The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

GKMKFKDCGKGEVTELDITDCSGDFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT
PIQVPGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVKAEVTAELVGDHGVLACGRF
GRQVE
Sequence Info Allergen Name Length Opt Bits Score E Value
CAB76459 Gly d 2.0201 125 844 172.1 4.1e-45
P80384 Lep d 2 141 681 140.5 1.4e-35
CAD32313 Lep d 2.0102 141 676 139.5 2.8e-35
CAA58755 Lep d 2.0201 141 665 137.4 1.2e-34
CAD32314 Lep d 2.0202 141 660 136.4 2.4e-34
CAA57160 Lep d 2.0101 98 516 108.5 4.4e-26
A6XEN9 Blo t 2.0104 142 474 100.4 1.7e-23
A6XEP5 Blo t 2.0104 142 473 100.2 2e-23
A6XEN8 Blo t 2.0104 142 471 99.8 2.6e-23
CAB59976 Gly d 2.0101 128 469 99.4 3.1e-23
A6XEP1 Blo t 2.0104 142 465 98.7 5.7e-23
A6XEP6 Blo t 2.0104 142 465 98.7 5.7e-23
A6XEP2 Blo t 2.0104 142 465 98.7 5.7e-23
AAQ73483 Blo t 2.0101 144 465 98.7 5.8e-23
A6XEP3 Blo t 2.0104 142 464 98.5 6.6e-23
A6XEP4 Blo t 2.0104 142 456 96.9 1.9e-22
A6XEP0 Blo t 2.0104 142 455 96.7 2.2e-22
AAQ73482 Blo t 2.0102 142 455 96.7 2.2e-22
BAX34757 Der f 35.0101 143 451 96.0 3.8e-22
O02380 Tyr p 2 141 446 95.0 7.3e-22
AAQ73481 Blo t 2.0103 141 419 89.8 2.7e-20
BAA01239 Der f 2 138 401 86.3 3e-19
Q00855 Der f 2 146 397 85.5 5.4e-19
BAA01241 Der f 2 138 395 85.1 6.8e-19
ABA39438 Der f 2.0109 129 387 83.5 1.9e-18
CAK22338 Der p 2.0114 146 374 81.0 1.2e-17
AAK30133 Der f 2 170 369 80.1 2.7e-17
P49278 Der p 2 146 367 79.7 3e-17
CAQ68249 Der p 2.0115 129 366 79.5 3.1e-17
ABA39437 Der p 2.0109 129 366 79.5 3.1e-17
Q9TZZ2 Eur m 2 145 356 77.6 1.3e-16
AAC82350 Eur m 2.0102 135 355 77.3 1.4e-16
Q28895 Can f 7.0101 149 228 52.8 4e-09
ABG76195 Der f 22.0101 155 195 46.4 3.4e-07
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Gly d 2.0201 Sequence ID: CAB76459

 Score = 172.1 bits 844,  Expect = 4e-45
 Identities = 125/125 100%, Positives = 125/125 100%, Gaps = 0/125 0%
Query  1    GKMKFKDCGKGEVTELDITDCSGDFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT 60
            GKMKFKDCGKGEVTELDITDCSGDFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT
Sbjct  1    GKMKFKDCGKGEVTELDITDCSGDFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT 60
Query  61   PIQVPGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVKAEVTAELVGDHGVLACGRF 120
            PIQVPGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVKAEVTAELVGDHGVLACGRF
Sbjct  61   PIQVPGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVKAEVTAELVGDHGVLACGRF 120
Query  121  GRQVE 125
            GRQVE
Sbjct  121  GRQVE 125

Sequence Alignment: 2. Allergen Name: Lep d 2 Sequence ID: P80384

 Score = 140.5 bits 681,  Expect = 1e-35
 Identities = 98/125 78%, Positives = 109/125 87%, Gaps = 0/125 0%
Query  1    GKMKFKDCGKGEVTELDITDCSGDFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT 60
            GKM FKDCG GEVTELDIT CSGD CVIHRG+ +TLEAKFAANQDT K TIKVLAKVAGT
Sbjct  17   GKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAANQDTAKVTIKVLAKVAGT 76
Query  61   PIQVPGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVKAEVTAELVGDHGVLACGRF 120
             IQVPGLETDGCKF+KCP+KKG+ +DF Y+ T+PAI PKVKA+VTAEL+GDHGV+ACG  
Sbjct  77   TIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVKADVTAELIGDHGVMACGTV 136
Query  121  GRQVE 125
              QVE
Sbjct  137  HGQVE 141

