The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

GILPECKLVPEEISFVLSTRENRDGVYLTLQKLKNGKMFKNSDLSSKKVPFLIHGFISSA
TNKNYADMTRALLDKDDIMVISIDWRDGACSNEFALLKFIGYPKAVENTRAVGKYIADFS
KILIQKYKVLLENIRLIGHSLGAQIAGFAGKEFQRFKLGKYPEIIGLDPAGPSFKKKDCP
ERICETDAHYVQILHTSSNLGTERTLGTVDFYINDGSNQPGCTYIIGETCSHTRAVKYLT
ECIRRECCLIGVPQSKNPQPVSKCTRNECVCVGLNAKEYPKKGSFYVPVEAKAPFCNNNG
KII
Sequence Info Allergen Name Length Opt Bits Score E Value
P53357 Dol m 1.02 303 2047 473.1 5.6e-135
C0HLL3 Vesp v 1.0101 304 1722 399.1 1.1e-112
Q06478 Dol m 1.0101 317 1415 329.1 1.4e-91
ACA00159 Vesp c 1.0101 301 1355 315.4 1.7e-87
P49369 Ves v 1 336 1293 301.2 3.5e-83
P51528 Ves m 1 300 1292 301.0 3.5e-83
ABN13879 Poly p 1.0101 322 1271 296.2 1.1e-81
Q9U6W0 Pol a 1 301 1241 289.4 1.1e-79
AAS67042 Pol d 1.0102 316 1208 281.9 2.2e-77
AAS67043 Pol d 1.0103 316 1206 281.4 3e-77
AAS67041 Pol d 1.0101 337 1204 280.9 4.4e-77
AAS67044 Pol d 1.0104 316 1199 279.8 9.1e-77
3989146 Ves s 1.0101 298 1168 272.8 1.1e-74
3989146 Pol e 1.0101 302 1027 240.6 5.4e-65
AAT95008 Sol i 1.0101 346 472 114.1 7.8e-27
P83542 Pol g 1.0101 42 103 34.9 0.00066
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Dol m 1.02 Sequence ID: P53357

 Score = 473.1 bits 2047,  Expect = 6e-135
 Identities = 303/303 100%, Positives = 303/303 100%, Gaps = 0/303 0%
Query  1    GILPECKLVPEEISFVLSTRENRDGVYLTLQKLKNGKMFKNSDLSSKKVPFLIHGFISSA 60
            GILPECKLVPEEISFVLSTRENRDGVYLTLQKLKNGKMFKNSDLSSKKVPFLIHGFISSA
Sbjct  1    GILPECKLVPEEISFVLSTRENRDGVYLTLQKLKNGKMFKNSDLSSKKVPFLIHGFISSA 60
Query  61   TNKNYADMTRALLDKDDIMVISIDWRDGACSNEFALLKFIGYPKAVENTRAVGKYIADFS 120
            TNKNYADMTRALLDKDDIMVISIDWRDGACSNEFALLKFIGYPKAVENTRAVGKYIADFS
Sbjct  61   TNKNYADMTRALLDKDDIMVISIDWRDGACSNEFALLKFIGYPKAVENTRAVGKYIADFS 120
Query  121  KILIQKYKVLLENIRLIGHSLGAQIAGFAGKEFQRFKLGKYPEIIGLDPAGPSFKKKDCP 180
            KILIQKYKVLLENIRLIGHSLGAQIAGFAGKEFQRFKLGKYPEIIGLDPAGPSFKKKDCP
Sbjct  121  KILIQKYKVLLENIRLIGHSLGAQIAGFAGKEFQRFKLGKYPEIIGLDPAGPSFKKKDCP 180
Query  181  ERICETDAHYVQILHTSSNLGTERTLGTVDFYINDGSNQPGCTYIIGETCSHTRAVKYLT 240
            ERICETDAHYVQILHTSSNLGTERTLGTVDFYINDGSNQPGCTYIIGETCSHTRAVKYLT
Sbjct  181  ERICETDAHYVQILHTSSNLGTERTLGTVDFYINDGSNQPGCTYIIGETCSHTRAVKYLT 240
Query  241  ECIRRECCLIGVPQSKNPQPVSKCTRNECVCVGLNAKEYPKKGSFYVPVEAKAPFCNNNG 300
            ECIRRECCLIGVPQSKNPQPVSKCTRNECVCVGLNAKEYPKKGSFYVPVEAKAPFCNNNG
Sbjct  241  ECIRRECCLIGVPQSKNPQPVSKCTRNECVCVGLNAKEYPKKGSFYVPVEAKAPFCNNNG 300
Query  301  KII 303
            KII
Sbjct  301  KII 303

