The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

EIGSTIPNATFAYVPYSPELEDHKVCGMPTSFQSHERWKGKKVVIVAVPGAFTPTCTANH
VPPYVEKIQELKSKGVDEVVVISANDPFVLSAWGITEHAKDNLTFAQDVNCEFSKHFNAT
LDLSSKGMGLRTARYALIANDLKVEYFGIDEGEPKQSSAATVLSKL
Sequence Info Allergen Name Length Opt Bits Score E Value
P56578 Mala f 3 166 1099 257.6 1.3e-70
CAA09883 Mala s 5 172 706 168.0 1.2e-43
P56577 Mala f 2 177 617 147.7 1.7e-37
O43099 Asp f 3 168 408 100.1 3.4e-23
AAD42074 Pen c 3 167 382 94.2 2e-21
AAA34358 Cand b 2 167 379 93.5 3.3e-21
AAA34357 Cand b 2 167 370 91.4 1.4e-20
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Mala f 3 Sequence ID: P56578

 Score = 257.6 bits 1099,  Expect = 1e-70
 Identities = 166/166 100%, Positives = 166/166 100%, Gaps = 0/166 0%
Query  1    EIGSTIPNATFAYVPYSPELEDHKVCGMPTSFQSHERWKGKKVVIVAVPGAFTPTCTANH 60
            EIGSTIPNATFAYVPYSPELEDHKVCGMPTSFQSHERWKGKKVVIVAVPGAFTPTCTANH
Sbjct  1    EIGSTIPNATFAYVPYSPELEDHKVCGMPTSFQSHERWKGKKVVIVAVPGAFTPTCTANH 60
Query  61   VPPYVEKIQELKSKGVDEVVVISANDPFVLSAWGITEHAKDNLTFAQDVNCEFSKHFNAT 120
            VPPYVEKIQELKSKGVDEVVVISANDPFVLSAWGITEHAKDNLTFAQDVNCEFSKHFNAT
Sbjct  61   VPPYVEKIQELKSKGVDEVVVISANDPFVLSAWGITEHAKDNLTFAQDVNCEFSKHFNAT 120
Query  121  LDLSSKGMGLRTARYALIANDLKVEYFGIDEGEPKQSSAATVLSKL 166
            LDLSSKGMGLRTARYALIANDLKVEYFGIDEGEPKQSSAATVLSKL
Sbjct  121  LDLSSKGMGLRTARYALIANDLKVEYFGIDEGEPKQSSAATVLSKL 166

Sequence Alignment: 2. Allergen Name: Mala s 5 Sequence ID: CAA09883

 Score = 168.0 bits 706,  Expect = 1e-43
 Identities = 98/164 59%, Positives = 130/164 79%, Gaps = 3/164 1%
Query  3    GSTIPNATFAYVPYSPELEDHKVCGMPTSFQSHERWKGKKVVIVAVPGAFTPTCTANHVP 62
            GS  PN TF Y+P++PEL+  KVCG+P +F++H+RWKGKKVV+VA+PGAFTP C  NH+P
Sbjct  6    GSQAPNTTFTYIPWAPELDSGKVCGVPQTFKAHDRWKGKKVVVVAIPGAFTPACHQNHIP 65
Query  63   PYVEKIQELKSKGVDEVVVISANDPFVLSAWGITEHAKDNLTFAQDVNCEFSKHFNATLD 122
             +VEKI ELK+KGVDEVVVI+ ND FV+S WG+T   KD + +A D +  FSK +  TLD
Sbjct  66   GFVEKINELKAKGVDEVVVIAVNDAFVMSGWGVTVGGKDQIVYACDNDLAFSKALGGTLD 125
Query  123  LSSKGMGLRTARYALIANDLKVEYFGIDEGE---PKQSSAATVLSKL 166
            L+S GMG+RTARYA++ +DLK+ YFG+DEG    P++SS   VL++L
Sbjct  126  LTSGGMGVRTARYAVVLDDLKITYFGMDEGNMGAPEKSSVDAVLAQL 172

Sequence Alignment: 3. Allergen Name: Mala f 2 Sequence ID: P56577

 Score = 147.7 bits 617,  Expect = 2e-37
 Identities = 85/164 51%, Positives = 124/164 75%, Gaps = 3/164 1%
Query  3    GSTIPNATFAYVPYSPELEDHKVCGMPTSFQSHERWKGKKVVIVAVPGAFTPTCTANHVP 62
            G+ IP+    Y+P++PEL+  +VCG+PT+F++ + WKGKKVVIV++PGA+TP C   H+P
Sbjct  11   GNEIPDTLMGYIPWTPELDSGEVCGIPTTFKTRDEWKGKKVVIVSIPGAYTPICHQQHIP 70
Query  63   PYVEKIQELKSKGVDEVVVISANDPFVLSAWGITEHAKDNLTFAQDVNCEFSKHFNATLD 122
            P V+++ ELK+KGVD V VI++NDPFV++AWG   +AKD + FA D++  FSK + AT+D
Sbjct  71   PLVKRVDELKAKGVDAVYVIASNDPFVMAAWGNFNNAKDKVVFATDIDLAFSKALGATID 130
Query  123  LSSKGMGLRTARYALIANDLKVEYFGIDEGEP---KQSSAATVLSKL 166
            LS+K  G RTARYALI +D K+  F  DEG+    + +S  T+L+K+
Sbjct  131  LSAKHFGERTARYALIIDDNKIVDFASDEGDTGKLQNASIDTILTKV 177