Sequence Alignment: 3. Allergen Name: Lep d 2.0102 Sequence ID: CAD32313

 Score = 139.5 bits 676,  Expect = 3e-35
 Identities = 97/125 77%, Positives = 108/125 86%, Gaps = 0/125 0%
Query  1    GKMKFKDCGKGEVTELDITDCSGDFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT 60
            GKM FKDCG GEVTELDIT CSGD CVIHRG+ +TLEAKFAANQDT K TIKVL KVAGT
Sbjct  17   GKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAANQDTAKVTIKVLTKVAGT 76
Query  61   PIQVPGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVKAEVTAELVGDHGVLACGRF 120
             IQVPGLETDGCKF+KCP+KKG+ +DF Y+ T+PAI PKVKA+VTAEL+GDHGV+ACG  
Sbjct  77   TIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVKADVTAELIGDHGVMACGTV 136
Query  121  GRQVE 125
              QVE
Sbjct  137  HGQVE 141

Sequence Alignment: 4. Allergen Name: Lep d 2.0201 Sequence ID: CAA58755

 Score = 137.4 bits 665,  Expect = 1e-34
 Identities = 96/125 76%, Positives = 107/125 85%, Gaps = 0/125 0%
Query  1    GKMKFKDCGKGEVTELDITDCSGDFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT 60
            GKM FKDCG GEVTELDI+ CSGD CVIHRG+ +TL+AKFAANQDT K TIKVLAKVAGT
Sbjct  17   GKMTFKDCGHGEVTELDISGCSGDTCVIHRGQKMTLDAKFAANQDTNKVTIKVLAKVAGT 76
Query  61   PIQVPGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVKAEVTAELVGDHGVLACGRF 120
             IQVPGLETDGCK +KCPIKKG+ +DF Y  T+PAI PK+KA+VTAELVGDHGV+ACG  
Sbjct  77   TIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIKADVTAELVGDHGVMACGTI 136
Query  121  GRQVE 125
              QVE
Sbjct  137  HGQVE 141

Sequence Alignment: 5. Allergen Name: Lep d 2.0202 Sequence ID: CAD32314

 Score = 136.4 bits 660,  Expect = 2e-34
 Identities = 95/125 76%, Positives = 106/125 84%, Gaps = 0/125 0%
Query  1    GKMKFKDCGKGEVTELDITDCSGDFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT 60
            GKM FKDCG GEVTELDI+ CSGD CVIHRG+ +TL+AKFAANQDT K TIKVLAKVAGT
Sbjct  17   GKMTFKDCGHGEVTELDISGCSGDTCVIHRGQKMTLDAKFAANQDTNKVTIKVLAKVAGT 76
Query  61   PIQVPGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVKAEVTAELVGDHGVLACGRF 120
             IQVPGLETDGCK +KCPIKKG+ +DF Y  T+PAI PK+K +VTAELVGDHGV+ACG  
Sbjct  77   TIQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIKVDVTAELVGDHGVMACGTI 136
Query  121  GRQVE 125
              QVE
Sbjct  137  HGQVE 141

Sequence Alignment: 6. Allergen Name: Lep d 2.0101 Sequence ID: CAA57160

 Score = 108.5 bits 516,  Expect = 4e-26
 Identities = 75/98 76%, Positives = 86/98 87%, Gaps = 0/98 0%
Query  28   IHRGKPLTLEAKFAANQDTTKATIKVLAKVAGTPIQVPGLETDGCKFVKCPIKKGDPIDF 87
            IHRG+ +TLEAKFAANQDT K TIKVLAKVAGT IQVPGLETDGCKF+KCP+KKG+ +DF
Sbjct  1    IHRGEKMTLEAKFAANQDTAKVTIKVLAKVAGTTIQVPGLETDGCKFIKCPVKKGEALDF 60
Query  88   KYTTTVPAILPKVKAEVTAELVGDHGVLACGRFGRQVE 125
             Y+ T+PAI PKVKA+VTAEL+GDHGV+ACG    QVE
Sbjct  61   IYSGTIPAITPKVKADVTAELIGDHGVMACGTVHGQVE 98

