   G YS+ 
Sbjct  28   NHFKVQGMVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIP 87
Query  69   IERDHKDEFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNTVNGTT---RTINPLGFFKK 125
            +  D +D+ CEI L+ S   +C E+  + + K S K  L + NG     R+ N LGF +K
Sbjct  88   VNGDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRSANALGFMRK 147
Query  126  EALPKCPQVFNKLGMY 141
            E L +CP+V+ +L +Y
Sbjct  148  EPLKECPEVLKELDLY 163

Sequence Alignment: 19. Allergen Name: Koc s 1.0101 Sequence ID: A0A0K1SC44

 Score = 115.6 bits 366,  Expect = 6e-28
 Identities = 58/138 42%, Positives = 87/138 63%, Gaps = 8/138 5%
Query  1    EDVPQPPVSQFHIQGQVYCDTCR--ARFITELSEFIPGASVRLQCKDGENGSITFTEVGY 58
            +DV + PVSQFHIQG VYCDTC   + ++  + E   GA+V+L+C++   G+ TF     
Sbjct  20   DDVAKAPVSQFHIQGLVYCDTCPYPSSYVLPMLE---GATVKLECRNITAGTQTFKAEAV 76
Query  59   TRAEGLYSMLIERDHKDEFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNTVNGTT---R 115
            T   G YS+ ++ D +D+ CEI L+ S    C E+  + + K S K  L + NG     R
Sbjct  77   TDKVGQYSIPVDGDFEDDICEIELLKSPDNQCSEVSHDVYAKQSAKVSLTSNNGEASDVR 136
Query  116  TINPLGFFKKEALPKCPQVFNKLGMY 141
            + N LGF +KE L +CP+V+ +L +Y
Sbjct  137  SANALGFMRKEPLEECPEVLKELDLY 162

Sequence Alignment: 20. Allergen Name: Lyc e LAT52 Sequence ID: CAA33854

 Score = 115.0 bits 364,  Expect = 9e-28
 Identities = 53/135 39%, Positives = 89/135 65%, Gaps = 4/135 2%
Query  5    QPPVSQFHIQGQVYCDTCRARFITELSEFIPGASVRLQCKDGENGSITFTEVGYTRAEGL 64
            +P V  F ++G+VYCDTCR +F T+LSE + GA+V+LQC++    + TF+  G T  +G 
Sbjct  23   RPEV--FDVEGKVYCDTCRVQFETKLSENLEGATVKLQCRNISTEAETFSVEGVTDKDGK 80
Query  65   YSMLIERDHKDEFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNT-VNGTTRTINPLGFF 123
            Y + +  DH+++ CE+T++ S R+DC E  V G+ K  ++   N  ++   R  NPL F 
Sbjct  81   YKLTVNGDHENDICEVTVVKSPREDCKE-SVSGYEKARIECSDNVGIHNAVRFANPLFFM 139
Query  124  KKEALPKCPQVFNKLGMYP 142
            K E++  C + +++LG++P
Sbjct  140  KAESVQGCKEALDELGLFP 158

Sequence Alignment: 21. Allergen Name: Pla l 1 Sequence ID: P82242

 Score = 95.0 bits 297,  Expect = 8e-22
 Identities = 51/119 42%, Positives = 78/119 65%, Gaps = 10/119 8%
Query  9    SQFHIQGQVYCDTCRAR-FITELSEFIPGASVRLQCKDGENGSITFTEVGYTRAEGLYSM 67
            ++FH++G+VYC+ C +R +I ELSE + GA V+L CKD ++  + ++  G T  +G+Y +
Sbjct  7    AKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKD-DSKKVIYSIGGETDQDGVYRL 65
Query  68   LIERDHKDEFCEITLISSSRKDCDEIP--VEGWVKPSLKFMLN---TVNGTTRTINPLGF 122
             +   H+D  CEI L+ SSR DC EIP   +G ++ S K  L+   T+   TR + PL F
Sbjct  66   PVVGYHED--CEIKLVKSSRPDCSEIPKLAKGTIQTS-KVDLSKNTTITEKTRHVKPLSF 122
Query  123  FKKEALPKC 131
              K   P C
Sbjct  123  RAKTDAPGC 131

Sequence Alignment: 22. Allergen Name: Pla l 1.0103 Sequence ID: CAC41635

 Score = 93.2 bits 291,  Expect = 3e-21
 Identities = 50/119 42%, Positives = 77/119 64%, Gaps = 10/119 8%
Query  9    SQFHIQGQVYCDTCRAR-FITELSEFIPGASVRLQCKDGENGSITFTEVGYTRAEGLYSM 67
            ++FH++G+VYC+ C +R +I ELSE + GA V+L CKD ++  + ++  G T  +G+Y +
Sbjct  7    AKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKD-DSKKVIYSIGGETGQDGVYRL 65
Query  68   LIERDHKDEFCEITLISSSRKDCDEIP--VEGWVKPSLKFMLN---TVNGTTRTINPLGF 122
             +   H+D  CEI L+ S R DC EIP   +G ++ S K  L+   T+   TR + PL F
Sbjct  66   PVVGYHED--CEIKLVKSGRPDCSEIPKLAKGTIQTS-KVDLSKNTTITEKTRHVKPLSF 122
Query  123  FKKEALPKC 131
              K   P C
Sbjct  123  RAKTDAPGC 131

Sequence Alignment: 23. Allergen Name: Lol p 11.0101 Sequence ID: Q7M1X5

 Score = 86.3 bits 268,  Expect = 3e-19
 Identities = 42/125 33%, Positives = 64/125 51%, Gaps = 1/125 0%
Query  11   FHIQGQVYCDTCRARFITELSEFIPGASVRLQCKDGENGSITFTEVGYTRAEGLYSMLIE 70
            F + G+VYCD CRA F T +S  + GA+V + C+  + G   +     T  +G Y + I+
Sbjct  6    FVVTGRVYCDPCRAGFETNVSHNVEGATVAVDCRPFDGGESKLKAEATTDKDGWYKIEID 65
Query  71   RDHKDEFCEITLISSSRKDCDEIP-VEGWVKPSLKFMLNTVNGTTRTINPLGFFKKEALP 129
            +DH++E CE+ L  S  K C EI       +  L           R  NP+ FF+KE L 
Sbjct  66   QDHQEEICEVVLAKSPDKSCSEIEEFRDRARVPLTSNXGIKQQGIRYANPIAFFRKEPLK 125
Query  130  KCPQVF 135
            +C  ++
Sbjct  126  ECGGIL 131

Sequence Alignment: 24. Allergen Name: Phl p 11.0101 Sequence ID: AAN32987

 Score = 83.8 bits 260,  Expect = 2e-18
 Identities = 43/122 35%, Positives = 65/122 53%, Gaps = 7/122 5%
Query  11   FHIQGQVYCDTCRARFITELSEFIPGASVRLQCKDGENGSITFTEVGYTRAEGLYSMLIE 70
            F + G+VYCD CRA F T +S  + GA+V + C+    G   +     T   G Y + I+
Sbjct  6    FVVTGRVYCDPCRAGFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGLGWYKIEID 65
Query  71   RDHKDEFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNTVNGTT----RTINPLGFFKKE 126
            +DH++E CE+ L  S    C EI      +   +  L + NG      R  NP+ FF+KE
Sbjct  66   QDHQEEICEVVLAKSPDTTCSEIEE---FRDRARVPLTSNNGIKQQGIRYANPIAFFRKE 122
Query  127  ALPKCPQVF 135
             L +C  ++
Sbjct  123  PLKECGGIL 131

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.