The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

FGTRFRQRQCVGPRRTRRRWTQQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATD
VGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Sequence Info Allergen Name Length Opt Bits Score E Value
BAA07774 Ory s TAI 113 846 125.1 4.7e-31
BAA07710 Ory s TAI 166 711 107.1 1.7e-25
BAA07773 Ory s TAI 109 705 106.0 2.5e-25
BAA02000 Ory s TAI 166 703 106.0 3.7e-25
BAA01998 Ory s TAI 165 693 104.7 9.4e-25
BAA07711 Ory s TAI 160 691 104.4 1.1e-24
BAA07772 Ory s TAI 111 686 103.4 1.5e-24
BAA01997 Ory s TAI 162 646 98.3 7.5e-23
BAA07713 Ory s TAI 160 569 87.9 1e-19
BAA01996 Ory s TAI 157 555 86.0 3.7e-19
BAA07712 Ory s TAI 157 515 80.6 1.6e-17
AAB99797 Ory s TAI 157 404 65.6 5.1e-13
P16968 Hor v 1 146 368 60.7 1.4e-11
P16968 Hor v 15.0101 146 368 60.7 1.4e-11
CBA13560 Tri a 15.0101 121 290 50.0 1.9e-08
P01083 Tri a TAI 123 288 49.8 2.3e-08
CAA08836 Hor v 1 152 283 49.3 4.2e-08
CAI84642 Tri a 28.0101 119 203 38.3 6.6e-05
P01085 Tri a TAI 124 203 38.3 6.7e-05
P01084 Tri a TAI 124 187 36.1 0.0003
BAA01999 Ory s TAI 95 181 35.1 0.00046
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ory s TAI Sequence ID: BAA07774

 Score = 125.1 bits 846,  Expect = 5e-31
 Identities = 113/113 100%, Positives = 113/113 100%, Gaps = 0/113 0%
Query  1    FGTRFRQRQCVGPRRTRRRWTQQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATD 60
            FGTRFRQRQCVGPRRTRRRWTQQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATD
Sbjct  1    FGTRFRQRQCVGPRRTRRRWTQQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATD 60
Query  61   VGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 113
            VGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Sbjct  61   VGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 113

Sequence Alignment: 2. Allergen Name: Ory s TAI Sequence ID: BAA07710

 Score = 107.1 bits 711,  Expect = 2e-25
 Identities = 96/107 89%, Positives = 98/107 91%, Gaps = 0/107 0%
Query  7    QRQCVGPRRTRRRWTQQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 66
            +RQCV       R  +QLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA
Sbjct  60   KRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 119
Query  67   EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 113
            EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Sbjct  120  EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 166

Sequence Alignment: 3. Allergen Name: Ory s TAI Sequence ID: BAA07773

 Score = 106.0 bits 705,  Expect = 2e-25
 Identities = 97/109 88%, Positives = 100/109 91%, Gaps = 1/109 0%
Query  4    RFRQRQCVGPRRTRRRWTQQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGH 63
            R  +RQCV  RRT     +QLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGH
Sbjct  1    RVVKRQCVATRRTGGA-DEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGH 59
Query  64   PMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 113
            PMAEVFPGCRRGDLERA A+LPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Sbjct  60   PMAEVFPGCRRGDLERARATLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 109

Sequence Alignment: 4. Allergen Name: Ory s TAI Sequence ID: BAA02000

 Score = 106.0 bits 703,  Expect = 4e-25
 Identities = 96/107 89%, Positives = 98/107 91%, Gaps = 0/107 0%
Query  7    QRQCVGPRRTRRRWTQQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 66
            +RQCVG         +QLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA
Sbjct  60   KRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 119
Query  67   EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 113
            EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Sbjct  120  EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 166

Sequence Alignment: 5. Allergen Name: Ory s TAI Sequence ID: BAA01998

 Score = 104.7 bits 693,  Expect = 9e-25
 Identities = 95/106 89%, Positives = 99/106 93%, Gaps = 1/106 0%
Query  7    QRQCVGPRRTRRRWTQQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 66
            +RQCVG R +     +QL QDCCR+LAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA
Sbjct  60   KRQCVGTR-SPGAVDEQLAQDCCRELAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 118
Query  67   EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 113
            EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Sbjct  119  EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 165