Sequence Alignment: 7. Allergen Name: Blo t 2.0104 Sequence ID: A6XEN9

 Score = 100.4 bits 474,  Expect = 2e-23
 Identities = 63/124 50%, Positives = 84/124 67%, Gaps = 0/124 0%
Query  1    GKMKFKDCGKGEVTELDITDCSGDFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT 60
            G +KF DC  GEVT LD++ CSGD C IH+GK +TL+  F ANQD+ K  IK+ A + G 
Sbjct  17   GDVKFTDCAHGEVTSLDLSGCSGDHCTIHKGKSFTLKTFFIANQDSEKLEIKISATMNGI 76
Query  61   PIQVPGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVKAEVTAELVGDHGVLACGRF 120
             + VPG++ DGCK   CP+KKG   ++ Y+  +P +LP VK   TA LVGDHGV+ACG+ 
Sbjct  77   EVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTVLPNVKTVTTASLVGDHGVVACGKV 136
Query  121  GRQV 124
              +V
Sbjct  137  NTEV 140

Sequence Alignment: 8. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP5

 Score = 100.2 bits 473,  Expect = 2e-23
 Identities = 63/124 50%, Positives = 84/124 67%, Gaps = 0/124 0%
Query  1    GKMKFKDCGKGEVTELDITDCSGDFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT 60
            G +KF DC  GEVT LD++ CSGD C IH+GK +TL+  F ANQD+ K  IK+ A + G 
Sbjct  17   GDVKFTDCAHGEVTSLDLSRCSGDHCTIHKGKSFTLKTFFIANQDSEKLEIKISATMNGI 76
Query  61   PIQVPGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVKAEVTAELVGDHGVLACGRF 120
             + VPG++ DGCK   CP+KKG   ++ Y+  +P +LP VK   TA LVGDHGV+ACG+ 
Sbjct  77   EVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTVLPNVKTVTTASLVGDHGVVACGKV 136
Query  121  GRQV 124
              +V
Sbjct  137  NTEV 140

Sequence Alignment: 9. Allergen Name: Blo t 2.0104 Sequence ID: A6XEN8

 Score = 99.8 bits 471,  Expect = 3e-23
 Identities = 63/124 50%, Positives = 84/124 67%, Gaps = 0/124 0%
Query  1    GKMKFKDCGKGEVTELDITDCSGDFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT 60
            G +KF DC  GEVT LD++ CSGD C IH+GK +TL+  F ANQD+ K  IK+ A + G 
Sbjct  17   GDVKFTDCAHGEVTSLDLSGCSGDHCTIHKGKSFTLKTFFIANQDSEKLEIKISATMNGI 76
Query  61   PIQVPGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVKAEVTAELVGDHGVLACGRF 120
             + VPG++ DGCK   CP+KKG   ++ Y+  +P ILP +K   TA LVGDHGV+ACG+ 
Sbjct  77   EVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVTTASLVGDHGVVACGKV 136
Query  121  GRQV 124
              +V
Sbjct  137  NTEV 140

Sequence Alignment: 10. Allergen Name: Gly d 2.0101 Sequence ID: CAB59976

 Score = 99.4 bits 469,  Expect = 3e-23
 Identities = 64/125 51%, Positives = 92/125 73%, Gaps = 2/125 1%
Query  1    GKMKFKDCGKGEVTELDITDCSGDFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT 60
            GKM F DCG  E+ EL +++C+G++CVIHRGKPLTL+AKF ANQDT    + + A + G 
Sbjct  1    GKMNFTDCGHNEIKELSVSNCTGNYCVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGD 60
Query  61   -PIQVPGLETDGCKFVKCPIKKGDPIDFKYTT-TVPAILPKVKAEVTAELVGDHGVLACG 118
              I +PGLET+ CK++KCPI+KG+  ++ Y    +P   P++KA+V A+L+G+HGVLACG
Sbjct  61   IAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIKAKVKAQLIGEHGVLACG 120
Query  119  RFGRQVE 125
                +V+
Sbjct  121  WVDGEVQ 127

