The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

ESPLPKPVLDTNGKELNPNSSYRIISIGRGALGGDVYLGKSPNSDAPCPDGVFRYNSDVG
PSGTPVRFIPLSGGIFEDQLLNIQFNIATVKLCVSYTIWKVGNLNAYFRTMLLETGGTIG
QADSSYFKIVKLSNFGYNLLYCPITPPFLCPFCRDDNFCAKVGVVIQNGKRRLALVNENP
LDVLFQEV
Sequence Info Allergen Name Length Opt Bits Score E Value
P16348 Sola t 2 188 1287 378.9 4.9e-107
CAA45723 Sola t 4 217 909 269.4 5.5e-74
P30941 Sola t 4 221 902 267.3 2.3e-73
P20347 Sola t 3.0102 222 192 61.7 1.8e-11
O24383 Sola t 3.0101 186 190 61.2 2.1e-11
AAB23464 Gly m TI 216 160 52.4 1.1e-08
CAA45778 Gly m TI 217 156 51.3 2.5e-08
P01071 Gly m TI 181 154 50.8 2.8e-08
CAA45777 Gly m TI 217 139 46.3 7.5e-07
AAB23483 Gly m TI 204 112 38.6 0.00015
AAB23482 Gly m TI 203 104 36.2 0.00076
CAA56343 Gly m TI 208 97 34.2 0.0032
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Sola t 2 Sequence ID: P16348

 Score = 378.9 bits 1287,  Expect = 5e-107
 Identities = 188/188 100%, Positives = 188/188 100%, Gaps = 0/188 0%
Query  1    ESPLPKPVLDTNGKELNPNSSYRIISIGRGALGGDVYLGKSPNSDAPCPDGVFRYNSDVG 60
            ESPLPKPVLDTNGKELNPNSSYRIISIGRGALGGDVYLGKSPNSDAPCPDGVFRYNSDVG
Sbjct  1    ESPLPKPVLDTNGKELNPNSSYRIISIGRGALGGDVYLGKSPNSDAPCPDGVFRYNSDVG 60
Query  61   PSGTPVRFIPLSGGIFEDQLLNIQFNIATVKLCVSYTIWKVGNLNAYFRTMLLETGGTIG 120
            PSGTPVRFIPLSGGIFEDQLLNIQFNIATVKLCVSYTIWKVGNLNAYFRTMLLETGGTIG
Sbjct  61   PSGTPVRFIPLSGGIFEDQLLNIQFNIATVKLCVSYTIWKVGNLNAYFRTMLLETGGTIG 120
Query  121  QADSSYFKIVKLSNFGYNLLYCPITPPFLCPFCRDDNFCAKVGVVIQNGKRRLALVNENP 180
            QADSSYFKIVKLSNFGYNLLYCPITPPFLCPFCRDDNFCAKVGVVIQNGKRRLALVNENP
Sbjct  121  QADSSYFKIVKLSNFGYNLLYCPITPPFLCPFCRDDNFCAKVGVVIQNGKRRLALVNENP 180
Query  181  LDVLFQEV 188
            LDVLFQEV
Sbjct  181  LDVLFQEV 188

Sequence Alignment: 2. Allergen Name: Sola t 4 Sequence ID: CAA45723

 Score = 269.4 bits 909,  Expect = 5e-74
 Identities = 136/182 74%, Positives = 151/182 82%, Gaps = 0/182 0%
Query  7    PVLDTNGKELNPNSSYRIISIGRGALGGDVYLGKSPNSDAPCPDGVFRYNSDVGPSGTPV 66
            PVLD  GKEL+   SYRIIS   GALGGDVYLGKSPNSDAPC +G+FRYNSDVGPSGTPV
Sbjct  35   PVLDVAGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGIFRYNSDVGPSGTPV 94
Query  67   RFIPLSGGIFEDQLLNIQFNIATVKLCVSYTIWKVGNLNAYFRTMLLETGGTIGQADSSY 126
            RF  +  GIFE++LLNIQF I+T KLCVSYTIWKVG+ +A + TMLLETGGTIGQADSS+
Sbjct  95   RFSHFGQGIFENELLNIQFAISTSKLCVSYTIWKVGDYDASLGTMLLETGGTIGQADSSW 154
Query  127  FKIVKLSNFGYNLLYCPITPPFLCPFCRDDNFCAKVGVVIQNGKRRLALVNENPLDVLFQ 186
            FKIVK S FGYNLLYCP+T    CPF  DD FC KVGVV QNGKRRLALV +NPLDV F+
Sbjct  155  FKIVKSSQFGYNLLYCPVTSTMSCPFSSDDQFCLKVGVVHQNGKRRLALVKDNPLDVSFK 214
Query  187  EV 188
            +V
Sbjct  215  QV 216

