The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

GKKEEKKEEKKESGDAASGADGTYDITKLGAKPDGKTDCTKEVEEAWASACGGTGKNTIV
IPKGDFLTGPLNFTGPCKGDSVTIKLDGNLLSSNDLAKYKANWIEIMRIKKLTITGKGTL
DGQGKAVWGKNSCAKNYNCKILPNTLVLDFCDDALIEGITLLNAKFFHMNIYECKGVTVK
DVTITAPGDSPNTDGIHIGDSSKVTITDTTIGTGDDCISIGPGSTGLNITGVTCGPGHGI
SVGSLGRYKDEKDVTDITVKNCVLKKSTNGLRIKSYEDAKSPLTASKLTYENVKMEDVGY
PIIIDQKYCPNKICTSKGDSARVTVKDVTFRNITGTSSTPEAVSLLCSDKQPCNGVTMND
VKIEYSGTNNKTMAVCTNAKVTAKGVSEANTCAA
Sequence Info Allergen Name Length Opt Bits Score E Value
CAB42886 Phl p 13 394 2614 653.0 6.6e-189
A0A077B569 Sor h 13.0201 410 2000 501.2 3.5e-143
A0A077B155 Sor h 13.0101 422 1952 489.3 1.4e-139
Q6H9K0 Pla a 2 377 1163 294.3 6.2e-81
ABY21306 Pla or 2.0101 378 1156 292.6 2.1e-80
ARS33724 Sal k 6.0101 401 1043 264.6 5.8e-72
AHL24657 Sal k 6.0101 379 1042 264.4 6.3e-72
W8PPL3 Ole e 14.0101 379 1003 254.7 5.1e-69
C9EA45 Cari p 1.0101 494 893 227.3 1.2e-60
BAA06172 Cry j 2 514 867 220.9 1.1e-58
P43212 Cry j 2 514 865 220.4 1.5e-58
CAC05582 Jun a 2 507 845 215.5 4.5e-57
Q7M1E7 Cha o 2.0101 514 826 210.8 1.2e-55
C0HKB1 Cup s 2.0101 164 127 38.7 0.00023
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Phl p 13 Sequence ID: CAB42886

 Score = 653.0 bits 2614,  Expect = 7e-189
 Identities = 394/394 100%, Positives = 394/394 100%, Gaps = 0/394 0%
Query  1    GKKEEKKEEKKESGDAASGADGTYDITKLGAKPDGKTDCTKEVEEAWASACGGTGKNTIV 60
            GKKEEKKEEKKESGDAASGADGTYDITKLGAKPDGKTDCTKEVEEAWASACGGTGKNTIV
Sbjct  1    GKKEEKKEEKKESGDAASGADGTYDITKLGAKPDGKTDCTKEVEEAWASACGGTGKNTIV 60
Query  61   IPKGDFLTGPLNFTGPCKGDSVTIKLDGNLLSSNDLAKYKANWIEIMRIKKLTITGKGTL 120
            IPKGDFLTGPLNFTGPCKGDSVTIKLDGNLLSSNDLAKYKANWIEIMRIKKLTITGKGTL
Sbjct  61   IPKGDFLTGPLNFTGPCKGDSVTIKLDGNLLSSNDLAKYKANWIEIMRIKKLTITGKGTL 120
Query  121  DGQGKAVWGKNSCAKNYNCKILPNTLVLDFCDDALIEGITLLNAKFFHMNIYECKGVTVK 180
            DGQGKAVWGKNSCAKNYNCKILPNTLVLDFCDDALIEGITLLNAKFFHMNIYECKGVTVK
Sbjct  121  DGQGKAVWGKNSCAKNYNCKILPNTLVLDFCDDALIEGITLLNAKFFHMNIYECKGVTVK 180
Query  181  DVTITAPGDSPNTDGIHIGDSSKVTITDTTIGTGDDCISIGPGSTGLNITGVTCGPGHGI 240
            DVTITAPGDSPNTDGIHIGDSSKVTITDTTIGTGDDCISIGPGSTGLNITGVTCGPGHGI
Sbjct  181  DVTITAPGDSPNTDGIHIGDSSKVTITDTTIGTGDDCISIGPGSTGLNITGVTCGPGHGI 240
Query  241  SVGSLGRYKDEKDVTDITVKNCVLKKSTNGLRIKSYEDAKSPLTASKLTYENVKMEDVGY 300
            SVGSLGRYKDEKDVTDITVKNCVLKKSTNGLRIKSYEDAKSPLTASKLTYENVKMEDVGY
Sbjct  241  SVGSLGRYKDEKDVTDITVKNCVLKKSTNGLRIKSYEDAKSPLTASKLTYENVKMEDVGY 300
Query  301  PIIIDQKYCPNKICTSKGDSARVTVKDVTFRNITGTSSTPEAVSLLCSDKQPCNGVTMND 360
            PIIIDQKYCPNKICTSKGDSARVTVKDVTFRNITGTSSTPEAVSLLCSDKQPCNGVTMND
Sbjct  301  PIIIDQKYCPNKICTSKGDSARVTVKDVTFRNITGTSSTPEAVSLLCSDKQPCNGVTMND 360
Query  361  VKIEYSGTNNKTMAVCTNAKVTAKGVSEANTCAA 394
            VKIEYSGTNNKTMAVCTNAKVTAKGVSEANTCAA
Sbjct  361  VKIEYSGTNNKTMAVCTNAKVTAKGVSEANTCAA 394

