The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

GPKCPFNSDTVSIIIETRENRNRDLYTLQTLQNHPEFKKKTITRPVVFITHGFTSSASEK
NFINLAKALVDKDNYMVISIDWQTAACTNEYPGLKYAYYPTAASNTRLVGQYIATITQKL
VKDYKISMANIRLIGHSLGAHVSGFAGKRVQELKLGKYSEIIGLDPARPSFDSNHCSERL
CETDAEYVQIIHTSNYLGTEKILGTVDFYMNNGKNNPGCGRFFSEVCSHTRAVIYMAECI
KHECCLIGIPRSKSSQPISRCTKQECVCVGLNAKKYPSRGSFYVPVESTAPFCNNKGKII
Sequence Info Allergen Name Length Opt Bits Score E Value
P51528 Ves m 1 300 2023 467.7 2.4e-133
P49369 Ves v 1 336 1936 447.8 2.6e-127
ACA00159 Vesp c 1.0101 301 1494 347.1 4.8e-97
Q06478 Dol m 1.0101 317 1485 345.0 2.1e-96
3989146 Ves s 1.0101 298 1435 333.6 5.3e-93
ABN13879 Poly p 1.0101 322 1333 310.4 5.8e-86
C0HLL3 Vesp v 1.0101 304 1311 305.4 1.8e-84
P53357 Dol m 1.02 303 1292 301.0 3.5e-83
Q9U6W0 Pol a 1 301 1133 264.8 2.8e-72
AAS67042 Pol d 1.0102 316 1108 259.1 1.6e-70
AAS67041 Pol d 1.0101 337 1104 258.2 3.2e-70
AAS67044 Pol d 1.0104 316 1100 257.3 5.6e-70
AAS67043 Pol d 1.0103 316 1100 257.3 5.6e-70
3989146 Pol e 1.0101 302 899 211.5 3.3e-56
AAT95008 Sol i 1.0101 346 595 142.1 2.8e-35
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ves m 1 Sequence ID: P51528

 Score = 467.7 bits 2023,  Expect = 2e-133
 Identities = 300/300 100%, Positives = 300/300 100%, Gaps = 0/300 0%
Query  1    GPKCPFNSDTVSIIIETRENRNRDLYTLQTLQNHPEFKKKTITRPVVFITHGFTSSASEK 60
            GPKCPFNSDTVSIIIETRENRNRDLYTLQTLQNHPEFKKKTITRPVVFITHGFTSSASEK
Sbjct  1    GPKCPFNSDTVSIIIETRENRNRDLYTLQTLQNHPEFKKKTITRPVVFITHGFTSSASEK 60
Query  61   NFINLAKALVDKDNYMVISIDWQTAACTNEYPGLKYAYYPTAASNTRLVGQYIATITQKL 120
            NFINLAKALVDKDNYMVISIDWQTAACTNEYPGLKYAYYPTAASNTRLVGQYIATITQKL
Sbjct  61   NFINLAKALVDKDNYMVISIDWQTAACTNEYPGLKYAYYPTAASNTRLVGQYIATITQKL 120
Query  121  VKDYKISMANIRLIGHSLGAHVSGFAGKRVQELKLGKYSEIIGLDPARPSFDSNHCSERL 180
            VKDYKISMANIRLIGHSLGAHVSGFAGKRVQELKLGKYSEIIGLDPARPSFDSNHCSERL
Sbjct  121  VKDYKISMANIRLIGHSLGAHVSGFAGKRVQELKLGKYSEIIGLDPARPSFDSNHCSERL 180
Query  181  CETDAEYVQIIHTSNYLGTEKILGTVDFYMNNGKNNPGCGRFFSEVCSHTRAVIYMAECI 240
            CETDAEYVQIIHTSNYLGTEKILGTVDFYMNNGKNNPGCGRFFSEVCSHTRAVIYMAECI
Sbjct  181  CETDAEYVQIIHTSNYLGTEKILGTVDFYMNNGKNNPGCGRFFSEVCSHTRAVIYMAECI 240
Query  241  KHECCLIGIPRSKSSQPISRCTKQECVCVGLNAKKYPSRGSFYVPVESTAPFCNNKGKII 300
            KHECCLIGIPRSKSSQPISRCTKQECVCVGLNAKKYPSRGSFYVPVESTAPFCNNKGKII
Sbjct  241  KHECCLIGIPRSKSSQPISRCTKQECVCVGLNAKKYPSRGSFYVPVESTAPFCNNKGKII 300