Sequence Alignment: 2. Allergen Name: Vesp v 1.0101 Sequence ID: C0HLL3

 Score = 399.1 bits 1722,  Expect = 1e-112
 Identities = 247/303 81%, Positives = 275/303 90%, Gaps = 1/303 0%
Query  1    GILPECKLVPEEISFVLSTRENRDGVYLTLQKLKNGKMFKNSDLSSKKVPFLIHGFISSA 60
            G+LP+CKLVPE+ISF+LSTRENR+GV+LTL  LK G ++  SDLSS +V FLIHGFISSA
Sbjct  1    GLLPKCKLVPEQISFILSTRENRNGVFLTLDSLKKGGILNKSDLSSTQVVFLIHGFISSA 60
Query  61   TNKNYADMTRALLDKDDIMVISIDWRDGACSNEFALLKFIGYPKAVENTRAVGKYIADFS 120
             N NY DMT+ALL+K+D MVISIDWR+GAC+NEF +LKFIGYPKAVENTR VGKYIADFS
Sbjct  61   NNSNYMDMTKALLEKNDCMVISIDWRNGACTNEFQILKFIGYPKAVENTRTVGKYIADFS 120
Query  121  KILIQKYKVLLENIRLIGHSLGAQIAGFAGKEFQRFKLGKYPEIIGLDPAGPSFKKKDCP 180
            K+L+QKYKV L NIRLIGHSLGAQIAGFAGKE+Q+FKLGKYPEIIGLDPAGP FK  DC 
Sbjct  121  KLLMQKYKVSLANIRLIGHSLGAQIAGFAGKEYQKFKLGKYPEIIGLDPAGPLFKSNDCS 180
Query  181  ERICETDAHYVQILHTSSNLGTERTLGTVDFYINDGSNQPGCTY-IIGETCSHTRAVKYL 239
            +RICETDAHYVQI+HTS+NLGTERTLGTVDFY+N+G NQPGC Y  IGETCSHTRAV+Y+
Sbjct  181  QRICETDAHYVQIIHTSNNLGTERTLGTVDFYMNNGYNQPGCYYSFIGETCSHTRAVQYF 240
Query  240  TECIRRECCLIGVPQSKNPQPVSKCTRNECVCVGLNAKEYPKKGSFYVPVEAKAPFCNNN 299
            TECIR ECCLIGVPQSKNPQPVSKCTRNECVCVGLNAK YPK GSFYVPVE+KAP+CNN 
Sbjct  241  TECIRHECCLIGVPQSKNPQPVSKCTRNECVCVGLNAKRYPKTGSFYVPVESKAPYCNNK 300
Query  300  GKII 303
            GK I
Sbjct  301  GKKI 304

Sequence Alignment: 3. Allergen Name: Dol m 1.0101 Sequence ID: Q06478

 Score = 329.1 bits 1415,  Expect = 1e-91
 Identities = 203/297 68%, Positives = 241/297 81%, Gaps = 1/297 0%
Query  6    CKLVPEEISFVLSTRENRDGVYLTLQKLKNGKMFKNSDLSSKKVPFLIHGFISSATNKNY 65
            C +  + +  ++ TRENR   + TL  +     FK S +  + V F+ HGF SSAT KN+
Sbjct  21   CPFSNDTVKMIFLTRENRKHDFYTLDTMNRHNEFKKS-IIKRPVVFITHGFTSSATEKNF 79
Query  66   ADMTRALLDKDDIMVISIDWRDGACSNEFALLKFIGYPKAVENTRAVGKYIADFSKILIQ 125
              M+ AL+   D ++I +DWR  AC++E+  LK++ Y  AV NTR VG +IA  +K L++
Sbjct  80   VAMSEALMHTGDFLIIMVDWRMAACTDEYPGLKYMFYKAAVGNTRLVGNFIAMIAKKLVE 139
Query  126  KYKVLLENIRLIGHSLGAQIAGFAGKEFQRFKLGKYPEIIGLDPAGPSFKKKDCPERICE 185
            +YKV + NIRL+GHSLGA+I+GFAGK  Q +KLGK+ EIIGLDPAGPSFKK DC ERICE
Sbjct  140  QYKVPMTNIRLVGHSLGAHISGFAGKRVQELKLGKFSEIIGLDPAGPSFKKNDCSERICE 199
Query  186  TDAHYVQILHTSSNLGTERTLGTVDFYINDGSNQPGCTYIIGETCSHTRAVKYLTECIRR 245
            TDAHYVQILHTSSNLGTERTLGTVDFYIN+GSNQPGC YIIGETCSHTRAVKY+TECIRR
Sbjct  200  TDAHYVQILHTSSNLGTERTLGTVDFYINNGSNQPGCRYIIGETCSHTRAVKYFTECIRR 259
Query  246  ECCLIGVPQSKNPQPVSKCTRNECVCVGLNAKEYPKKGSFYVPVEAKAPFCNNNGKII 303
            ECCLIGVPQSKNPQPVSKCTRNECVCVGLNAK+YPK+GSFYVPVEA+AP+CNNNGKII
Sbjct  260  ECCLIGVPQSKNPQPVSKCTRNECVCVGLNAKKYPKRGSFYVPVEAEAPYCNNNGKII 317