Sequence Alignment: 6. Allergen Name: Ory s TAI Sequence ID: BAA07711

 Score = 104.4 bits 691,  Expect = 1e-24
 Identities = 96/107 89%, Positives = 98/107 91%, Gaps = 1/107 0%
Query  7    QRQCVGPRRTRRRWTQQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 66
            +RQCVG         +QLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA
Sbjct  53   KRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 112
Query  67   EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGY-PRTPRTGH 113
            EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGY PRTPRTGH
Sbjct  113  EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYTPRTPRTGH 160

Sequence Alignment: 7. Allergen Name: Ory s TAI Sequence ID: BAA07772

 Score = 103.4 bits 686,  Expect = 1e-24
 Identities = 93/107 86%, Positives = 95/107 88%, Gaps = 0/107 0%
Query  7    QRQCVGPRRTRRRWTQQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 66
            +RQCV         T+QLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA
Sbjct  5    KRQCVATTHPAAPGTEQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 64
Query  67   EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 113
            EVFPGCRRGDLER   SLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH
Sbjct  65   EVFPGCRRGDLERRRRSLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 111

Sequence Alignment: 8. Allergen Name: Ory s TAI Sequence ID: BAA01997

 Score = 98.3 bits 646,  Expect = 8e-23
 Identities = 87/105 82%, Positives = 93/105 88%, Gaps = 2/105 1%
Query  7    QRQCVGPRRTRRRWTQQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 66
            +RQCVG  R      +Q+ QDCCRQLAAVDD WCRC AL+HM+ GIYRELGAT+ GHPMA
Sbjct  58   RRQCVG--RGASAADEQVWQDCCRQLAAVDDGWCRCGALDHMLSGIYRELGATEAGHPMA 115
Query  67   EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 113
            EVFPGCRRGDLERAAASLPAFCNVDIPNG GGVCYWLGYPRTPRTGH
Sbjct  116  EVFPGCRRGDLERAAASLPAFCNVDIPNGPGGVCYWLGYPRTPRTGH 162

Sequence Alignment: 9. Allergen Name: Ory s TAI Sequence ID: BAA07713

 Score = 87.9 bits 569,  Expect = 1e-19
 Identities = 77/95 81%, Positives = 85/95 89%, Gaps = 2/95 2%
Query  7    QRQCVGPRRTRRRWTQQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 66
            +RQCVG  R      +Q+R+DCCRQLAAVDDSWCRC A++HM+GGIYRELGA DVGHPM+
Sbjct  61   KRQCVG--RGTAAAAEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMS 118
Query  67   EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWL 103
            EVF GCRRGDLERAAASLPAFCNVDIPNG GGVCYWL
Sbjct  119  EVFRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWL 155

Sequence Alignment: 10. Allergen Name: Ory s TAI Sequence ID: BAA01996

 Score = 86.0 bits 555,  Expect = 4e-19
 Identities = 75/93 80%, Positives = 83/93 89%, Gaps = 4/93 4%
Query  7    QRQCVGPRRTRRRWTQQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMA 66
            +RQC G         +Q+R+DCCRQLAAVDDSWCRC A++HM+GGIYRELGA DVGHPM+
Sbjct  60   KRQCRGSAAA----AEQVRRDCCRQLAAVDDSWCRCEAISHMLGGIYRELGAPDVGHPMS 115
Query  67   EVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWL 103
            EVF GCRRGDLERAAASLPAFCNVDIPNG GGVCYWL
Sbjct  116  EVFRGCRRGDLERAAASLPAFCNVDIPNGGGGVCYWL 152

Sequence Alignment: 11. Allergen Name: Ory s TAI Sequence ID: BAA07712

 Score = 80.6 bits 515,  Expect = 2e-17
 Identities = 73/100 73%, Positives = 81/100 81%, Gaps = 9/100 9%
Query  5    FRQRQCVGPRRTRRRWTQQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHP 64
            F +RQCV P        +Q+R+ CCRQLA +D SWCRC ALNHM+  IYRE  A D GHP
Sbjct  58   FVKRQCVAPGTL----DEQVRRGCCRQLAGIDSSWCRCDALNHMLRIIYREERAADAGHP 113
Query  65   MAEVFPGCRRGDLERAAASLPAFCNVDIPNGTGGVCYWLGYPRTPRTGH 113
            MAEVF GCRRGD+ERAAASLPAFCNVDIPNG GGVCYWL     P TG+
Sbjct  114  MAEVFRGCRRGDIERAAASLPAFCNVDIPNGVGGVCYWL-----PGTGY 157