Sequence Alignment: 2. Allergen Name: Sor h 13.0201 Sequence ID: A0A077B569

 Score = 501.2 bits 2000,  Expect = 4e-143
 Identities = 289/384 75%, Positives = 335/384 87%, Gaps = 4/384 1%
Query  7    KEEKKESGDA--ASGADGTYDITKLGAKPDGKTDCTKEVEEAWASACGGTGKNTIVIPKG 64
            K+   + GDA  ASG  G++DI+KLGA  DGK D TK V+EAW SACGGTGK TI+IPKG
Sbjct  24   KDAPAKDGDAKAASGPGGSFDISKLGASGDGKKDSTKAVQEAWTSACGGTGKQTILIPKG 83
Query  65   DFLTGPLNFTGPCKGDSVTIKLDGNLLSSNDLAKYKANWIEIMRIKKLTITGKGTLDGQG 124
            D+L GPLNFTGPCKGD VTI++DGNLL++ DL++YK NWIEI+R+  L ITGKG LDGQG
Sbjct  84   DYLVGPLNFTGPCKGD-VTIQVDGNLLATTDLSQYKGNWIEILRVDNLVITGKGKLDGQG 142
Query  125  KAVWGKNSCAKNYNCKILPNTLVLDFCDDALIEGITLLNAKFFHMNIYECKGVTVKDVTI 184
             AVW KNSCAK Y+CKILPN+LVLD+ ++  + GITLLNAKFFHMN+++CKGVT+KDVT+
Sbjct  143  PAVWSKNSCAKKYDCKILPNSLVLDYVNNGEVSGITLLNAKFFHMNVFQCKGVTIKDVTV 202
Query  185  TAPGDSPNTDGIHIGDSSKVTITDTTIGTGDDCISIGPGSTGLNITGVTCGPGHGISVGS 244
            TAPGDSPNTDGIHIGDSSKVTIT TTIG GDDCISIGPGSTG+N+TGVTCGPGHGISVGS
Sbjct  203  TAPGDSPNTDGIHIGDSSKVTITGTTIGVGDDCISIGPGSTGINVTGVTCGPGHGISVGS 262
Query  245  LGRYKDEKDVTDITVKNCVLKKSTNGLRIKSYEDAKSPLTASKLTYENVKMEDVGYPIII 304
            LGRYKDEKDVTDI VK+C LKK++NG+RIKSYEDA   +TASKL YEN+ M+DV  PIII
Sbjct  263  LGRYKDEKDVTDINVKDCTLKKTSNGVRIKSYEDAACVITASKLHYENIAMDDVANPIII 322
Query  305  DQKYCPNKICTSKGDSARVTVKDVTFRNITGTSSTPEAVSLLCSDKQPCNGVTMNDVKIE 364
            D KYCPNKICT+KGDS +VTVKDVTF+NITGTSSTPEAVSLLCSDK PC+GVTM+++K+E
Sbjct  323  DMKYCPNKICTAKGDS-KVTVKDVTFKNITGTSSTPEAVSLLCSDKIPCSGVTMDNIKVE 381
Query  365  YSGTNNKTMAVCTNAKVTAKGVSEANTC 392
            Y GTNNKTMAVC NAK +A G  +   C
Sbjct  382  YKGTNNKTMAVCQNAKGSATGCLKELAC 409

Sequence Alignment: 3. Allergen Name: Sor h 13.0101 Sequence ID: A0A077B155

 Score = 489.3 bits 1952,  Expect = 1e-139
 Identities = 284/389 73%, Positives = 333/389 85%, Gaps = 5/389 1%
Query  2    KKEEKKEEKKESG---DAASGADGTYDITKLGAKPDGKTDCTKEVEEAWASACGGTGKNT 58
            K++EK ++ K  G   +A SG+ G  DI+KLGAK DGKTD TK + EAWA+ACG  G  T
Sbjct  30   KEKEKGKDDKSGGAPAEAPSGSAGGSDISKLGAKGDGKTDSTKALNEAWAAACGKEGPQT 89
Query  59   IVIPKGDFLTGPLNFTGPCKGDSVTIKLDGNLLSSNDLAKYKANWIEIMRIKKLTITGKG 118
            ++IPKGD+LTGPLNF+GPCKG SVTI+LDGNLL + DL+ YK NWIEI  +  L I+GKG
Sbjct  90   LMIPKGDYLTGPLNFSGPCKG-SVTIQLDGNLLGTTDLSAYKTNWIEIEHVDNLVISGKG 148
Query  119  TLDGQGKAVWGKNSCAKNYNCKILPNTLVLDFCDDALIEGITLLNAKFFHMNIYECKGVT 178
            TLDGQGK VW  N CA+ Y+CKILPN+LVLD+ ++  + GITLLNAKFFHMN+++CKGVT
Sbjct  149  TLDGQGKQVWDNNKCAQKYDCKILPNSLVLDYVNNGEVSGITLLNAKFFHMNVFQCKGVT 208
Query  179  VKDVTITAPGDSPNTDGIHIGDSSKVTITDTTIGTGDDCISIGPGSTGLNITGVTCGPGH 238
            +KDVT+TAPGDSPNTDGIHIGDSSKVTIT TTIG GDDCISIGPGSTG+N+TGVTCGPGH
Sbjct  209  IKDVTVTAPGDSPNTDGIHIGDSSKVTITGTTIGVGDDCISIGPGSTGINVTGVTCGPGH 268
Query  239  GISVGSLGRYKDEKDVTDITVKNCVLKKSTNGLRIKSYEDAKSPLTASKLTYENVKMEDV 298
            GISVGSLGRYKDEKDVTDI VK+C LKK++NG+RIKSYEDA   +TASKL YEN+ M+DV
Sbjct  269  GISVGSLGRYKDEKDVTDINVKDCTLKKTSNGVRIKSYEDAACVITASKLHYENIAMDDV 328
Query  299  GYPIIIDQKYCPNKICTSKGDSARVTVKDVTFRNITGTSSTPEAVSLLCSDKQPCNGVTM 358
              PIIID KYCPNKICT+KGDS +VTVKDVTF+NITGTSSTPEAVSLLCSDK PC+GVTM
Sbjct  329  ANPIIIDMKYCPNKICTAKGDS-KVTVKDVTFKNITGTSSTPEAVSLLCSDKIPCSGVTM 387
Query  359  NDVKIEYSGTNNKTMAVCTNAKVTAKGVSEANTC 392
            +++K+EY GTNNKTMAVC NAK +A G  +   C
Sbjct  388  DNIKVEYKGTNNKTMAVCQNAKGSATGCLKELAC 421