Sequence Alignment: 4. Allergen Name: Vesp c 1.0101 Sequence ID: ACA00159

 Score = 315.4 bits 1355,  Expect = 2e-87
 Identities = 198/297 66%, Positives = 236/297 79%, Gaps = 2/297 0%
Query  6    CKLVPEEISFVLSTRENRDGVYLTLQKLKNGKMFKNSDLSSKKVPFLIHGFISSATNKNY 65
            C    + +  ++ TREN+   + TL  +KN   FK++ ++ K   F+ HGF SSAT +N+
Sbjct  4    CPYSDDTVKMIVLTRENKKYDFYTLDTIKNHNEFKDT-ITLKPHVFITHGFTSSATAENF 62
Query  66   ADMTRALLDKDDIMVISIDWRDGACSNEFALLKFIGYPKAVENTRAVGKYIADFSKILIQ 125
              M +ALLDK + +VI  DWR  AC+NE A LK+  YP A  NTR VG YIA  +K+L+Q
Sbjct  63   VVMAKALLDKGNYLVILTDWRMAACTNEIAGLKLAYYPYAASNTRLVGNYIATVTKMLVQ 122
Query  126  KYKVLLENIRLIGHSLGAQIAGFAGKEFQRFKLGKYPEIIGLDPAGPSFKKKDCPERICE 185
            KY V + NIRLIGHSLGA+I+GFAGK+ Q + LGKYPEIIGLDPAGPSFK  DC +RICE
Sbjct  123  KYNVPMANIRLIGHSLGAHISGFAGKKVQELGLGKYPEIIGLDPAGPSFKSNDCSQRICE 182
Query  186  TDAHYVQILHTSSNLGTERTLGTVDFYINDGSNQPGCTY-IIGETCSHTRAVKYLTECIR 244
            TDA+YVQI+HTS+ LGTERTLGTVDFY+N+G NQPGC   IIGETCSHTRAVKY+TECI+
Sbjct  183  TDANYVQIIHTSNRLGTERTLGTVDFYMNNGYNQPGCGLPIIGETCSHTRAVKYFTECIK 242
Query  245  RECCLIGVPQSKNPQPVSKCTRNECVCVGLNAKEYPKKGSFYVPVEAKAPFCNNNGKII 303
             ECCLIGVP+SKNPQPVSKCTRNECVCVGLNAK YPK GSFYVPVE+KAP+CNN GKII
Sbjct  243  HECCLIGVPKSKNPQPVSKCTRNECVCVGLNAKTYPKTGSFYVPVESKAPYCNNKGKII 301

Sequence Alignment: 5. Allergen Name: Ves v 1 Sequence ID: P49369

 Score = 301.2 bits 1293,  Expect = 3e-83
 Identities = 179/299 59%, Positives = 230/299 76%, Gaps = 1/299 0%
Query  4    PECKLVPEEISFVLSTRENRDGVYLTLQKLKNGKMFKNSDLSSKKVPFLIHGFISSATNK 63
            P+C +  + +S ++ TRENR+    TLQ L+N   FK   ++ + V F+ HGF SSA+  
Sbjct  38   PKCPFNSDTVSIIIETRENRNRDLYTLQTLQNHPEFKKKTIT-RPVVFITHGFTSSASET 96
Query  64   NYADMTRALLDKDDIMVISIDWRDGACSNEFALLKFIGYPKAVENTRAVGKYIADFSKIL 123
            N+ ++ +AL+DKD+ MVISIDW+  AC+NE A LK++ YP A  NTR VG+YIA  ++ L
Sbjct  97   NFINLAKALVDKDNYMVISIDWQTAACTNEAAGLKYLYYPTAARNTRLVGQYIATITQKL 156
Query  124  IQKYKVLLENIRLIGHSLGAQIAGFAGKEFQRFKLGKYPEIIGLDPAGPSFKKKDCPERI 183
            ++ YK+ + NIRLIGHSLGA+ +GFAGK+ Q +KLGKY EIIGLDPA PSF    C ER+
Sbjct  157  VKHYKISMANIRLIGHSLGAHASGFAGKKVQELKLGKYSEIIGLDPARPSFDSNHCSERL 216
Query  184  CETDAHYVQILHTSSNLGTERTLGTVDFYINDGSNQPGCTYIIGETCSHTRAVKYLTECI 243
            CETDA YVQI+HTS+ LGTE+TLGTVDFY+N+G NQPGC     E CSH+RAV Y+ ECI
Sbjct  217  CETDAEYVQIIHTSNYLGTEKTLGTVDFYMNNGKNQPGCGRFFSEVCSHSRAVIYMAECI 276
Query  244  RRECCLIGVPQSKNPQPVSKCTRNECVCVGLNAKEYPKKGSFYVPVEAKAPFCNNNGKII 303
            + ECCLIG+P+SK+ QP+S CT+ ECVCVGLNAK+YP +GSFYVPVE+ APFCNN GKII
Sbjct  277  KHECCLIGIPKSKSSQPISSCTKQECVCVGLNAKKYPSRGSFYVPVESTAPFCNNKGKII 336