Sequence Alignment: 4. Allergen Name: Asp f 3 Sequence ID: O43099

 Score = 100.1 bits 408,  Expect = 3e-23
 Identities = 64/158 40%, Positives = 100/158 63%, Gaps = 10/158 6%
Query  3    GSTIP-NATFAYVPYSPELEDHKVCGMPTSFQSHERWKGKKVVIVAVPGAFTPTCTANHV 61
            G + P +  F+Y+P+S +  +   CG+P ++ + + W  KKV++ A+PGAFTP C+A HV
Sbjct  7    GDSFPSDVVFSYIPWSEDKGEITACGIPINYNASKEWADKKVILFALPGAFTPVCSARHV 66
Query  62   PPYVEKIQELKSKGVDEVVVISANDPFVLSAWGITEHAK-DNLTFAQDVNCEFSKHFNAT 120
            P Y+EK+ E+++KGVD V V++ ND +V+SAWG   +   D++ F  D +  FSK     
Sbjct  67   PEYIEKLPEIRAKGVDVVAVLAYNDAYVMSAWGKANQVTGDDILFLSDPDARFSKSIGWA 126
Query  121  LDLSSKGMGLRTARYALIANDLKVEYFGIDEGEPKQ--SSAATVLSKL 166
                 +G   RT RYAL+ +  K+ Y  ++  +     SSA TVL  L
Sbjct  127  ---DEEG---RTKRYALVIDHGKITYAALEPAKNHLEFSSAETVLKHL 168

Sequence Alignment: 5. Allergen Name: Pen c 3 Sequence ID: AAD42074

 Score = 94.2 bits 382,  Expect = 2e-21
 Identities = 62/158 39%, Positives = 100/158 63%, Gaps = 10/158 6%
Query  3    GSTIPNA-TFAYVPYSPELEDHKVCGMPTSFQSHERWKGKKVVIVAVPGAFTPTCTANHV 61
            G + P   TF+Y+P++ +  +   CG+P ++ + + +  KKVV+ A+PGAFTP C+ANHV
Sbjct  6    GDSFPEGVTFSYIPWAEDASEITSCGIPINYNASKEFANKKVVLFALPGAFTPVCSANHV 65
Query  62   PPYVEKIQELKSKGVDEVVVISANDPFVLSAWGITEHAK-DNLTFAQDVNCEFSKHFNAT 120
            P Y++K+ EL++KGVD+V V++ ND +V+SAWG       D++ F  D   +FSK     
Sbjct  66   PEYIQKLPELRAKGVDQVAVLAYNDAYVMSAWGKANGVTGDDILFLSDPEAKFSKSIGWA 125
Query  121  LDLSSKGMGLRTARYALIANDLKVEYFGIDEGEP--KQSSAATVLSKL 166
                 +G   RT RY L+ ++ K+ Y   +  +   + S A  VL +L
Sbjct  126  ---DEEG---RTYRYVLVIDNGKIIYAAKEAAKNSLELSRADHVLKQL 167

Sequence Alignment: 6. Allergen Name: Cand b 2 Sequence ID: AAA34358

 Score = 93.5 bits 379,  Expect = 3e-21
 Identities = 65/140 46%, Positives = 90/140 64%, Gaps = 4/140 2%
Query  27   GMPTSFQSHERWKGKKVVIVAVPGAFTPTCTANHVPPYVEKIQELKSKGVDEVVVISAND 86
            G P +F+  +  K KK V+V+VPGAFTP CT  H+P Y++ +  + SKGVD V+VI+ ND
Sbjct  24   GEPGAFELSKFVKTKKFVVVSVPGAFTPPCTEQHLPGYIKNLPRILSKGVDFVLVITQND 83
Query  87   PFVLSAWGITEHAKD--NLTFAQDVNCEFSKHFNATLDLSSKGMGLRTARYALIANDLK- 143
            PFVL  W     A D   L F  D N +++K + +T+DLSS G+G R+ R ALI N    
Sbjct  84   PFVLKGWKKELGAADAKKLIFVSDPNLKLTKKLGSTIDLSSIGLGTRSGRLALIVNRSGI 143
Query  144  VEYFGIDEG-EPKQSSAATVLSKL 166
            VEY  I+ G E   S+A  +++KL
Sbjct  144  VEYAAIENGGEVDVSTAQKIIAKL 167

Sequence Alignment: 7. Allergen Name: Cand b 2 Sequence ID: AAA34357

 Score = 91.4 bits 370,  Expect = 1e-20
 Identities = 64/140 45%, Positives = 89/140 63%, Gaps = 4/140 2%
Query  27   GMPTSFQSHERWKGKKVVIVAVPGAFTPTCTANHVPPYVEKIQELKSKGVDEVVVISAND 86
            G P  ++  +  K KK V+V+VPGAFTP CT  H+P Y++ +  + SKGVD V+VIS ND
Sbjct  24   GEPGPLELSKFVKTKKFVVVSVPGAFTPPCTEQHLPGYIKNLPRILSKGVDFVLVISQND 83
Query  87   PFVLSAWGITEHAKD--NLTFAQDVNCEFSKHFNATLDLSSKGMGLRTARYALIANDLK- 143
            PFVL  W     A D   L F  D N +++K + +T+DLS+ G+G R+ R ALI N    
Sbjct  84   PFVLKGWKKELGAADAKKLVFVSDPNLKLTKKLGSTIDLSAIGLGTRSGRLALIVNRSGI 143
Query  144  VEYFGIDEG-EPKQSSAATVLSKL 166
            VEY  I+ G E   S+A  +++KL
Sbjct  144  VEYAAIENGGEVDVSTAQKIIAKL 167

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.