Sequence Alignment: 4. Allergen Name: Pla a 2 Sequence ID: Q6H9K0

 Score = 294.3 bits 1163,  Expect = 6e-81
 Identities = 167/374 44%, Positives = 245/374 65%, Gaps = 8/374 2%
Query  14   GDAASGADGTYDITKLGAKPDGKTDCTKEVEEAWASACGGTGKNTIVIPKGDFLTGPLNF 73
            G  +SG+   +++   GAK  G  D ++ V +AW +AC   G +T++IPKG++  G +  
Sbjct  2    GVQSSGS--VFNVNDYGAK--GAGDISQAVMKAWKAACASQGPSTVLIPKGNYNMGEVAM 57
Query  74   TGPCKGDSVTIKLDGNLLSSNDLAKYKAN-WIEIMRIKKLTITGKGTLDGQGKAVWGKNS 132
             GPCKG  +  ++DG + +  D +K+K++ W+   RI  LT++G GTLDGQG+  W KN+
Sbjct  58   QGPCKGSKIGFQIDGVVKAPADPSKFKSDGWVSFYRIDGLTVSGTGTLDGQGQTAWAKNN 117
Query  133  CAKNYNCKILPNTLVLDFCDDALIEGITLLNAKFFHMNIYECKGVTVKDVTITAPGDSPN 192
            C KN NCK     L +DF   A++  IT LN+K FH+N+ EC+ +T + VT+TAPG S N
Sbjct  118  CDKNPNCKHAAMNLRFDFLKHAMVRDITSLNSKMFHINVLECEDITFQHVTVTAPGTSIN 177
Query  193  TDGIHIGDSSKVTITDTTIGTGDDCISIGPGSTGLNITGVTCGPGHGISVGSLGRYKDEK 252
            TDGIH+G S  VTIT+T I TGDDCISIGPGS  + IT V CGPGHGIS+GSLGRY +EK
Sbjct  178  TDGIHVGISKGVTITNTKIATGDDCISIGPGSQNVTITQVNCGPGHGISIGSLGRYNNEK 237
Query  253  DVTDITVKNCVLKKSTNGLRIKSYEDAKSPLTASKLTYENVKMEDVGYPIIIDQKYCPNK 312
            +V  ITVK C +  + NG+R+K++ ++  P  A+ LT++++ M +V  P+I+DQ+YCP  
Sbjct  238  EVRGITVKGCTFSGTMNGVRVKTWPNSP-PGAATDLTFQDLTMNNVQNPVILDQEYCPYG 296
Query  313  ICTSKGDSARVTVKDVTFRNITGTSSTPEAVSLLCSDKQPCNGVTMNDVKIEYSGTNNKT 372
             C+ +  S R+ + ++ F NI GTS+   AV + CS   PC+ + + ++ + Y G     
Sbjct  297  QCSRQAPS-RIKLSNINFNNIRGTSTGKVAVVIACSHGMPCSNMKIGEINLSYRGAGGPA 355
Query  373  MAVCTNAKVTAKGVS-EANTCA 393
             + C+N K T  G    A  CA
Sbjct  356  TSTCSNVKPTFSGKQVPAIKCA 377