Sequence Alignment: 11. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP1

 Score = 98.7 bits 465,  Expect = 6e-23
 Identities = 62/124 50%, Positives = 84/124 67%, Gaps = 0/124 0%
Query  1    GKMKFKDCGKGEVTELDITDCSGDFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT 60
            G +KF DC  GEVT LD++ CSGD C+IH+GK +TL+  F ANQD+ K  IK+ A +   
Sbjct  17   GDVKFTDCAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQDSEKLEIKISAIMNNI 76
Query  61   PIQVPGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVKAEVTAELVGDHGVLACGRF 120
             + VPG++ DGCK   CP+KKG   ++ Y+  +P ILP +K   TA LVGDHGV+ACG+ 
Sbjct  77   EVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVTTASLVGDHGVVACGKV 136
Query  121  GRQV 124
              +V
Sbjct  137  NTEV 140

Sequence Alignment: 12. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP6

 Score = 98.7 bits 465,  Expect = 6e-23
 Identities = 62/124 50%, Positives = 84/124 67%, Gaps = 0/124 0%
Query  1    GKMKFKDCGKGEVTELDITDCSGDFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT 60
            G +KF DC  GEVT LD++ CSGD C+IH+GK +TL+  F ANQD+ K  IK+ A +   
Sbjct  17   GDVKFTDCAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQDSEKLEIKISAIMNNI 76
Query  61   PIQVPGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVKAEVTAELVGDHGVLACGRF 120
             + VPG++ DGCK   CP+KKG   ++ Y+  +P ILP +K   TA LVGDHGV+ACG+ 
Sbjct  77   EVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVTTASLVGDHGVVACGKV 136
Query  121  GRQV 124
              +V
Sbjct  137  NTEV 140

Sequence Alignment: 13. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP2

 Score = 98.7 bits 465,  Expect = 6e-23
 Identities = 62/124 50%, Positives = 84/124 67%, Gaps = 0/124 0%
Query  1    GKMKFKDCGKGEVTELDITDCSGDFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT 60
            G +KF DC  GEVT LD++ CSGD C+IH+GK +TL+  F ANQD+ K  IK+ A +   
Sbjct  17   GDVKFTDCAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQDSEKLEIKISAIMNNI 76
Query  61   PIQVPGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVKAEVTAELVGDHGVLACGRF 120
             + VPG++ DGCK   CP+KKG   ++ Y+  +P ILP +K   TA LVGDHGV+ACG+ 
Sbjct  77   EVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVTTASLVGDHGVVACGKV 136
Query  121  GRQV 124
              +V
Sbjct  137  NTEV 140

Sequence Alignment: 14. Allergen Name: Blo t 2.0101 Sequence ID: AAQ73483

 Score = 98.7 bits 465,  Expect = 6e-23
 Identities = 62/124 50%, Positives = 84/124 67%, Gaps = 0/124 0%
Query  1    GKMKFKDCGKGEVTELDITDCSGDFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT 60
            G +KF DC  GEVT LD++ CSGD C+IH+GK +TL+  F ANQD+ K  IK+ A +   
Sbjct  19   GDVKFTDCAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQDSEKLEIKISAIMNNI 78
Query  61   PIQVPGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVKAEVTAELVGDHGVLACGRF 120
             + VPG++ DGCK   CP+KKG   ++ Y+  +P ILP +K   TA LVGDHGV+ACG+ 
Sbjct  79   EVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVTTASLVGDHGVVACGKV 138
Query  121  GRQV 124
              +V
Sbjct  139  NTEV 142

Sequence Alignment: 15. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP3

 Score = 98.5 bits 464,  Expect = 7e-23
 Identities = 62/124 50%, Positives = 84/124 67%, Gaps = 0/124 0%
Query  1    GKMKFKDCGKGEVTELDITDCSGDFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT 60
            G +KF DC  GEVT LD++ CSGD C+IH+GK +TL+  F ANQD+ K  IK+ A +   
Sbjct  17   GDVKFTDCAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQDSEKLEIKISAIMNNI 76
Query  61   PIQVPGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVKAEVTAELVGDHGVLACGRF 120
             + VPG++ DGCK   CP+KKG   ++ Y+  +P ILP +K   TA LVGDHGV+ACG+ 
Sbjct  77   EVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTITTASLVGDHGVVACGKV 136
Query  121  GRQV 124
              +V
Sbjct  137  NTEV 140