Sequence Alignment: 6. Allergen Name: Ves m 1 Sequence ID: P51528

 Score = 301.0 bits 1292,  Expect = 4e-83
 Identities = 178/299 59%, Positives = 229/299 76%, Gaps = 1/299 0%
Query  4    PECKLVPEEISFVLSTRENRDGVYLTLQKLKNGKMFKNSDLSSKKVPFLIHGFISSATNK 63
            P+C +  + +S ++ TRENR+    TLQ L+N   FK   ++ + V F+ HGF SSA+ K
Sbjct  2    PKCPFNSDTVSIIIETRENRNRDLYTLQTLQNHPEFKKKTIT-RPVVFITHGFTSSASEK 60
Query  64   NYADMTRALLDKDDIMVISIDWRDGACSNEFALLKFIGYPKAVENTRAVGKYIADFSKIL 123
            N+ ++ +AL+DKD+ MVISIDW+  AC+NE+  LK+  YP A  NTR VG+YIA  ++ L
Sbjct  61   NFINLAKALVDKDNYMVISIDWQTAACTNEYPGLKYAYYPTAASNTRLVGQYIATITQKL 120
Query  124  IQKYKVLLENIRLIGHSLGAQIAGFAGKEFQRFKLGKYPEIIGLDPAGPSFKKKDCPERI 183
            ++ YK+ + NIRLIGHSLGA+++GFAGK  Q +KLGKY EIIGLDPA PSF    C ER+
Sbjct  121  VKDYKISMANIRLIGHSLGAHVSGFAGKRVQELKLGKYSEIIGLDPARPSFDSNHCSERL 180
Query  184  CETDAHYVQILHTSSNLGTERTLGTVDFYINDGSNQPGCTYIIGETCSHTRAVKYLTECI 243
            CETDA YVQI+HTS+ LGTE+ LGTVDFY+N+G N PGC     E CSHTRAV Y+ ECI
Sbjct  181  CETDAEYVQIIHTSNYLGTEKILGTVDFYMNNGKNNPGCGRFFSEVCSHTRAVIYMAECI 240
Query  244  RRECCLIGVPQSKNPQPVSKCTRNECVCVGLNAKEYPKKGSFYVPVEAKAPFCNNNGKII 303
            + ECCLIG+P+SK+ QP+S+CT+ ECVCVGLNAK+YP +GSFYVPVE+ APFCNN GKII
Sbjct  241  KHECCLIGIPRSKSSQPISRCTKQECVCVGLNAKKYPSRGSFYVPVESTAPFCNNKGKII 300

Sequence Alignment: 7. Allergen Name: Poly p 1.0101 Sequence ID: ABN13879

 Score = 296.2 bits 1271,  Expect = 1e-81
 Identities = 178/298 59%, Positives = 232/298 77%, Gaps = 6/298 2%
Query  1    GILPECKLVPEEISFVLSTRENRDGVYLTLQKLKNGKMFKNSDLSSKKVPFLIHGFISSA 60
            G++PEC +   +I F + TR+ RDG+ LT + L+N  +FK S +S ++V F+ HGF+S+ 
Sbjct  18   GLIPECPFNEYDILFFVYTRQQRDGIVLTEETLQNYDLFKKSTIS-RQVVFIDHGFLSNG 76
Query  61   TNKNYADMTRALLDKDDIMVISIDWRDGACSNEFA-LLKFIGYPKAVENTRAVGKYIADF 119
             N+N+  M +AL++KD+ +VIS+DW+ GAC N FA  L ++GY  AV NTR VGKY+ADF
Sbjct  77   NNENFIAMAKALIEKDNFLVISVDWKKGAC-NAFASTLDYLGYSTAVGNTRHVGKYVADF 135
Query  120  SKILIQKYKVLLENIRLIGHSLGAQIAGFAGKEFQRFKLGKYPEIIGLDPAGPSFKKKDC 179
            +K+L+++YKV + NIRLIGHSLGA+ +GFAGKE Q +KL KY  I GLDPAGPSF   DC
Sbjct  136  TKLLVEQYKVSMSNIRLIGHSLGAHTSGFAGKEVQELKLNKYSNIDGLDPAGPSFDSNDC 195
Query  180  PERICETDAHYVQILHTSSNLGTERTLGTVDFYINDGSNQPGCTYIIGETCSHTRAVKYL 239
            PER+CETDA YVQI+HTS+ LG    +GTVDFY+N GS+QPGC      +CSHT+AVKYL
Sbjct  196  PERLCETDAEYVQIIHTSNILGVYSKIGTVDFYMNYGSHQPGCGRFFSPSCSHTKAVKYL 255
Query  240  TECIRRECCLIGVPQSK---NPQPVSKCTRNECVCVGLNAKEYPKKGSFYVPVEAKAPFC 296
            TECI+ ECCLIG P  K    P+P+S+CT++ CVCVGLNAK YP +GSFYVPVEA AP+C
Sbjct  256  TECIKHECCLIGTPWKKYFSTPKPISQCTKDTCVCVGLNAKSYPARGSFYVPVEATAPYC 315
Query  297  NNNG 300
            +N G
Sbjct  316  HNEG 319