Sequence Alignment: 5. Allergen Name: Pla or 2.0101 Sequence ID: ABY21306

 Score = 292.6 bits 1156,  Expect = 2e-80
 Identities = 164/374 43%, Positives = 246/374 65%, Gaps = 8/374 2%
Query  14   GDAASGADGTYDITKLGAKPDGKTDCTKEVEEAWASACGGTGKNTIVIPKGDFLTGPLNF 73
            G  +SG  GT+++   GAK  G  D ++ V +AW +AC   G +T++IP G+++ G + +
Sbjct  3    GVQSSG--GTFNVNDYGAK--GSGDISQAVMKAWEAACASPGPSTVLIPTGNYIMGEVLL 58
Query  74   TGPCKGDSVTIKLDGNLLSSNDLAKYKAN-WIEIMRIKKLTITGKGTLDGQGKAVWGKNS 132
             GPCKG  +  +LDG + +  D++ +K+  W+    +  LT++GKGT+DGQG+  W  N+
Sbjct  59   EGPCKGSKIGFQLDGVVKAPADVSAFKSEGWVVFNHVDGLTVSGKGTFDGQGQKAWAANN 118
Query  133  CAKNYNCKILPNTLVLDFCDDALIEGITLLNAKFFHMNIYECKGVTVKDVTITAPGDSPN 192
            C K+ NC   P  + ++F  +A++  IT +N+K FH+N+ EC  ++ + VTI+APG S N
Sbjct  119  CDKDENCNRPPMNIRFNFLKNAVVRDITSMNSKMFHINVLECDNISFQHVTISAPGTSIN 178
Query  193  TDGIHIGDSSKVTITDTTIGTGDDCISIGPGSTGLNITGVTCGPGHGISVGSLGRYKDEK 252
            TDGIHIG S  VTITDT I TGDDC+SIGPGS  + +T V CGPGHGISVGSLG+YKDEK
Sbjct  179  TDGIHIGLSRGVTITDTNIATGDDCVSIGPGSQNVTVTKVNCGPGHGISVGSLGKYKDEK 238
Query  253  DVTDITVKNCVLKKSTNGLRIKSYEDAKSPLTASKLTYENVKMEDVGYPIIIDQKYCPNK 312
            DV  ITV  C +  ++NG+R+K++ D+  P  A+ + +E++ M++V  P+I+DQ+YCP  
Sbjct  239  DVRGITVTGCTFTGTSNGVRVKTWPDSP-PGVATDMAFEDLTMKNVQNPVILDQEYCPYG 297
Query  313  ICTSKGDSARVTVKDVTFRNITGTSSTPEAVSLLCSDKQPCNGVTMNDVKIEYSGTNNKT 372
             C+ K  S RV + ++ F NI GTSS P+A+ + CS   PC+ + + ++ +         
Sbjct  298  QCSLKAPS-RVKLSNIKFNNIRGTSSGPDAIVIACSHGFPCSNLEIGEINLALHAAGAPA 356
Query  373  MAVCTNAKVTAKGVS-EANTCA 393
             + CTNAK    G    A  CA
Sbjct  357  NSTCTNAKPIFSGKQVPAIKCA 378

Sequence Alignment: 6. Allergen Name: Sal k 6.0101 Sequence ID: ARS33724

 Score = 264.6 bits 1043,  Expect = 6e-72
 Identities = 155/368 42%, Positives = 234/368 63%, Gaps = 12/368 3%
Query  20   ADGTYDITKLGAKPDGKTDCTKEVEEAWASACGGTGKNTIVIPKGDFLTGPLNFTGPCKG 79
            + G  DITK+GAKP+   D T  +  AW  AC       IV+P G+FL   + + GPCK 
Sbjct  22   SQGPIDITKFGAKPN--ADATSALLAAWKEACAAAAPAKIVVPAGEFLLNAVKLQGPCKA 79
Query  80   DSVTIKLDGNLLSSNDLAKYKAN--WIEIMRIKKLTIT---GKGTLDGQGKAVWGKNSCA 134
              +TI++ GN+ +  D+A+ K    W++I  ++ LTIT     GT+DGQG+A W +N CA
Sbjct  80   P-LTIEIAGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCA 138
Query  135  KNYNCKILPNTLVLDFCDDALIEGITLLNAKFFHMNIYECKGVTVKDVTITAPGDSPNTD 194
            ++  C  LP  + ++   +A I GI  LN+K++HM +  CK +T+  +TI AP DS NTD
Sbjct  139  QSGMCNSLPYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKNITLTGLTIDAPKDSLNTD 198
Query  195  GIHIGDSSKVTITDTTIGTGDDCISIGPGSTGLNITGVTCGPGHGISVGSLGRYKDEKDV 254
            G+HIG S+ V  T++ IGTGDDCIS+G G+  +++ G+TCGPGHGIS+GS+G++ +E   
Sbjct  199  GMHIGRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAPN 258
Query  255  TDITVKNCVLKKSTNGLRIKSYEDAKSPLTASKLTYENVKMEDVGYPIIIDQKYCPNKIC 314
            T I VKNC +  + NG+RIKS+ ++    +AS L +E++ + +V  P+IIDQ+YCP   C
Sbjct  259  TGIFVKNCSFTDTDNGVRIKSWMNSFEA-SASDLHFEDITVTNVLNPVIIDQEYCPYNHC 317
Query  315  TSKGDSARVTVKDVTFRNITGTSSTPEAVSLLCSDKQPCNGVTMNDVKIEYSGTNNKTMA 374
              K  S +V +  ++F+N+ G + + E V LLCS   PC+GV + D+ + + G     ++
Sbjct  318  KEKTPS-KVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTFPG--GAAVS 374
Query  375  VCTNAKVTAKGVSEANTCAA 394
             C N K    G      C A
Sbjct  375  QCKNVKPIVTGKQNPVACGA 394