Sequence Alignment: 16. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP4

 Score = 96.9 bits 456,  Expect = 2e-22
 Identities = 61/124 49%, Positives = 83/124 66%, Gaps = 0/124 0%
Query  1    GKMKFKDCGKGEVTELDITDCSGDFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT 60
            G +KF DC  GEVT LD++ CS D C+IH+GK +TL+  F ANQD+ K  IK+ A +   
Sbjct  17   GDVKFTDCAHGEVTSLDLSGCSDDHCIIHKGKSFTLKTFFIANQDSEKLEIKISAIMNNI 76
Query  61   PIQVPGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVKAEVTAELVGDHGVLACGRF 120
             + VPG++ DGCK   CP+KKG   ++ Y+  +P ILP +K   TA LVGDHGV+ACG+ 
Sbjct  77   EVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVTTASLVGDHGVVACGKV 136
Query  121  GRQV 124
              +V
Sbjct  137  NTEV 140

Sequence Alignment: 17. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP0

 Score = 96.7 bits 455,  Expect = 2e-22
 Identities = 61/124 49%, Positives = 83/124 66%, Gaps = 0/124 0%
Query  1    GKMKFKDCGKGEVTELDITDCSGDFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT 60
            G +KF DC  GEVT LD++ CSGD C+I +GK +TL+  F ANQD+ K  IK+ A +   
Sbjct  17   GDVKFTDCAHGEVTSLDLSGCSGDHCIIRKGKSFTLKTFFIANQDSEKLEIKISAIMNNI 76
Query  61   PIQVPGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVKAEVTAELVGDHGVLACGRF 120
             + VPG++ DGCK   CP+KKG   ++ Y+  +P ILP +K   TA LVGDHGV+ACG+ 
Sbjct  77   EVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVTTASLVGDHGVVACGKV 136
Query  121  GRQV 124
              +V
Sbjct  137  NTEV 140

Sequence Alignment: 18. Allergen Name: Blo t 2.0102 Sequence ID: AAQ73482

 Score = 96.7 bits 455,  Expect = 2e-22
 Identities = 61/124 49%, Positives = 83/124 66%, Gaps = 0/124 0%
Query  1    GKMKFKDCGKGEVTELDITDCSGDFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT 60
            G +KF  C  GEVT LD++ CSGD C+IH+GK +TL+  F ANQD+ K  IK+ A +   
Sbjct  17   GDVKFTACAHGEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQDSEKLEIKISAIMNNI 76
Query  61   PIQVPGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVKAEVTAELVGDHGVLACGRF 120
             + VPG++ DGCK   CP+KKG   ++ Y+  +P ILP +K   TA LVGDHGV+ACG+ 
Sbjct  77   EVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVTTASLVGDHGVVACGKV 136
Query  121  GRQV 124
              +V
Sbjct  137  NTEV 140

Sequence Alignment: 19. Allergen Name: Der f 35.0101 Sequence ID: BAX34757

 Score = 96.0 bits 451,  Expect = 4e-22
 Identities = 56/124 45%, Positives = 86/124 69%, Gaps = 0/124 0%
Query  1    GKMKFKDCGKGEVTELDITDCSGDFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT 60
            GKMKF DCG  EV  LD++ C GD+CV+H+GK + L+ K  +NQD+    + + A V G 
Sbjct  18   GKMKFVDCGHKEVISLDVSGCEGDYCVLHKGKTIDLDMKCKSNQDSEHLKLIISADVNGI 77
Query  61   PIQVPGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVKAEVTAELVGDHGVLACGRF 120
             I+VPG++ DGC +V+CPI KG   D KY+  VPA+LP +K  +TA+++GD+G++ C ++
Sbjct  78   EIEVPGFDQDGCHYVQCPIHKGQDYDIKYSYNVPAVLPNIKGTLTAKVIGDNGLVGCLKL 137
Query  121  GRQV 124
              ++
Sbjct  138  NGEI 141