Sequence Alignment: 12. Allergen Name: Ory s TAI Sequence ID: AAB99797

 Score = 65.6 bits 404,  Expect = 5e-13
 Identities = 58/89 65%, Positives = 65/89 73%, Gaps = 4/89 4%
Query  11   VGPRRTRRRWTQQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFP 70
            +G  R RRR    +  DCCRQ+  VD SWCRC A++HM+GGIYRELGA DVGHPM+EVF 
Sbjct  64   LGRARPRRR---AVPGDCCRQFPPVDYSWCRCEAISHMLGGIYRELGAPDVGHPMSEVFR 120
Query  71   GCRRGDLERAAASLPAFCNVDIPNGTGGVCYWL 103
            GCRRG    A    P    VDIPNG GGVCYWL
Sbjct  121  GCRRGTWS-ARRRAPGVLQVDIPNGGGGVCYWL 152

Sequence Alignment: 13. Allergen Name: Hor v 1 Sequence ID: P16968

 Score = 60.7 bits 368,  Expect = 1e-11
 Identities = 54/99 54%, Positives = 68/99 68%, Gaps = 9/99 9%
Query  7    QRQCVGPRRTRRRWTQQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGAT--DVGHP 64
            + QC G +       + +++DCCRQ+AA+ D WC C AL  M G +Y+ELG    D    
Sbjct  39   KSQCAGGQ-----VVESIQKDCCRQIAAIGDEWCICGALGSMRGSMYKELGVALADDKAT 93
Query  65   MAEVFPGCRRGDLERAAASLPAFCNVDIPN--GTGGVCYWLGYPRTPR 110
            +AEVFPGCR   ++RA ASLPA CN  IPN  GT GVCYWL Y + PR
Sbjct  94   VAEVFPGCRTEVMDRAVASLPAVCNQYIPNTNGTDGVCYWLSYYQPPR 141

Sequence Alignment: 14. Allergen Name: Hor v 15.0101 Sequence ID: P16968

 Score = 60.7 bits 368,  Expect = 1e-11
 Identities = 54/99 54%, Positives = 68/99 68%, Gaps = 9/99 9%
Query  7    QRQCVGPRRTRRRWTQQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGAT--DVGHP 64
            + QC G +       + +++DCCRQ+AA+ D WC C AL  M G +Y+ELG    D    
Sbjct  39   KSQCAGGQ-----VVESIQKDCCRQIAAIGDEWCICGALGSMRGSMYKELGVALADDKAT 93
Query  65   MAEVFPGCRRGDLERAAASLPAFCNVDIPN--GTGGVCYWLGYPRTPR 110
            +AEVFPGCR   ++RA ASLPA CN  IPN  GT GVCYWL Y + PR
Sbjct  94   VAEVFPGCRTEVMDRAVASLPAVCNQYIPNTNGTDGVCYWLSYYQPPR 141

Sequence Alignment: 15. Allergen Name: Tri a 15.0101 Sequence ID: CBA13560

 Score = 50.0 bits 290,  Expect = 2e-08
 Identities = 45/89 50%, Positives = 63/89 70%, Gaps = 12/89 13%
Query  9    QCVGPRRTRRRWTQQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEV 68
            QCVG +       + + +DCC+QLA V++ WCRC  L+ M+  +Y+ELGA + G    EV
Sbjct  28   QCVGSQV-----PEAVLRDCCQQLADVNNEWCRCEDLSSMLRSVYQELGARE-GK---EV 78
Query  69   FPGCRRGDLERAAASLPAFCNVDIPNGTG---GVCYWLGYP 106
            +PGCR+  ++  AAS+P    V IPN +G   GVCYW  YP
Sbjct  79   LPGCRKEVMKLTAASVPEVRKVPIPNPSGDRAGVCYWAAYP 119