Sequence Alignment: 7. Allergen Name: Sal k 6.0101 Sequence ID: AHL24657

 Score = 264.4 bits 1042,  Expect = 6e-72
 Identities = 155/366 42%, Positives = 233/366 63%, Gaps = 12/366 3%
Query  22   GTYDITKLGAKPDGKTDCTKEVEEAWASACGGTGKNTIVIPKGDFLTGPLNFTGPCKGDS 81
            G  DITK+GAKP+   D T  +  AW  AC       IV+P G+FL   + + GPCK   
Sbjct  2    GPIDITKFGAKPNA--DATSALLAAWKEACAAAAPAKIVVPAGEFLLNAVKLQGPCKAP- 58
Query  82   VTIKLDGNLLSSNDLAKYKAN--WIEIMRIKKLTIT---GKGTLDGQGKAVWGKNSCAKN 136
            +TI++ GN+ +  D+A+ K    W++I  ++ LTIT     GT+DGQG+A W +N CA++
Sbjct  59   LTIEIAGNFKAPADVAQMKGEDTWVKIENVQGLTITCLPTGGTFDGQGQAAWKQNKCAQS 118
Query  137  YNCKILPNTLVLDFCDDALIEGITLLNAKFFHMNIYECKGVTVKDVTITAPGDSPNTDGI 196
              C  LP  + ++   +A I GI  LN+K++HM +  CK +T+  +TI AP DS NTDG+
Sbjct  119  GMCNSLPYNFRFNTLTNAQISGIKSLNSKLYHMGVMGCKNITLTGLTIDAPKDSLNTDGM 178
Query  197  HIGDSSKVTITDTTIGTGDDCISIGPGSTGLNITGVTCGPGHGISVGSLGRYKDEKDVTD 256
            HIG S+ V  T++ IGTGDDCIS+G G+  +++ G+TCGPGHGIS+GS+G++ +E   T 
Sbjct  179  HIGRSNGVHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAPNTG 238
Query  257  ITVKNCVLKKSTNGLRIKSYEDAKSPLTASKLTYENVKMEDVGYPIIIDQKYCPNKICTS 316
            I VKNC +  + NG+RIKS+ ++    +AS L +E++ + +V  P+IIDQ+YCP   C  
Sbjct  239  IFVKNCSFTDTDNGVRIKSWMNSFEA-SASDLHFEDITVTNVLNPVIIDQEYCPYNHCKE 297
Query  317  KGDSARVTVKDVTFRNITGTSSTPEAVSLLCSDKQPCNGVTMNDVKIEYSGTNNKTMAVC 376
            K  S +V +  ++F+N+ G + + E V LLCS   PC+GV + D+ + + G     ++ C
Sbjct  298  KTPS-KVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCDGVELADIDLTFPG--GAAVSQC 354
Query  377  TNAKVTAKGVSEANTCAA 394
             N K    G      C A
Sbjct  355  KNVKPIVTGKQNPVACGA 372

Sequence Alignment: 8. Allergen Name: Ole e 14.0101 Sequence ID: W8PPL3

 Score = 254.7 bits 1003,  Expect = 5e-69
 Identities = 150/355 42%, Positives = 224/355 63%, Gaps = 9/355 2%
Query  24   YDITKLGAKPDGKTDCTKEVEEAWASACGGTGKNTIVIPKGDFLTGPLNFTGPCKGDS-V 82
            +D+ K GAK DG+ D  +   +AW +AC  TG   +VIPKGDF+ G + F GPC     +
Sbjct  16   FDVMKYGAKADGRFDNAQAFIKAWKAACESTGPAKVVIPKGDFVAGEVVFQGPCTAPKPI 75
Query  83   TIKLDGNLLSSNDLAKYKA-NWIEIMRIKKLTITGKGTLDGQGKAVWGKNSCAKNYNCKI 141
            TI++ GN+L+S D++ Y + +WI +  I  L I G GT++G+GK+ W       N    +
Sbjct  76   TIEIQGNVLASTDVSAYTSGSWIMLEEIDGLVINGGGTINGRGKSSW--QFAGANNEGPL 133
Query  142  LPNTLVLDFCDDALIEGITLLNAKFFHMNIYECKGVTVKDVTITAPGDSPNTDGIHIGDS 201
            LP +L +    ++ +  + ++++  FH  + + + + +  + I+APGDSPNTDG+HI  S
Sbjct  134  LPVSLTFKKVKNSEMHDVNFVDSMGFHSKVADSENIKISKLKISAPGDSPNTDGMHISCS 193
Query  202  SKVTITDTTIGTGDDCISIGPGSTGLNITGVTCGPGHGISVGSLGRYKDEKDVTDITVKN 261
            + V +TD+ IGTGDDC+SIG G+T + ++G+TCGPGHGISVGSLG+  DE DV  I+V N
Sbjct  194  TNVNVTDSIIGTGDDCVSIGHGTTDILVSGITCGPGHGISVGSLGKRPDETDVKGISVIN 253
Query  262  CVLKKSTNGLRIKSYEDAKSPLTASKLTYENVKMEDVGYPIIIDQKYCPNKICTSKGDSA 321
            C L  +TNG RIK+Y  A   + AS + Y+++ + DV  PI+IDQ Y   K    K + +
Sbjct  254  CTLTGTTNGARIKTYH-ASPSIQASDILYKDIIVTDVKNPILIDQHYDSKK----KPEQS 308
Query  322  RVTVKDVTFRNITGTSSTPEAVSLLCSDKQPCNGVTMNDVKIEYSGTNNKTMAVCTNAKV 381
            +V +  V F NI GT+ +   V+L CS+  PC  V + D+ +  SG      +VC NAK 
Sbjct  309  KVKISGVHFVNIKGTTVSEIPVALNCSEAVPCEDVELADIDLAPSGAAGSLKSVCANAKF 368
Query  382  TAKG 385
              KG
Sbjct  369  VLKG 372