Sequence Alignment: 20. Allergen Name: Tyr p 2 Sequence ID: O02380

 Score = 95.0 bits 446,  Expect = 7e-22
 Identities = 57/125 45%, Positives = 82/125 65%, Gaps = 0/125 0%
Query  1    GKMKFKDCGKGEVTELDITDCSGDFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT 60
            G++KF DCGK E+  + +  C GD+CVIH+ KP+ + A+F ANQDT K  +KV  ++ G 
Sbjct  16   GQVKFTDCGKKEIASVAVDGCEGDLCVIHKSKPVHVIAEFTANQDTCKIEVKVTGQLNGL 75
Query  61   PIQVPGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVKAEVTAELVGDHGVLACGRF 120
             + +PG+ETDGCK +KCP+KKG      Y+  VP+++P +K  V     G+HGVLACG  
Sbjct  76   EVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVPNIKTVVKLLATGEHGVLACGAV 135
Query  121  GRQVE 125
               V+
Sbjct  136  NTDVK 140

Sequence Alignment: 21. Allergen Name: Blo t 2.0103 Sequence ID: AAQ73481

 Score = 89.8 bits 419,  Expect = 3e-20
 Identities = 57/119 47%, Positives = 80/119 67%, Gaps = 1/119 0%
Query  5    FKDCGKGEVTELDITDCSGDFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGTPIQV 64
            ++ C   EVT LD++ CSGD C+IH+GK +TL+  F ANQD+ K  IK+ A +    + V
Sbjct  21   YRSC-TWEVTSLDLSGCSGDHCIIHKGKSFTLKTFFIANQDSEKLEIKISAIMNNIEVPV 79
Query  65   PGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVKAEVTAELVGDHGVLACGRFGRQV 124
            PG++ DGCK   CP+KKG   ++ Y+  +P ILP +K   TA LVGDHGV+ACG+   +V
Sbjct  80   PGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVTTASLVGDHGVVACGKVNTEV 139

Sequence Alignment: 22. Allergen Name: Der f 2 Sequence ID: BAA01239

 Score = 86.3 bits 401,  Expect = 3e-19
 Identities = 59/116 50%, Positives = 79/116 68%, Gaps = 2/116 1%
Query  2    KMKFKDCGKGEVTELDITDCSG-DFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT 60
            ++  KDC   E+ ++ +  C G D C+IHRGKP+TLEA F ANQ+T  A I++ A + G 
Sbjct  11   QVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGL 70
Query  61   PIQVPGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVK-AEVTAELVGDHGVLAC 117
             I VPG++T+ C FVKCP+ KG   D KYT  VP I PK +   VT +L+GD+GVLAC
Sbjct  71   EIDVPGIDTNACHFVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLAC 128

Sequence Alignment: 23. Allergen Name: Der f 2 Sequence ID: Q00855

 Score = 85.5 bits 397,  Expect = 5e-19
 Identities = 58/116 50%, Positives = 79/116 68%, Gaps = 2/116 1%
Query  2    KMKFKDCGKGEVTELDITDCSG-DFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT 60
            ++  KDC   E+ ++ +  C G D C+IHRGKP+TLEA F ANQ+T  A I++ A + G 
Sbjct  19   QVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGL 78
Query  61   PIQVPGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVK-AEVTAELVGDHGVLAC 117
             I VPG++T+ C F+KCP+ KG   D KYT  VP I PK +   VT +L+GD+GVLAC
Sbjct  79   EIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLAC 136

Sequence Alignment: 24. Allergen Name: Der f 2 Sequence ID: BAA01241

 Score = 85.1 bits 395,  Expect = 7e-19
 Identities = 59/116 50%, Positives = 79/116 68%, Gaps = 2/116 1%
Query  2    KMKFKDCGKGEVTELDITDCSG-DFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT 60
            ++  KDC   E+ ++ +  C G D C+IHRGKP+TLEA F ANQ+T  A I++ A + G 
Sbjct  11   QVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGL 70
Query  61   PIQVPGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVK-AEVTAELVGDHGVLAC 117
             I VPG++T+ C F+KCP+ KG   D KYT  VP I PK +   VT +LVGD+GVLAC
Sbjct  71   EIDVPGIDTNACHFMKCPLVKGQQYDAKYTWNVPKIAPKSENVVVTVKLVGDNGVLAC 128