Sequence Alignment: 8. Allergen Name: Pol a 1 Sequence ID: Q9U6W0

 Score = 289.4 bits 1241,  Expect = 1e-79
 Identities = 174/292 59%, Positives = 228/292 78%, Gaps = 9/292 3%
Query  4    PECKLVPEEISFVLSTRENRDGVYLTLQKLKNGKMFKNSDLSSKKVPFLIHGFISSATNK 63
            P+C +  ++I F + +R+ RDG+ L  + L N  +F  S +S K+V FLIHGF+S+  N+
Sbjct  3    PDCTFNEKDIVFYVYSRDKRDGIILKKETLTNYDLFTKSTIS-KQVVFLIHGFLSTGNNE 61
Query  64   NYADMTRALLDKDDIMVISIDWRDGACSNEFALLK-FIGYPKAVENTRAVGKYIADFSKI 122
            N+  M++AL++KDD +VIS+DW+ GAC N FA  K  +GY KAV NTR VGK++ADF+K+
Sbjct  62   NFVAMSKALIEKDDFLVISVDWKKGAC-NAFASTKDALGYSKAVGNTRHVGKFVADFTKL 120
Query  123  LIQKYKVLLENIRLIGHSLGAQIAGFAGKEFQRFKLGKYPEIIGLDPAGPSFKKKDCPER 182
            L++KYKVL+ NIRLIGHSLGA+ +GFAGKE Q++KLGKY EIIGLDPAGP F + DCP+R
Sbjct  121  LVEKYKVLISNIRLIGHSLGAHTSGFAGKEVQKLKLGKYKEIIGLDPAGPYFHRSDCPDR 180
Query  183  ICETDAHYVQILHTSSNLGTERTLGTVDFYINDGSNQPGCTYIIGETCSHTRAVKYLTEC 242
            +C TDA YVQ++HTS  LG    +G+VDFY+N G NQPGC      +CSHT+AVKYLTEC
Sbjct  181  LCVTDAEYVQVIHTSIILGVYYNVGSVDFYVNYGKNQPGCNE---PSCSHTKAVKYLTEC 237
Query  243  IRRECCLIGVPQSK---NPQPVSKCTRNECVCVGLNAKEYPKKGSFYVPVEAKAPFCNNN 299
            I+ ECCLIG P  K    P+P+S+C  + CVCVGLNAK YP +G+FY PVEA AP+C+N 
Sbjct  238  IKHECCLIGTPWKKYFSTPKPISQCRGDTCVCVGLNAKSYPARGAFYAPVEANAPYCHNE 297
Query  300  G 300
            G
Sbjct  298  G 298

Sequence Alignment: 9. Allergen Name: Pol d 1.0102 Sequence ID: AAS67042

 Score = 281.9 bits 1208,  Expect = 2e-77
 Identities = 170/295 57%, Positives = 227/295 76%, Gaps = 9/295 3%
Query  1    GILPECKLVPEEISFVLSTRENRDGVYLTLQKLKNGKMFKNSDLSSKKVPFLIHGFISSA 60
            GI P+C +  ++I + + +R+ R+G+ L  + LKN  +F+ S +S  ++  LIHGF+S+ 
Sbjct  15   GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQIS-HQIAILIHGFLSTG 73
Query  61   TNKNYADMTRALLDKDDIMVISIDWRDGACSNEFALLK-FIGYPKAVENTRAVGKYIADF 119
             N+N+  M +AL++ D+ +VIS+DW+ GAC N FA     +GY +AV NTR VGKY+ADF
Sbjct  74   NNENFDAMAKALIEIDNFLVISVDWKKGAC-NAFASTNDVLGYSQAVGNTRHVGKYVADF 132
Query  120  SKILIQKYKVLLENIRLIGHSLGAQIAGFAGKEFQRFKLGKYPEIIGLDPAGPSFKKKDC 179
            +K+L+++YKV + NIRLIGHSLGA+ +GFAGKE QR+KLGKY EIIGLDPAGPSF    C
Sbjct  133  TKLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGLDPAGPSFLTNKC 192
Query  180  PERICETDAHYVQILHTSSNLGTERTLGTVDFYINDGSNQPGCTYIIGETCSHTRAVKYL 239
            P R+CETDA YVQ +HTS+ LG    +G+VDFY+N G +QPGC+     +CSHT+AVKYL
Sbjct  193  PNRLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSE---PSCSHTKAVKYL 249
Query  240  TECIRRECCLIGVPQSK---NPQPVSKCTRNECVCVGLNAKEYPKKGSFYVPVEAKAPFC 296
            TECI+RECCLIG P       P+P+S+C R+ CVCVGLNA+ YP KGSFYVPVE  AP+C
Sbjct  250  TECIKRECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYVPVEKDAPYC 309
Query  297  NNNG 300
            +N G
Sbjct  310  HNEG 313