Sequence Alignment: 16. Allergen Name: Tri a TAI Sequence ID: P01083

 Score = 49.8 bits 288,  Expect = 2e-08
 Identities = 44/89 49%, Positives = 63/89 70%, Gaps = 14/89 15%
Query  9    QCVGPRRTRRRWTQQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEV 68
            QCVG +       + + +DCC+QLA +++ WCRC  L+ M+  +Y+ELG  + G    EV
Sbjct  28   QCVGSQV-----PEAVLRDCCQQLADINNEWCRCGDLSSMLRSVYQELGVRE-GK---EV 78
Query  69   FPGCRRGDLERAAASLPAFCNVDIPNGTG---GVCY--WLGYP 106
            +PGCR+  ++  AAS+P  C V IPN +G   GVCY  W  YP
Sbjct  79   LPGCRKEVMKLTAASVPEVCKVPIPNPSGDRAGVCYGDWAAYP 121

Sequence Alignment: 17. Allergen Name: Hor v 1 Sequence ID: CAA08836

 Score = 49.3 bits 283,  Expect = 4e-08
 Identities = 41/86 47%, Positives = 58/86 67%, Gaps = 11/86 12%
Query  9    QCVGPRRTRRRWTQQLRQDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEV 68
            +CVG      R  + + +DCC+++A + + WCRC  L  M+  +Y  LG   VG    EV
Sbjct  58   ECVG-----NRVPEDVLRDCCQEVANISNEWCRCGDLGSMLRSVYAALG---VGGGPEEV 109
Query  69   FPGCRRGDLERAAASLPAFCNVDIPN---GTGGVCYW 102
            FPGC++  ++   A +PA+CNV IPN   GT GVCYW
Sbjct  110  FPGCQKDVMKLLVAGVPALCNVPIPNEAAGTRGVCYW 146

Sequence Alignment: 18. Allergen Name: Tri a 28.0101 Sequence ID: CAI84642

 Score = 38.3 bits 203,  Expect = 7e-05
 Identities = 33/73 45%, Positives = 47/73 64%, Gaps = 6/73 8%
Query  26   QDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLP 85
            +DCC+QLA + + WCRC AL  M+  +Y+E GA + G+     FP CRR  ++  AAS+ 
Sbjct  34   RDCCQQLAHISE-WCRCGALYSMLDSMYKEHGAQE-GQAGTGAFPRCRREVVKLTAASIT 91
Query  86   AFCNVDI---PNGTGG-VC 100
            A C + I    +G G  VC
Sbjct  92   AVCRLPIVVDASGDGAYVC 110

Sequence Alignment: 19. Allergen Name: Tri a TAI Sequence ID: P01085

 Score = 38.3 bits 203,  Expect = 7e-05
 Identities = 33/73 45%, Positives = 47/73 64%, Gaps = 6/73 8%
Query  26   QDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLP 85
            +DCC+QLA + + WCRC AL  M+  +Y+E GA + G+     FP CRR  ++  AAS+ 
Sbjct  39   RDCCQQLAHISE-WCRCGALYSMLDSMYKEHGAQE-GQAGTGAFPRCRREVVKLTAASIT 96
Query  86   AFCNVDI---PNGTGG-VC 100
            A C + I    +G G  VC
Sbjct  97   AVCRLPIVVDASGDGAYVC 115

Sequence Alignment: 20. Allergen Name: Tri a TAI Sequence ID: P01084

 Score = 36.1 bits 187,  Expect = 0.0003
 Identities = 31/73 42%, Positives = 46/73 63%, Gaps = 6/73 8%
Query  26   QDCCRQLAAVDDSWCRCSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLP 85
            +DCC+QLA + + W RC AL  M+  +Y+E G ++ G+     FP CRR  ++  AAS+ 
Sbjct  39   RDCCQQLADISE-WPRCGALYSMLDSMYKEHGVSE-GQAGTGAFPSCRREVVKLTAASIT 96
Query  86   AFCNVDI---PNGTGG-VC 100
            A C + I    +G G  VC
Sbjct  97   AVCRLPIVVDASGDGAYVC 115

Sequence Alignment: 21. Allergen Name: Ory s TAI Sequence ID: BAA01999

 Score = 35.1 bits 181,  Expect = 0.0005
 Identities = 25/38 65%, Positives = 29/38 76%, Gaps = 2/38 5%
Query  7    QRQCVGPRRTRRRWTQQLRQDCCRQLAAVDDSWCRCSALN 46
            +RQCVG  R      +Q+ QDCCRQLAAVDD WCRC AL+
Sbjct  58   RRQCVG--RGASAADEQVWQDCCRQLAAVDDGWCRCGALD 95

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.