Sequence Alignment: 25. Allergen Name: Der f 2.0109 Sequence ID: ABA39438

 Score = 83.5 bits 387,  Expect = 2e-18
 Identities = 57/116 49%, Positives = 78/116 67%, Gaps = 2/116 1%
Query  2    KMKFKDCGKGEVTELDITDCSG-DFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT 60
            ++  KDC   E+ ++ +    G D C+IHRGKP+TLEA F ANQ+T  A I++ A + G 
Sbjct  2    QVDVKDCANNEIKKVMVDGRHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKANINGL 61
Query  61   PIQVPGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVK-AEVTAELVGDHGVLAC 117
             + VPG++T+ C FVKCP+ KG   D KYT  VP I PK +   VT +L+GD+GVLAC
Sbjct  62   EVDVPGIDTNACHFVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLAC 119

Sequence Alignment: 26. Allergen Name: Der p 2.0114 Sequence ID: CAK22338

 Score = 81.0 bits 374,  Expect = 1e-17
 Identities = 53/116 45%, Positives = 77/116 66%, Gaps = 2/116 1%
Query  2    KMKFKDCGKGEVTELDITDCSG-DFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT 60
            ++  KDC   E+ ++ +  C G + C+IHRGKP+ LEA F ANQ+T  A I++ A + G 
Sbjct  19   QVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEALFEANQNTKNAKIEIKASIDGL 78
Query  61   PIQVPGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVK-AEVTAELVGDHGVLAC 117
             + VPG++ + C +VKCP+ KG   D KYT  VP I PK +   VT +++GD+GVLAC
Sbjct  79   EVDVPGIDPNACHYVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLAC 136

Sequence Alignment: 27. Allergen Name: Der f 2 Sequence ID: AAK30133

 Score = 80.1 bits 369,  Expect = 3e-17
 Identities = 55/106 51%, Positives = 74/106 69%, Gaps = 2/106 1%
Query  12   EVTELDITDCSG-DFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGTPIQVPGLETD 70
            E+ ++ +  C G D C+IHRGKP+TLEA F ANQ+T  A I++ A + G  I VPG++T+
Sbjct  53   EIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTN 112
Query  71   GCKFVKCPIKKGDPIDFKYTTTVPAILPKVK-AEVTAELVGDHGVLAC 117
             C F+KCP+ KG   D KYT  VP I PK +   VT +L+GD+GVLAC
Sbjct  113  ACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLAC 160

Sequence Alignment: 28. Allergen Name: Der p 2 Sequence ID: P49278

 Score = 79.7 bits 367,  Expect = 3e-17
 Identities = 52/116 44%, Positives = 76/116 65%, Gaps = 2/116 1%
Query  2    KMKFKDCGKGEVTELDITDCSG-DFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT 60
            ++  KDC   E+ ++ +  C G + C+IHRGKP+ LEA F ANQ+T  A I++ A + G 
Sbjct  19   QVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNTKTAKIEIKASIDGL 78
Query  61   PIQVPGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVK-AEVTAELVGDHGVLAC 117
             + VPG++ + C ++KCP+ KG   D KYT  VP I PK +   VT +++GD GVLAC
Sbjct  79   EVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVMGDDGVLAC 136

Sequence Alignment: 29. Allergen Name: Der p 2.0115 Sequence ID: CAQ68249

 Score = 79.5 bits 366,  Expect = 3e-17
 Identities = 51/116 43%, Positives = 77/116 66%, Gaps = 2/116 1%
Query  2    KMKFKDCGKGEVTELDITDCSG-DFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT 60
            ++  KDC   E+ ++ +  C G + C+IHRGKP+ LEA F ANQ++  A I++ A + G 
Sbjct  2    QVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDGL 61
Query  61   PIQVPGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVK-AEVTAELVGDHGVLAC 117
             + VPG++ + C ++KCP+ KG   D KYT  VP I PK +   VT +++GD+GVLAC
Sbjct  62   EVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVMGDNGVLAC 119

Sequence Alignment: 30. Allergen Name: Der p 2.0109 Sequence ID: ABA39437

 Score = 79.5 bits 366,  Expect = 3e-17
 Identities = 51/116 43%, Positives = 77/116 66%, Gaps = 2/116 1%
Query  2    KMKFKDCGKGEVTELDITDCSG-DFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT 60
            ++  KDC   E+ ++ +  C G + C+IHRGKP+ LEA F ANQ++  A I++ A + G 
Sbjct  2    QVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDGL 61
Query  61   PIQVPGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVK-AEVTAELVGDHGVLAC 117
             + VPG++ + C ++KCP+ KG   D KYT  VP I PK +   VT +++GD+GVLAC
Sbjct  62   EVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLAC 119