Sequence Alignment: 3. Allergen Name: Sola t 4 Sequence ID: P30941

 Score = 267.3 bits 902,  Expect = 2e-73
 Identities = 138/182 75%, Positives = 152/182 83%, Gaps = 4/182 2%
Query  7    PVLDTNGKELNPNSSYRIISIGRGALGGDVYLGKSPNSDAPCPDGVFRYNSDVGPSGTPV 66
            PVLD  GKEL+   SYRIIS   GALGGDVYLGKSPNSDAPC +G+FRYNSDVGPSGTPV
Sbjct  35   PVLDVAGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGIFRYNSDVGPSGTPV 94
Query  67   RFIPLSG----GIFEDQLLNIQFNIATVKLCVSYTIWKVGNLNAYFRTMLLETGGTIGQA 122
            RFI  S     GIFE++LLNIQF I+T KLCVSYTIWKVG+ +A + TMLLETGGTIGQA
Sbjct  95   RFIGSSSHFGQGIFENELLNIQFAISTSKLCVSYTIWKVGDYDASLGTMLLETGGTIGQA 154
Query  123  DSSYFKIVKLSNFGYNLLYCPITPPFLCPFCRDDNFCAKVGVVIQNGKRRLALVNENPLD 182
            DSS+FKIVK S FGYNLLYCP+T    CPF  DD FC KVGVV QNGKRRLALV +NPLD
Sbjct  155  DSSWFKIVKSSQFGYNLLYCPVTSTMSCPFSSDDQFCLKVGVVHQNGKRRLALVKDNPLD 214
Query  183  VLFQEV 188
            V F++V
Sbjct  215  VSFKQV 220

Sequence Alignment: 4. Allergen Name: Sola t 3.0102 Sequence ID: P20347

 Score = 61.7 bits 192,  Expect = 2e-11
 Identities = 59/153 38%, Positives = 86/153 56%, Gaps = 37/153 24%
Query  4    LPKPVLDTNGKELNPNSSYRIISIGRGALGGDVYLGKSPNSDAPCPDGVFRYNS--DVGP 61
            LP+ V D +G  L     Y I +   GA  G VYL    N    CP+ V+++ S      
Sbjct  45   LPE-VYDQDGNPLRIGERYIINNPLLGA--GAVYLYNIGNLQ--CPNAVLQHMSIPQFLG 99
Query  62   SGTPVRFIPLSGGIFED-----QLLNIQFNIATVKLCVSYTIWKVGNLNAYFRTMLLETG 116
             GTPV F+  S   + D      ++ I+F + T KLCV  T+WKV +        L+ TG
Sbjct  100  EGTPVVFVRKSESDYGDVVRVMTVVYIKFFVKTTKLCVDQTVWKVND------EQLVVTG 153
Query  117  GTIGQADSSYFKIVKL-------SNFGYNLLYCPITPPFLCPFCRDDNFCAKVGVVIQNG 169
            G +G  ++  FKI+K        S + Y LL+CP               C  +G   +NG
Sbjct  154  GKVGN-ENDIFKIMKTDLVTPGGSKYVYKLLHCP-----------SHLGCKNIGGNFKNG 201
Query  170  KRRLALVNEN 179
              RL  V+++
Sbjct  202  YPRLVTVDDD 211