Sequence Alignment: 10. Allergen Name: Pol d 1.0103 Sequence ID: AAS67043

 Score = 281.4 bits 1206,  Expect = 3e-77
 Identities = 169/295 57%, Positives = 228/295 77%, Gaps = 9/295 3%
Query  1    GILPECKLVPEEISFVLSTRENRDGVYLTLQKLKNGKMFKNSDLSSKKVPFLIHGFISSA 60
            GI P+C +  ++I + + +R+ R+G+ L  + LKN  +F+ S +S  ++  LIHGF+S+ 
Sbjct  15   GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQIS-HQIAILIHGFLSTG 73
Query  61   TNKNYADMTRALLDKDDIMVISIDWRDGACSNEFALLK-FIGYPKAVENTRAVGKYIADF 119
             N+N+  M +AL++ D+ +VIS+DW+ GAC N FA     +GY +AV NTR VGKY+ADF
Sbjct  74   NNENFDAMAKALIEIDNFLVISVDWKKGAC-NAFASTNDVLGYSQAVGNTRHVGKYVADF 132
Query  120  SKILIQKYKVLLENIRLIGHSLGAQIAGFAGKEFQRFKLGKYPEIIGLDPAGPSFKKKDC 179
            +K+L+++YKV + NIRLIGHSLGA+ +GFAGKE QR+KLGKY EIIGLDPAGPSF    C
Sbjct  133  TKLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGLDPAGPSFLTSKC 192
Query  180  PERICETDAHYVQILHTSSNLGTERTLGTVDFYINDGSNQPGCTYIIGETCSHTRAVKYL 239
            P+R+CETDA YVQ +HTS+ LG    +G+VDFY+N G +QPGC+     +CSHT+AVKYL
Sbjct  193  PDRLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSE---PSCSHTKAVKYL 249
Query  240  TECIRRECCLIGVPQSK---NPQPVSKCTRNECVCVGLNAKEYPKKGSFYVPVEAKAPFC 296
            TECI+RECCLIG P       P+P+S+C R+ CVCVGLNA+ YP KGSFYVPV+  AP+C
Sbjct  250  TECIKRECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYVPVDKDAPYC 309
Query  297  NNNG 300
            +N G
Sbjct  310  HNEG 313

Sequence Alignment: 11. Allergen Name: Pol d 1.0101 Sequence ID: AAS67041

 Score = 280.9 bits 1204,  Expect = 4e-77
 Identities = 169/295 57%, Positives = 227/295 76%, Gaps = 9/295 3%
Query  1    GILPECKLVPEEISFVLSTRENRDGVYLTLQKLKNGKMFKNSDLSSKKVPFLIHGFISSA 60
            GI P+C +  ++I + + +R+ R+G+ L  + LKN  +F+ S +S  ++  LIHGF+S+ 
Sbjct  36   GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQIS-HQIAILIHGFLSTG 94
Query  61   TNKNYADMTRALLDKDDIMVISIDWRDGACSNEFALLK-FIGYPKAVENTRAVGKYIADF 119
             N+N+  M +AL++ D+ +VIS+DW+ GAC N FA     +GY +AV NTR VGKY+ADF
Sbjct  95   NNENFDAMAKALIEIDNFLVISVDWKKGAC-NAFASTNDVLGYSQAVGNTRHVGKYVADF 153
Query  120  SKILIQKYKVLLENIRLIGHSLGAQIAGFAGKEFQRFKLGKYPEIIGLDPAGPSFKKKDC 179
            +K+L+++YKV + NIRLIGHSLGA+ +GFAGKE QR+KLGKY EIIGLDPAGPSF    C
Sbjct  154  TKLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGLDPAGPSFLTNKC 213
Query  180  PERICETDAHYVQILHTSSNLGTERTLGTVDFYINDGSNQPGCTYIIGETCSHTRAVKYL 239
            P R+CETDA YVQ +HTS+ LG    +G+VDFY+N G +QPGC+     +CSHT+AVKYL
Sbjct  214  PNRLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSE---PSCSHTKAVKYL 270
Query  240  TECIRRECCLIGVPQSK---NPQPVSKCTRNECVCVGLNAKEYPKKGSFYVPVEAKAPFC 296
            TECI+RECCLIG P       P+P+S+C R+ CVCVGLNA+ YP KGSFYVPV+  AP+C
Sbjct  271  TECIKRECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYVPVDKDAPYC 330
Query  297  NNNG 300
            +N G
Sbjct  331  HNEG 334