Sequence Alignment: 9. Allergen Name: Cari p 1.0101 Sequence ID: C9EA45

 Score = 227.3 bits 893,  Expect = 1e-60
 Identities = 140/356 39%, Positives = 224/356 62%, Gaps = 14/356 3%
Query  24   YDITKLGAKPDGKTDCTKEV-EEAWASACGGTGKNTIVIP-KGDFLTGPLNFTGPCKGDS 81
            +++  +GA+ DG  D T++V EEAW  AC   G    ++P +  +L GP+ F GPCK + 
Sbjct  117  FNVDDFGAEGDGIHDDTQQVFEEAWEKACSYKGPALFLVPERRTYLIGPIRFLGPCKSNL 176
Query  82   VT-IKLDGNLLSSNDLAKYKAN---WIEIMRIKKLTITGKGTLDGQGKAVWGKNSCAKNY 137
            V  +++ G +L+S++ + Y+ +   WI I  +  L + G GT+ G G+ +W +NSC    
Sbjct  177  VIQVQISGTILASDNRSDYRKDPRHWIVIDSVDNLLVEGGGTIHGNGQ-IWWRNSCKA-- 233
Query  138  NCKILPNTLVLDFCDDALIEGITLLNAKFFHMNIYECKGVTVKDVTITAPGDSPNTDGIH 197
             CK  P T+ +  C + ++  + + +A+  +++  +C  VT  D+T+TAP  SPNTDGIH
Sbjct  234  PCKEAP-TVTFYKCKNLMVRNVKVQDAQQMQVSFEKCSEVTASDLTVTAPEKSPNTDGIH 292
Query  198  IGDSSKVTITDTTIGTGDDCISIGPGSTGLNITGVTCGPGHGISVGSLGRYKDEKDVTDI 257
            + ++  + IT+T IG GDDCISI  GS  + I  +TCGPGHGI+V SLG    +  V+ +
Sbjct  293  VTNTQNILITNTFIG-GDDCISIESGSHNVQIEELTCGPGHGINVDSLGDNNSKAFVSFV 351
Query  258  TVKNCVLKKSTNGLRIKSYEDAKSPLTASKLTYENVKMEDVGYPIIIDQKYCPNKICTSK 317
            TV    L  +TNG+RIK+Y+      +AS + ++NV ME+V  PIIIDQ YC  K    K
Sbjct  352  TVNGAKLSGTTNGVRIKTYQGGSG--SASNIKFQNVDMENVKNPIIIDQNYCDQKKPCKK 409
Query  318  GDSARVTVKDVTFRNITGTSSTPEAVSLLCSDKQPCNGVTMNDVKIEYSG-TNNKTMAVC 376
               + V VKDV ++NI G S++  A+ + CS+  PC GV + +V+++ +   + +  A+C
Sbjct  410  QQKSAVQVKDVLYQNIQGNSASDVAIDFDCSENYPCLGVKLQNVRLQRADRVDEEAKAIC 469
Query  377  TNAKVTAKGV 386
             + ++T  GV
Sbjct  470  NHVELTETGV 479

Sequence Alignment: 10. Allergen Name: Cry j 2 Sequence ID: BAA06172

 Score = 220.9 bits 867,  Expect = 1e-58
 Identities = 139/344 40%, Positives = 208/344 60%, Gaps = 21/344 6%
Query  24   YDITKLGAKPDGKTDCTKEVEEAWASACGGTGKNTIVIPKGDFLTGPLNFTGPCKGDSVT 83
            +++ K GA  DGK DCT+    AW +AC       +V     F+   L F GPC+    T
Sbjct  59   FNVEKYGAVGDGKHDCTEAFSTAWQAACKNPSAMLLVPGSKKFVVNNLFFNGPCQ-PHFT 117
Query  84   IKLDGNLLSSNDLAKYKAN--WIEIMRIKKLTITGKGTLDGQGKAVW--------GKNSC 133
             K+DG + +  + A +K N  W++  ++  +T+ GKG +DGQGK  W        G+  C
Sbjct  118  FKVDGIIAAYQNPASWKNNRIWLQFAKLTGFTLMGKGVIDGQGKQWWAGQCKWVNGREIC 177
Query  134  AKNYNCKILPNTLVLDFCDDALIEGITLLNAKFFHMNIYECKGVTVKDVTITAPGDSPNT 193
                N +  P  + +DF    +I+G+ L+N+  FH+    C+GV +  ++ITAP DSPNT
Sbjct  178  ----NDRDRPTAIKFDFSTGLIIQGLKLMNSPEFHLVFGNCEGVKIIGISITAPRDSPNT 233
Query  194  DGIHIGDSSKVTITDTTIGTGDDCISIGPGSTGLNITGVTCGPGHGISVGSLGRYKDEKD 253
            DGI I  S    +   TIGTGDDC++IG GS+ + I  + CGPGHGIS+GSLGR     +
Sbjct  234  DGIDIFASKNFHLQKNTIGTGDDCVAIGTGSSNIVIEDLICGPGHGISIGSLGRENSRAE 293
Query  254  VTDITVKNCVLKKSTNGLRIKSYEDAKSPLTASKLTYENVKMEDVGYPIIIDQKYCPNKI 313
            V+ + V    +  + NGLRIK+++       AS + YENV+M +   PI+I+Q YC +  
Sbjct  294  VSYVHVNGAKFIDTQNGLRIKTWQGGSG--MASHIIYENVEMINSENPILINQFYCTSAS 351
Query  314  CTSKGDSARVTVKDVTFRNITGTSSTPEAVSLLCSDKQPCNGVTMNDVKIEYSGTNNKTM 373
                  SA V ++DVT++NI GTS+T  A+ L CSD  PC  + ++D+ ++   T+ K +
Sbjct  352  ACQNQRSA-VQIQDVTYKNIRGTSATAAAIQLKCSDSMPCKDIKLSDISLKL--TSGK-I 407
Query  374  AVCTN 378
            A C N
Sbjct  408  ASCLN 412