Sequence Alignment: 5. Allergen Name: Sola t 3.0101 Sequence ID: O24383

 Score = 61.2 bits 190,  Expect = 2e-11
 Identities = 64/152 42%, Positives = 85/152 55%, Gaps = 36/152 23%
Query  4    LPKPVLDTNGKELNPNSSYRIISIGRGALGGDVYLGKSPNSDAPCPDGVFRYNS--DVGP 61
            LP+ V D +G  L     Y I +   GA  G VYL    N    CP+ V+++ S      
Sbjct  10   LPE-VYDQDGNPLRIGERYIIKNPLLGA--GAVYLDNIGN--LQCPNAVLQHMSIPQFLG 64
Query  62   SGTPVRFIPLSGGIFED--QLLN---IQFNIATVKLCVSYTIWKVGNLNAYFRTMLLETG 116
             GTPV FI  S   + D  +L+    I+F + T KLCV  T+WKV N        L+ TG
Sbjct  65   KGTPVVFIRKSESDYGDVVRLMTAVYIKFFVKTTKLCVDETVWKVNN------EQLVVTG 118
Query  117  GTIGQADSSYFKIVK--LSNFG----YNLLYCPITPPFLCPFCRDDNFCAKVGVVIQNGK 170
            G +G  ++  FKI K  L   G    Y LL+CP               C  +G   +NG 
Sbjct  119  GNVGN-ENDIFKIKKTDLVIRGMKNVYKLLHCP-----------SHLECKNIGSNFKNGY 166
Query  171  RRLALVNE 178
             RL  VN+
Sbjct  167  PRLVTVND 174

Sequence Alignment: 6. Allergen Name: Gly m TI Sequence ID: AAB23464

 Score = 52.4 bits 160,  Expect = 1e-08
 Identities = 50/166 30%, Positives = 86/166 51%, Gaps = 23/166 13%
Query  8    VLDTNGKELNPNSSYRIISIGRGALGGDVYLGKSPNSDAPCPDGVFRYNSDVGPS-GTPV 66
            VLD  G  L    +Y I+S    A+GG   +  +P  +  CP  V +  +++    GT +
Sbjct  27   VLDNEGNPLENGGTYYILS-DITAFGG---IRAAPTGNERCPLTVVQSRNELDKGIGTII 82
Query  67   RFIPLSGGIFEDQLLNIQFN-IATVKLCVSY-TIWKVGNLNAYFRTMLLETGGTIGQADS 124
                    I E + L+++F+  A + LCV   T W V  +        ++ G      D 
Sbjct  83   SSPYRIRFIAEGHPLSLKFDSFAVIMLCVGIPTEWSV--VEDLPEGPAVKIGENKDAMDG 140
Query  125  SYFKIVKLSN--FG-YNLLYCPITPPFLCPFCRDDNFCAKVGVVIQ--NGKRRLALVNEN 179
             +F++ ++S+  F  Y L++CP           +D+ C  +G+ I   +G RRL +    
Sbjct  141  -WFRLERVSDDEFNNYKLVFCPQQA--------EDDKCGDIGISIDHDDGTRRLVVSKNK 191
Query  180  PLDVLFQEV 188
            PL V FQ++
Sbjct  192  PLVVQFQKL 200

Sequence Alignment: 7. Allergen Name: Gly m TI Sequence ID: CAA45778

 Score = 51.3 bits 156,  Expect = 2e-08
 Identities = 55/160 34%, Positives = 85/160 53%, Gaps = 35/160 21%
Query  8    VLDTNGKELNPNSSYRIISIGRGALGGDVYLGKSPNSDAPCPDGVF--RYNSDVGPS--- 62
            VLD  G  L+   +Y I+S    A+GG   +  +P  +  CP  V   R   D G     
Sbjct  28   VLDNEGNPLDSGGTYYILS-DITAFGG---IRAAPTGNERCPLTVVQSRNELDKGIGTII 83
Query  63   GTP--VRFIPLSGGIFEDQLLNIQFN-IATVKLCVSY-TIWKVGNLNAYFRTMLLETGGT 118
             +P  +RFI       E   L ++F+  A + LCV   T W V  +        ++ G  
Sbjct  84   SSPFRIRFIA------EGNPLRLKFDSFAVIMLCVGIPTEWSV--VEDLPEGPAVKIGEN 135
Query  119  IGQADSSYFKIVKLSN--FG-YNLLYCPITPPFLCPFCRDDNFCAKVGVVIQ--NGKRRL 173
                D  +F+I ++S+  F  Y L++C            +D+ C  +G+ I   +G RRL
Sbjct  136  KDAVDG-WFRIERVSDDEFNNYKLVFCTQQA--------EDDKCGDIGISIDHDDGTRRL 186
Query  174  ALVNENPLDVLFQEV 188
             +    PL V FQ+V
Sbjct  187  VVSKNKPLVVQFQKV 201