Sequence Alignment: 12. Allergen Name: Pol d 1.0104 Sequence ID: AAS67044

 Score = 279.8 bits 1199,  Expect = 9e-77
 Identities = 169/295 57%, Positives = 227/295 76%, Gaps = 9/295 3%
Query  1    GILPECKLVPEEISFVLSTRENRDGVYLTLQKLKNGKMFKNSDLSSKKVPFLIHGFISSA 60
            GI P+C +  ++I + + +R+ R+G+ L  + LKN  +F+ S +S  ++  LIHGF+S+ 
Sbjct  15   GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQIS-HQIAILIHGFLSTG 73
Query  61   TNKNYADMTRALLDKDDIMVISIDWRDGACSNEFALLK-FIGYPKAVENTRAVGKYIADF 119
             N+N+  M +AL++ D+ +VIS+DW+ GAC N FA     +GY +AV NTR VGKY+ADF
Sbjct  74   NNENFDAMAKALIEIDNFLVISVDWKKGAC-NAFASTNDVLGYSQAVGNTRHVGKYVADF 132
Query  120  SKILIQKYKVLLENIRLIGHSLGAQIAGFAGKEFQRFKLGKYPEIIGLDPAGPSFKKKDC 179
            +K+L+++YKV + NIRLIGHSLGA+ +GFAGKE QR+KLGKY EIIGLDPAGPSF    C
Sbjct  133  TKLLVEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGLDPAGPSFLTSKC 192
Query  180  PERICETDAHYVQILHTSSNLGTERTLGTVDFYINDGSNQPGCTYIIGETCSHTRAVKYL 239
            P+R+CETDA YVQ +HTS+ LG    +G+VDFY+N G +QPGC+     +CSHT+AVKYL
Sbjct  193  PDRLCETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSE---PSCSHTKAVKYL 249
Query  240  TECIRRECCLIGVPQSK---NPQPVSKCTRNECVCVGLNAKEYPKKGSFYVPVEAKAPFC 296
            TECI+RECCLIG P       P+ +S+C R+ CVCVGLNA+ YP KGSFYVPVE  AP+C
Sbjct  250  TECIKRECCLIGTPWKSYFSTPKSISQCKRDTCVCVGLNAQSYPAKGSFYVPVEKDAPYC 309
Query  297  NNNG 300
            +N G
Sbjct  310  HNEG 313

Sequence Alignment: 13. Allergen Name: Ves s 1.0101 Sequence ID: 3989146

 Score = 272.8 bits 1168,  Expect = 1e-74
 Identities = 166/295 56%, Positives = 219/295 74%, Gaps = 5/295 1%
Query  5    ECKLVPEEISFVLSTRENRDGVYLTLQKLKNGKMFKNSDLSSKKVPFLIHGFISSATNKN 64
            +C +  + ++ V+ TRENR+  + TLQ L+N   FK   ++ + V F+ HGF SSAT ++
Sbjct  3    KCPFSDDTVAMVIVTRENRNRDFYTLQTLRNHDEFKKKAIT-RPVVFITHGFTSSATVES 61
Query  65   YADMTRALLDKDDIMVISIDWRDGACSNEFALLKFIGYPKAVENTRAVGKYIADFSKILI 124
            + D+  A+L+     V   DWR  AC+    LL ++    AV NTR VG+YIA  +K L+
Sbjct  62   FVDLQTAILEXXXXKVTVSDWRVAACNRTTGLLYYV---TAVSNTRLVGRYIATVTKKLV 118
Query  125  QKYKVLLENIRLIGHSLGAQIAGFAGKEFQRFKLGKYPEIIGLDPAGPSFKKKDCPERIC 184
              Y V + +IRLIGHSLGA+++GFAGKE Q++KL KY EIIGLDPAGPSF+  DC ER+C
Sbjct  119  TDYNVSMADIRLIGHSLGAHVSGFAGKEVQKLKLEKYSEIIGLDPAGPSFESNDCAERLC 178
Query  185  ETDAHYVQILHTSSNLGTERTLGTVDFYINDGSNQPGCTYI-IGETCSHTRAVKYLTECI 243
            +TDAHYVQI+HTS  +G E+++G VDFY+N G+NQPGC  I + + CSH+RA+ Y+TECI
Sbjct  179  KTDAHYVQIIHTSKKFGIEKSIGHVDFYVNQGNNQPGCGIIPLKDVCSHSRAITYMTECI 238
Query  244  RRECCLIGVPQSKNPQPVSKCTRNECVCVGLNAKEYPKKGSFYVPVEAKAPFCNNNGKII 303
            +RECCLIG+PQSK+ + +S CTR ECVCVGL AK YP  GSFYVPVE+ APFCNN GKII
Sbjct  239  KRECCLIGIPQSKSSKSISSCTRQECVCVGLKAKSYPNTGSFYVPVESTAPFCNNKGKII 298

