The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

EQLTKCEVFRELKDLKGYGGVSLPEWVCTAFHTSGYDTQAIVQNNDSTEYGLFQINNKIW
CKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDKVGINYWLAHKALCSEKLDQWLC
EKL
Sequence Info Allergen Name Length Opt Bits Score E Value
Q28049 Bos d 4 123 876 270.5 9.3e-75
CAA29664 Bos d 4 142 876 270.4 1.1e-74
P00711 Bos d 4 142 871 268.9 3.3e-74
XP_014705584 Equ a 6.01 148 365 115.8 4e-28
P11376 Equ c 6.01 129 359 114.1 1.2e-27
P00698 Gal d 4 147 330 105.3 6.1e-25
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Bos d 4 Sequence ID: Q28049

 Score = 270.5 bits 876,  Expect = 9e-75
 Identities = 123/123 100%, Positives = 123/123 100%, Gaps = 0/123 0%
Query  1    EQLTKCEVFRELKDLKGYGGVSLPEWVCTAFHTSGYDTQAIVQNNDSTEYGLFQINNKIW 60
            EQLTKCEVFRELKDLKGYGGVSLPEWVCTAFHTSGYDTQAIVQNNDSTEYGLFQINNKIW
Sbjct  1    EQLTKCEVFRELKDLKGYGGVSLPEWVCTAFHTSGYDTQAIVQNNDSTEYGLFQINNKIW 60
Query  61   CKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDKVGINYWLAHKALCSEKLDQWLC 120
            CKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDKVGINYWLAHKALCSEKLDQWLC
Sbjct  61   CKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDKVGINYWLAHKALCSEKLDQWLC 120
Query  121  EKL 123
            EKL
Sbjct  121  EKL 123

Sequence Alignment: 2. Allergen Name: Bos d 4 Sequence ID: CAA29664

 Score = 270.4 bits 876,  Expect = 1e-74
 Identities = 123/123 100%, Positives = 123/123 100%, Gaps = 0/123 0%
Query  1    EQLTKCEVFRELKDLKGYGGVSLPEWVCTAFHTSGYDTQAIVQNNDSTEYGLFQINNKIW 60
            EQLTKCEVFRELKDLKGYGGVSLPEWVCTAFHTSGYDTQAIVQNNDSTEYGLFQINNKIW
Sbjct  20   EQLTKCEVFRELKDLKGYGGVSLPEWVCTAFHTSGYDTQAIVQNNDSTEYGLFQINNKIW 79
Query  61   CKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDKVGINYWLAHKALCSEKLDQWLC 120
            CKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDKVGINYWLAHKALCSEKLDQWLC
Sbjct  80   CKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDKVGINYWLAHKALCSEKLDQWLC 139
Query  121  EKL 123
            EKL
Sbjct  140  EKL 142

Sequence Alignment: 3. Allergen Name: Bos d 4 Sequence ID: P00711

 Score = 268.9 bits 871,  Expect = 3e-74
 Identities = 122/123 99%, Positives = 122/123 99%, Gaps = 0/123 0%
Query  1    EQLTKCEVFRELKDLKGYGGVSLPEWVCTAFHTSGYDTQAIVQNNDSTEYGLFQINNKIW 60
            EQLTKCEVFRELKDLKGYGGVSLPEWVCT FHTSGYDTQAIVQNNDSTEYGLFQINNKIW
Sbjct  20   EQLTKCEVFRELKDLKGYGGVSLPEWVCTTFHTSGYDTQAIVQNNDSTEYGLFQINNKIW 79
Query  61   CKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDKVGINYWLAHKALCSEKLDQWLC 120
            CKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDKVGINYWLAHKALCSEKLDQWLC
Sbjct  80   CKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDKVGINYWLAHKALCSEKLDQWLC 139
Query  121  EKL 123
            EKL
Sbjct  140  EKL 142

Sequence Alignment: 4. Allergen Name: Equ a 6.01 Sequence ID: XP_014705584

 Score = 115.8 bits 365,  Expect = 4e-28
 Identities = 56/116 48%, Positives = 84/116 72%, Gaps = 7/116 6%
Query  3    LTKCEVFRELK--DLKGYGGVSLPEWVCTAFHTSGYDTQAIV-QN-NDSTEYGLFQINNK 58
            ++KCE+  +LK  ++ G+GG SL  WVC A + S ++T+A   +N N S++YGLFQ+NNK
Sbjct  22   FSKCELAHKLKAQEMDGFGGYSLANWVCMAEYESNFNTRAFNGKNANGSSDYGLFQLNNK 81
Query  59   IWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKIL-DKVGINYWLAHKALCSEK-LD 116
             WCKD++   SSN CNI C K+LDD++ DDI C K+++ D  G++ W A    C +K L 
Sbjct  82   WWCKDNKRS-SSNACNIMCSKLLDDNIDDDISCAKRVVRDPKGMSAWKAWVKHCKDKDLS 140
Query  117  QWL 119
            ++L
Sbjct  141  EYL 143

Sequence Alignment: 5. Allergen Name: Equ c 6.01 Sequence ID: P11376

 Score = 114.1 bits 359,  Expect = 1e-27
 Identities = 55/116 47%, Positives = 84/116 72%, Gaps = 7/116 6%
Query  3    LTKCEVFRELK--DLKGYGGVSLPEWVCTAFHTSGYDTQAIV-QN-NDSTEYGLFQINNK 58
            ++KCE+  +LK  ++ G+GG SL  WVC A + S ++T+A   +N N S++YGLFQ+NNK
Sbjct  3    FSKCELAHKLKAQEMDGFGGYSLANWVCMAEYESNFNTRAFNGKNANGSSDYGLFQLNNK 62
Query  59   IWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKIL-DKVGINYWLAHKALCSEK-LD 116
             WCKD++   SSN CNI C K+LD+++ DDI C K+++ D  G++ W A    C +K L 
Sbjct  63   WWCKDNKRS-SSNACNIMCSKLLDENIDDDISCAKRVVRDPKGMSAWKAWVKHCKDKDLS 121
Query  117  QWL 119
            ++L
Sbjct  122  EYL 124

Sequence Alignment: 6. Allergen Name: Gal d 4 Sequence ID: P00698

 Score = 105.3 bits 330,  Expect = 6e-25
 Identities = 49/115 42%, Positives = 71/115 61%, Gaps = 5/115 4%
Query  5    KCEVFRELK--DLKGYGGVSLPEWVCTAFHTSGYDTQAIVQNND-STEYGLFQINNKIWC 61
            +CE+   +K   L  Y G SL  WVC A   S ++TQA  +N D ST+YG++QIN++ WC
Sbjct  23   RCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQATNRNTDGSTDYGILQINSRWWC 82
Query  62   KDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKIL-DKVGINYWLAHKALCS-EKLDQWL 119
             D + P S N+CNI C  +L  D+T  + C KKI+ D  G+N W+A +  C    +  W+
Sbjct  83   NDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQAWI 142

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.