Sequence Alignment: 31. Allergen Name: Eur m 2 Sequence ID: Q9TZZ2

 Score = 77.6 bits 356,  Expect = 1e-16
 Identities = 53/116 45%, Positives = 75/116 64%, Gaps = 2/116 1%
Query  2    KMKFKDCGKGEVTELDITDCSG-DFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT 60
            ++  KDC   E+ ++ +  C G + CVIHRG  + LEA F ANQ++  A I++ A + G 
Sbjct  18   QVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEIKATIDGV 77
Query  61   PIQVPGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVK-AEVTAELVGDHGVLAC 117
             I VPG++ + C F+KCP+ KG   D KYT  VP I PK +   VT +L+GD+GVLAC
Sbjct  78   EIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDNGVLAC 135

Sequence Alignment: 32. Allergen Name: Eur m 2.0102 Sequence ID: AAC82350

 Score = 77.3 bits 355,  Expect = 1e-16
 Identities = 53/116 45%, Positives = 75/116 64%, Gaps = 2/116 1%
Query  2    KMKFKDCGKGEVTELDITDCSG-DFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGT 60
            ++  KDC   E+ ++ +  C G + CVIHRG  + LEA F ANQ++  A I++ A + G 
Sbjct  8    QVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEIKATIDGV 67
Query  61   PIQVPGLETDGCKFVKCPIKKGDPIDFKYTTTVPAILPKVK-AEVTAELVGDHGVLAC 117
             I VPG++ + C F+KCP+ KG   D KYT  VP I PK +   VT +L+GD+GVLAC
Sbjct  68   EIDVPGIDNNLCHFMKCPLVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDNGVLAC 125

Sequence Alignment: 33. Allergen Name: Can f 7.0101 Sequence ID: Q28895

 Score = 52.8 bits 228,  Expect = 4e-09
 Identities = 39/125 31%, Positives = 59/125 47%, Gaps = 4/125 3%
Query  1    GKMKFKDCGK--GEVTELDITDCSGDFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVA 58
            G + FKDCG   G + EL++  C    C +H+G+  ++   F +N  +  +   V   V 
Sbjct  20   GAVHFKDCGSAVGVIKELNVNPCPAQPCKLHKGQSYSVNVTFTSNIPSQSSKAVVHGIVL 79
Query  59   GTPIQVPGLETDGCKF-VKCPIKKGDPIDFKYTTTVPAILPKVKAEVTAELVGDHGV-LA 116
            G  +  P  E DGCK  + CPI+K     +     V    P +K  V   L+GD+   L 
Sbjct  80   GVAVPFPIPEADGCKSGINCPIQKDKTYSYLNKLPVKNEYPSIKLVVQWMLLGDNNQHLF 139
Query  117  CGRFGRQVE 125
            C     Q+E
Sbjct  140  CWEIPVQIE 148

Sequence Alignment: 34. Allergen Name: Der f 22.0101 Sequence ID: ABG76195

 Score = 46.4 bits 195,  Expect = 3e-07
 Identities = 35/117 29%, Positives = 59/117 50%, Gaps = 7/117 5%
Query  3    MKFKDCGKGEVTELDITDCSGD--FCVIHRGKPLTLEAKFAANQDT-TKATIKVLAKVAG 59
            +++KDCG  E+  + +T  + +   CVIH+     L   F AN++T  K   + +  + G
Sbjct  25   VQYKDCGHNEIKSFFVTGGNPNQKSCVIHKHSKNQLRISFVANENTGNKINTRFICNLGG 84
Query  60   TPIQVPGLE-TDGCKF--VKCPIKKGDPIDFKYTTTVPAILPKVKAEVTAELVGDHGV-L 115
              +  PG++ TD C+   + CP+ KG   ++     +   +P      T  L   HG  L
Sbjct  85   IELGWPGIDGTDACQGHGLSCPLTKGQTYNYHLDFNLGDDVPTANVTATVRLENGHGGDL 144
Query  116  ACGR 119
             CGR
Sbjct  145  LCGR 148

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.