Sequence Alignment: 14. Allergen Name: Pol e 1.0101 Sequence ID: 3989146

 Score = 240.6 bits 1027,  Expect = 5e-65
 Identities = 147/296 49%, Positives = 196/296 66%, Gaps = 7/296 2%
Query  1    GILPECKLVPEEISFVLSTRENRDGVYLTLQKLKNGKMFKNSDLSSKKVPFLIHGFISSA 60
            G+ P+C +  ++I F + +R+ RDG+ L    L N  +F  S   SK+V FLIHGF++S 
Sbjct  1    GMSPDCTFNEKDIVFYVYSRDKRDGIILKKDSLTNYDLFTKSITVSKQVVFLIHGFLTSX 60
Query  61   TNKNYADMTRALLDKDDIMVISIDWRDGACSNEFALLKFIGYPKAVENTRAVGKYIADFS 120
                   ++ AL++ DD +V+S+DW+             +GY K      A+G Y+ADF+
Sbjct  61   XXXXXXSLSGALIEGDDFLVMSVDWKKXXXXXXXXXXGALGYSKXASIKDALGTYVADFT 120
Query  121  KILIQKYKVLLENIRLIGHSLGAQIAGFAGKEFQRFKLGKYPEIIGLDPAGPSFKKKDCP 180
            K+ + KYKVL    R IGHSLGA+ +GFAGKE Q++KLGKY EIIGLDPAGPSF    CP
Sbjct  121  KLKLGKYKVLRXXXRGIGHSLGAHTSGFAGKEVQKLKLGKYKEIIGLDPAGPSFLTSKCP 180
Query  181  ERICETDAHYVQILHTSSNLGTERTLGTVDFYINDGSNQPGCTYIIGETCSHTRAVKYLT 240
            +R+CE+   Y QILHTS   G    +G+VDFY+N G +QPGC      +C   +A KYLT
Sbjct  181  DRLCESGTDYTQILHTSXXXGVYYNVGSVDFYVNYGKSQPGCNE---PSCXXXKATKYLT 237
Query  241  ECIRRECCLIGVPQSK---NPQPVSKCTRNECVCVGLNAKEYPKKGSFYVPVEAKAPFCN 297
            ECI+ ECCLI  P  K    P+P+S+C R+ CVCVGLNAK YP +G+FY PVEA AP+C+
Sbjct  238  ECIKEECCLISTPWFKYFSTPKPISQC-RDTCVCVGLNAKSYPARGAFYAPVEANAPYCH 296
Query  298  NNG 300
            N G
Sbjct  297  NEG 299

Sequence Alignment: 15. Allergen Name: Sol i 1.0101 Sequence ID: AAT95008

 Score = 114.1 bits 472,  Expect = 8e-27
 Identities = 88/269 32%, Positives = 143/269 53%, Gaps = 11/269 4%
Query  26   VYLTLQKLKNGKMFKNS----DLS-SKKVPFLIHGFISSATNKNYADMTRALLDKDDIMV 80
            VYL   +++ GK + N     D++ S  V F+ HGF SSA    + D+  A++ K     
Sbjct  50   VYLYNSRFQ-GKNLGNQQSCQDINASLPVVFITHGFTSSAQVSTFKDLANAFVQKGHTAF 108
Query  81   ISIDWRDGACSNEFALLKFIGYPKAVENTRAVGKYIADFSKILIQKYKVLLENIRLIGHS 140
            I +DW + AC++ +  ++F  Y  A  NT  +G+ +A ++  L+ K K+ L NI+ +GHS
Sbjct  109  I-VDWSEAACTDGLPGVQFAEYNAAASNTYDIGQLMAKYTVDLMNKCKIPLNNIQYVGHS 167
Query  141  LGAQIAGFAGKEFQRFKLGKYPEIIGLDPAGPSFKKKDCPERICETDAHYVQILHTSSNL 200
            LG+++ GFA K  +++     P I+ LDPA PSF    C ERIC++DA  + ++ TS  L
Sbjct  168  LGSHVCGFAAKHVKKLINKTMPYILALDPADPSFGSNKCGERICKSDAKRIVVFKTSI-L 226
Query  201  GT-ERTLGTVDFYINDGSNQPGCTYIIGETCSHTRAVKYLTECIRRECCLIGVPQSKNPQ 259
            G  E  +G +    + G +QP C++     CSH+ ++ Y T  +   C  + VP +   Q
Sbjct  227  GIGENIIGHLLIVFDGGKSQPACSWY-DVPCSHSESIVYATGMVSGRCQHLAVPWTAQ-Q 284
Query  260  PVSKCTRNECVCVGLNAKEYPKKGSFYVPVEAKAPFCNNN 299
             ++            N   YP   +    V     F N+N
Sbjct  285  RINPIQWKFWRVFTSNIPAYPTSDTTNCVVLNTNVFKNDN 324

Sequence Alignment: 16. Allergen Name: Pol g 1.0101 Sequence ID: P83542

 Score = 34.9 bits 103,  Expect = 0.0007
 Identities = 15/42 35%, Positives = 27/42 64%, Gaps = 0/42 0%
Query  1    GILPECKLVPEEISFVLSTRENRDGVYLTLQKLKNGKMFKNS 42
            GI P+C +  ++I + + +R+ R+G+ L  + LKN  +FK S
Sbjct  1    GITPDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFKES 42

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.