Sequence Alignment: 8. Allergen Name: Gly m TI Sequence ID: P01071

 Score = 50.8 bits 154,  Expect = 3e-08
 Identities = 55/160 34%, Positives = 85/160 53%, Gaps = 35/160 21%
Query  8    VLDTNGKELNPNSSYRIISIGRGALGGDVYLGKSPNSDAPCPDGVF--RYNSDVGPS--- 62
            VLD  G  L+   +Y I+S    A+GG   +  +P  +  CP  V   R   D G     
Sbjct  3    VLDNEGNPLSNGGTYYILS-DITAFGG---IRAAPTGNERCPLTVVQSRNELDKGIGTII 58
Query  63   GTP--VRFIPLSGGIFEDQLLNIQFN-IATVKLCVSY-TIWKVGNLNAYFRTMLLETGGT 118
             +P  +RFI       E   L ++F+  A + LCV   T W V  +        ++ G  
Sbjct  59   SSPFRIRFIA------EGNPLRLKFDSFAVIMLCVGIPTEWSV--VEDLPEGPAVKIGEN 110
Query  119  IGQADSSYFKIVKLSN--FG-YNLLYCPITPPFLCPFCRDDNFCAKVGVVIQ--NGKRRL 173
                D  +F+I ++S+  F  Y L++C            +D+ C  +G+ I   +G RRL
Sbjct  111  KDAVDG-WFRIERVSDDEFNNYKLVFCTQQA--------EDDKCGDIGISIDHDDGTRRL 161
Query  174  ALVNENPLDVLFQEV 188
             +    PL V FQ+V
Sbjct  162  VVSKNKPLVVQFQKV 176

Sequence Alignment: 9. Allergen Name: Gly m TI Sequence ID: CAA45777

 Score = 46.3 bits 139,  Expect = 7e-07
 Identities = 50/166 30%, Positives = 86/166 51%, Gaps = 23/166 13%
Query  8    VLDTNGKELNPNSSYRIISIGRGALGGDVYLGKSPNSDAPCPDGVFRYNSDVGPS-GTPV 66
            VLD  G  L    +Y I+S    A+GG   +  +P  +  CP  V +  +++    GT +
Sbjct  28   VLDNEGNPLENGGTYYILS-DITAFGG---IRAAPTGNERCPLTVVQSRNELDKGIGTII 83
Query  67   RFIPLSGGIFEDQLLNIQFN-IATVKLCVSY-TIWKVGNLNAYFRTMLLETGGTIGQADS 124
                    I E + L+++F+  A + LCV   T W V  +        ++ G      D 
Sbjct  84   SSPYRIRFIAEGHPLSLKFDSFAVIMLCVGIPTEWSV--VEDLPEGPAVKIGENKDAMDG 141
Query  125  SYFKIVKLSN--FG-YNLLYCPITPPFLCPFCRDDNFCAKVGVVIQ--NGKRRLALVNEN 179
             +F++ ++S+  F  Y L++CP           +D+ C  +G+ I   +G RRL +    
Sbjct  142  -WFRLERVSDDEFNNYKLVFCPQQA--------EDDKCGDIGISIDHDDGTRRLVVSKNK 192
Query  180  PLDVLFQEV 188
            PL V FQ++
Sbjct  193  PLVVQFQKL 201