Sequence Alignment: 11. Allergen Name: Cry j 2 Sequence ID: P43212

 Score = 220.4 bits 865,  Expect = 1e-58
 Identities = 139/344 40%, Positives = 208/344 60%, Gaps = 21/344 6%
Query  24   YDITKLGAKPDGKTDCTKEVEEAWASACGGTGKNTIVIPKGDFLTGPLNFTGPCKGDSVT 83
            +++ K GA  DGK DCT+    AW +AC       +V     F+   L F GPC+    T
Sbjct  59   FNVEKYGAVGDGKHDCTEAFSTAWQAACKKPSAMLLVPGNKKFVVNNLFFNGPCQ-PHFT 117
Query  84   IKLDGNLLSSNDLAKYKAN--WIEIMRIKKLTITGKGTLDGQGKAVW--------GKNSC 133
             K+DG + +  + A +K N  W++  ++  +T+ GKG +DGQGK  W        G+  C
Sbjct  118  FKVDGIIAAYQNPASWKNNRIWLQFAKLTGFTLMGKGVIDGQGKQWWAGQCKWVNGREIC 177
Query  134  AKNYNCKILPNTLVLDFCDDALIEGITLLNAKFFHMNIYECKGVTVKDVTITAPGDSPNT 193
                N +  P  + +DF    +I+G+ L+N+  FH+    C+GV +  ++ITAP DSPNT
Sbjct  178  ----NDRDRPTAIKFDFSTGLIIQGLKLMNSPEFHLVFGNCEGVKIIGISITAPRDSPNT 233
Query  194  DGIHIGDSSKVTITDTTIGTGDDCISIGPGSTGLNITGVTCGPGHGISVGSLGRYKDEKD 253
            DGI I  S    +   TIGTGDDC++IG GS+ + I  + CGPGHGIS+GSLGR     +
Sbjct  234  DGIDIFASKNFHLQKNTIGTGDDCVAIGTGSSNIVIEDLICGPGHGISIGSLGRENSRAE 293
Query  254  VTDITVKNCVLKKSTNGLRIKSYEDAKSPLTASKLTYENVKMEDVGYPIIIDQKYCPNKI 313
            V+ + V    +  + NGLRIK+++       AS + YENV+M +   PI+I+Q YC +  
Sbjct  294  VSYVHVNGAKFIDTQNGLRIKTWQGGSG--MASHIIYENVEMINSENPILINQFYCTSAS 351
Query  314  CTSKGDSARVTVKDVTFRNITGTSSTPEAVSLLCSDKQPCNGVTMNDVKIEYSGTNNKTM 373
                  SA V ++DVT++NI GTS+T  A+ L CSD  PC  + ++D+ ++   T+ K +
Sbjct  352  ACQNQRSA-VQIQDVTYKNIRGTSATAAAIQLKCSDSMPCKDIKLSDISLKL--TSGK-I 407
Query  374  AVCTN 378
            A C N
Sbjct  408  ASCLN 412