Sequence Alignment: 10. Allergen Name: Gly m TI Sequence ID: AAB23483

 Score = 38.6 bits 112,  Expect = 0.0002
 Identities = 54/166 32%, Positives = 84/166 50%, Gaps = 19/166 11%
Query  8    VLDTNGKELNPNSSYRIISIGRGALGGDVYLGKSPNSDAPCPDGVFRYNSDVGPSGTPVR 67
            VLDT+   L    +Y ++ + RG  GG    G S   +  CP  V + + +    G  + 
Sbjct  28   VLDTDDDPLQNGGTYYMLPVMRGKSGG--IEGNSTGKEI-CPLTVVQ-SPNKHNKGIGLV 83
Query  68   FI-PLSGGIFEDQL-LNIQFN-IATVKLC-VSYTIWKVGNLNAYFRTMLLETGGTIGQAD 123
            F  PL      ++  L+I+F+  A + LC V  T W +      ++ + L    T+    
Sbjct  84   FKSPLHALFIAERYPLSIKFDSFAVIPLCGVMPTKWAIVEREG-LQAVTLAARDTV---- 138
Query  124  SSYFKIVKLSNFGYNLLYCPITPPFLCPFCRDDNFCAKVGVVIQN-GKRRLALVNENPLD 182
              +F I ++S   YN  Y  +    +CP   +DN C  +G+ I N G RRL L    PL 
Sbjct  139  DGWFNIERVSRE-YNDYYKLV----FCPQEAEDNKCEDIGIQIDNDGIRRLVLSKNKPLV 193
Query  183  VLFQE 187
            V FQ+
Sbjct  194  VEFQK 198

Sequence Alignment: 11. Allergen Name: Gly m TI Sequence ID: AAB23482

 Score = 36.2 bits 104,  Expect = 0.0008
 Identities = 49/163 30%, Positives = 83/163 50%, Gaps = 24/163 14%
Query  8    VLDTNGKELNPNSSYRIISIGRGALGGDVYLGKSPNSDAPCPDGVFRYNSDVGPSGTPVR 67
            VLDT+   L    +Y ++ + RG  GG + +  +      CP  V +  +++   G  + 
Sbjct  28   VLDTDDDPLQNGGTYYMLPVMRGK-GGGIEVDST--GKEICPLTVVQSPNELD-KGIGLV 83
Query  68   FI-PLSGGIFEDQL-LNIQF-NIATVKLCVSY-TIWKVGNLNAYFRTMLLETGGTIGQAD 123
            F  PL      ++  L+I+F + A + LC    T W +      ++ + L    T+    
Sbjct  84   FTSPLHALFIAERYPLSIKFGSFAVITLCAGMPTEWAIVEREG-LQAVKLAARDTV---- 138
Query  124  SSYFKIVKLSNF--GYNLLYCPITPPFLCPFCRDDNFCAKVGVVIQN-GKRRLALVNENP 180
              +F I ++S     Y L++CP           +DN C  +G+ I + G RRL L    P
Sbjct  139  DGWFNIERVSREYNDYKLVFCPQQA--------EDNKCEDIGIQIDDDGIRRLVLSKNKP 190
Query  181  LDVLFQE 187
            L V FQ+
Sbjct  191  LVVQFQK 197

Sequence Alignment: 12. Allergen Name: Gly m TI Sequence ID: CAA56343

 Score = 34.2 bits 97,  Expect = 0.003
 Identities = 44/166 26%, Positives = 86/166 51%, Gaps = 22/166 13%
Query  8    VLDTNGKELNPNSSYRIISIGRGALGGDVYLGKSPNSDAPCPDGVFRYNSDVGPSGTPVR 67
            V+DT G  +    +Y ++ + RG  GG + + K+      CP  V +   +    G P+ 
Sbjct  28   VFDTEGNPIRNGGTYYVLPVIRGK-GGGIEFAKTETE--TCPLTVVQSPFEGLQRGLPLI 84
Query  68   FI-PLSG-GIFEDQLLNIQFNIATVKLCVSYTIWKVGNLNAYFRTMLLETGGTIGQADSS 125
               P+    I E  +L+++F++ T     S+++ +    +A  R    +T   + + +  
Sbjct  85   ISSPFKILDITEGLILSLKFHLCTPLSLNSFSVDRYSQGSA--RRTPCQTHW-LQKHNRC 141
Query  126  YFKIVKLSNFG--YNLLYCPITPPFLCPFCRDDNFCAKVGVVI-QNGKRRLALVNE--NP 180
            +F+I + S+    Y L++C            DD+ C  +   I + G R L + ++  +P
Sbjct  142  WFRIQRASSESNYYKLVFCT---------SNDDSSCGDIVAPIDREGNRPLIVTHDQNHP 192
Query  181  LDVLFQEV 188
            L V FQ+V
Sbjct  193  LLVQFQKV 200

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.