Sequence Alignment: 12. Allergen Name: Jun a 2 Sequence ID: CAC05582

 Score = 215.5 bits 845,  Expect = 4e-57
 Identities = 138/360 38%, Positives = 210/360 58%, Gaps = 18/360 5%
Query  24   YDITKLGAKPDGKTDCTKEVEEAWASACGGTGKNTIVIPKGDFLTGPLNFTGPCKGDSVT 83
            +++   GA  DGK D T   E+ W +AC       +V     F+   L F GPC+    +
Sbjct  60   FNVEHYGAVGDGKHDSTDAFEKTWNAACNKLSAVFLVPANKKFVVNNLVFYGPCQ-PHFS 118
Query  84   IKLDGNLLSSNDLAKYKAN--WIEIMRIKKLTITGKGTLDGQGKAVWGKNSCAKNYN--- 138
             K+DG + +  D AK+K +  W+   R+  + + G G +DGQG   W  + C K  N   
Sbjct  119  FKVDGTIAAYPDPAKWKNSKIWMHFARLTDFNLMGTGVIDGQGNRWWS-DQC-KTINGRT 176
Query  139  -C--KILPNTLVLDFCDDALIEGITLLNAKFFHMNIYECKGVTVKDVTITAPGDSPNTDG 195
             C  K  P  + +DF     ++ +TL N+  FH+   EC GV ++ + I AP DSPNTDG
Sbjct  177  VCNDKGRPTAIKIDFSKSVTVKELTLTNSPEFHLVFGECDGVKIQGIKIKAPRDSPNTDG 236
Query  196  IHIGDSSKVTITDTTIGTGDDCISIGPGSTGLNITGVTCGPGHGISVGSLGRYKDEKDVT 255
            I I  S +  I   TIGTGDDC+++G GS+ + I  +TCGPGHG+S+GSLG+     +V+
Sbjct  237  IDIFASKRFEIEKCTIGTGDDCVAVGTGSSNITIKDLTCGPGHGMSIGSLGKGNSRSEVS 296
Query  256  DITVKNCVLKKSTNGLRIKSYEDAKSPLTASKLTYENVKMEDVGYPIIIDQKYCPNKICT 315
             + +    +  + NGLRIK+++       AS +TYENV+M +   PI+I+Q YC +    
Sbjct  297  FVHLDGAKFIDTQNGLRIKTWQGGSG--LASHITYENVEMINAENPILINQFYCTSAAAC 354
Query  316  SKGDSARVTVKDVTFRNITGTSSTPEAVSLLCSDKQPCNGVTMNDVKIEYSGTNNKTMAV 375
                SA V ++DVTF+NI GTS+T  A+ L+CSD  PC+ + +++V ++   T+ K +A 
Sbjct  355  KNQRSA-VKIQDVTFKNIHGTSATTAAIQLMCSDSVPCSNIKLSNVFLKL--TSGK-VAT 410
Query  376  CTNAKVTAKGVSEAN-TC 392
            C N        +  N +C
Sbjct  411  CVNKNANGYYTNPLNPSC 428

Sequence Alignment: 13. Allergen Name: Cha o 2.0101 Sequence ID: Q7M1E7

 Score = 210.8 bits 826,  Expect = 1e-55
 Identities = 135/358 37%, Positives = 213/358 59%, Gaps = 19/358 5%
Query  15   DAASGADGTYDITKLGAKPDGKTDCTKEVEEAWASACGGTGKNTIVIPKGDFLTGPLNFT 74
            DAA+     +++ + GA  DGK D T+     W +AC       +V     F+   L F 
Sbjct  54   DAAT----VFNVEQYGAVGDGKHDSTEAFATTWNAACKKASAVLLVPANKKFFVNNLVFR 109
Query  75   GPCKGDSVTIKLDGNLLSSNDLAKYKAN--WIEIMRIKKLTITGKGTLDGQGKAVW-GKN 131
            GPC+   ++ K+DG +++  D A++K +  W++  ++  + + G G +DGQG+  W G+ 
Sbjct  110  GPCQ-PHLSFKVDGTIVAQPDPARWKNSKIWLQFAQLTDFNLMGTGVIDGQGQQWWAGQC 168
Query  132  SCAKNYN-C--KILPNTLVLDFCDDALIEGITLLNAKFFHMNIYECKGVTVKDVTITAPG 188
                    C  +  P  + +D+     ++ +TL+N+  FH+   EC+GV ++ + I AP 
Sbjct  169  KVVNGRTVCNDRNRPTAIKIDYSKSVTVKELTLMNSPEFHLVFGECEGVKIQGLKIKAPR 228
Query  189  DSPNTDGIHIGDSSKVTITDTTIGTGDDCISIGPGSTGLNITGVTCGPGHGISVGSLGRY 248
            DSPNTDGI I  S +  I    IGTGDDCI+IG GS+ + I  + CGPGHGIS+GSLGR 
Sbjct  229  DSPNTDGIDIFASKRFHIEKCVIGTGDDCIAIGTGSSNITIKDLICGPGHGISIGSLGRD 288
Query  249  KDEKDVTDITVKNCVLKKSTNGLRIKSYEDAKSPLTASKLTYENVKMEDVGYPIIIDQKY 308
                +V+ + V    +  + NGLRIK+++       AS +TYENV+M +   PI+I+Q Y
Sbjct  289  NSRAEVSHVHVNRAKFIDTQNGLRIKTWQGGSG--LASYITYENVEMINSENPILINQFY 346
Query  309  CPNKICTSKGDSARVTVKDVTFRNITGTSSTPEAVSLLCSDKQPCNGVTMNDVKIEYSGT 368
            C +        SA V ++ VT++NI GTS+T  A+ L+CSD  PC G+ +++V ++   T
Sbjct  347  CTSASACQNQRSA-VQIQGVTYKNIHGTSATAAAIQLMCSDSVPCTGIQLSNVSLKL--T 403
Query  369  NNKTMAVCTNAKVTAKG 385
            + K  A C +    A+G
Sbjct  404  SGKP-ASCVDKN--ARG 417

Sequence Alignment: 14. Allergen Name: Cup s 2.0101 Sequence ID: C0HKB1

 Score = 38.7 bits 127,  Expect = 0.0002
 Identities = 17/41 41%, Positives = 27/41 65%, Gaps = 0/41 0%
Query  232  VTCGPGHGISVGSLGRYKDEKDVTDITVKNCVLKKSTNGLR 272
            +TCGPGHG+S+GSLG+     +V+ + +    +  + NGLR
Sbjct  98   LTCGPGHGMSIGSLGKGNSRSEVSFVHLDGAKFIDTQNGLR 138

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.