Sequence Alignment: 2. Allergen Name: Ves v 1 Sequence ID: P49369

 Score = 447.8 bits 1936,  Expect = 3e-127
 Identities = 287/300 95%, Positives = 290/300 96%, Gaps = 0/300 0%
Query  1    GPKCPFNSDTVSIIIETRENRNRDLYTLQTLQNHPEFKKKTITRPVVFITHGFTSSASEK 60
            GPKCPFNSDTVSIIIETRENRNRDLYTLQTLQNHPEFKKKTITRPVVFITHGFTSSASE 
Sbjct  37   GPKCPFNSDTVSIIIETRENRNRDLYTLQTLQNHPEFKKKTITRPVVFITHGFTSSASET 96
Query  61   NFINLAKALVDKDNYMVISIDWQTAACTNEYPGLKYAYYPTAASNTRLVGQYIATITQKL 120
            NFINLAKALVDKDNYMVISIDWQTAACTNE  GLKY YYPTAA NTRLVGQYIATITQKL
Sbjct  97   NFINLAKALVDKDNYMVISIDWQTAACTNEAAGLKYLYYPTAARNTRLVGQYIATITQKL 156
Query  121  VKDYKISMANIRLIGHSLGAHVSGFAGKRVQELKLGKYSEIIGLDPARPSFDSNHCSERL 180
            VK YKISMANIRLIGHSLGAH SGFAGK+VQELKLGKYSEIIGLDPARPSFDSNHCSERL
Sbjct  157  VKHYKISMANIRLIGHSLGAHASGFAGKKVQELKLGKYSEIIGLDPARPSFDSNHCSERL 216
Query  181  CETDAEYVQIIHTSNYLGTEKILGTVDFYMNNGKNNPGCGRFFSEVCSHTRAVIYMAECI 240
            CETDAEYVQIIHTSNYLGTEK LGTVDFYMNNGKN PGCGRFFSEVCSH+RAVIYMAECI
Sbjct  217  CETDAEYVQIIHTSNYLGTEKTLGTVDFYMNNGKNQPGCGRFFSEVCSHSRAVIYMAECI 276
Query  241  KHECCLIGIPRSKSSQPISRCTKQECVCVGLNAKKYPSRGSFYVPVESTAPFCNNKGKII 300
            KHECCLIGIP+SKSSQPIS CTKQECVCVGLNAKKYPSRGSFYVPVESTAPFCNNKGKII
Sbjct  277  KHECCLIGIPKSKSSQPISSCTKQECVCVGLNAKKYPSRGSFYVPVESTAPFCNNKGKII 336

Sequence Alignment: 3. Allergen Name: Vesp c 1.0101 Sequence ID: ACA00159

 Score = 347.1 bits 1494,  Expect = 5e-97
 Identities = 213/297 71%, Positives = 245/297 82%, Gaps = 1/297 0%
Query  4    CPFNSDTVSIIIETRENRNRDLYTLQTLQNHPEFKKKTITRPVVFITHGFTSSASEKNFI 63
            CP++ DTV +I+ TREN+  D+YTL T++NH EFK     +P VFITHGFTSSA+ +NF+
Sbjct  4    CPYSDDTVKMIVLTRENKKYDFYTLDTIKNHNEFKDTITLKPHVFITHGFTSSATAENFV 63
Query  64   NLAKALVDKDNYMVISIDWQTAACTNEYPGLKYAYYPTAASNTRLVGQYIATITQKLVKD 123
             +AKAL+DK NY+VI  DW+ AACTNE  GLK AYYP AASNTRLVG YIAT+T+ LV+ 
Sbjct  64   VMAKALLDKGNYLVILTDWRMAACTNEIAGLKLAYYPYAASNTRLVGNYIATVTKMLVQK 123
Query  124  YKISMANIRLIGHSLGAHVSGFAGKRVQELKLGKYSEIIGLDPARPSFDSNHCSERLCET 183
            Y + MANIRLIGHSLGAH+SGFAGK+VQEL LGKY EIIGLDPA PSF SN CS+R+CET
Sbjct  124  YNVPMANIRLIGHSLGAHISGFAGKKVQELGLGKYPEIIGLDPAGPSFKSNDCSQRICET 183
Query  184  DAEYVQIIHTSNYLGTEKILGTVDFYMNNGKNNPGCGR-FFSEVCSHTRAVIYMAECIKH 242
            DA YVQIIHTSN LGTE+ LGTVDFYMNNG N PGCG     E CSHTRAV Y  ECIKH
Sbjct  184  DANYVQIIHTSNRLGTERTLGTVDFYMNNGYNQPGCGLPIIGETCSHTRAVKYFTECIKH 243
Query  243  ECCLIGIPRSKSSQPISRCTKQECVCVGLNAKKYPSRGSFYVPVESTAPFCNNKGKII 300
            ECCLIG+P+SK+ QP+S+CT+ ECVCVGLNAK YP  GSFYVPVES AP+CNNKGKII
Sbjct  244  ECCLIGVPKSKNPQPVSKCTRNECVCVGLNAKTYPKTGSFYVPVESKAPYCNNKGKII 301

Sequence Alignment: 4. Allergen Name: Dol m 1.0101 Sequence ID: Q06478

 Score = 345.0 bits 1485,  Expect = 2e-96
 Identities = 204/297 68%, Positives = 244/297 82%, Gaps = 0/297 0%
Query  4    CPFNSDTVSIIIETRENRNRDLYTLQTLQNHPEFKKKTITRPVVFITHGFTSSASEKNFI 63
            CPF++DTV +I  TRENR  D+YTL T+  H EFKK  I RPVVFITHGFTSSA+EKNF+
Sbjct  21   CPFSNDTVKMIFLTRENRKHDFYTLDTMNRHNEFKKSIIKRPVVFITHGFTSSATEKNFV 80
Query  64   NLAKALVDKDNYMVISIDWQTAACTNEYPGLKYAYYPTAASNTRLVGQYIATITQKLVKD 123
             +++AL+   ++++I +DW+ AACT+EYPGLKY +Y  A  NTRLVG +IA I +KLV+ 
Sbjct  81   AMSEALMHTGDFLIIMVDWRMAACTDEYPGLKYMFYKAAVGNTRLVGNFIAMIAKKLVEQ 140
Query  124  YKISMANIRLIGHSLGAHVSGFAGKRVQELKLGKYSEIIGLDPARPSFDSNHCSERLCET 183
            YK+ M NIRL+GHSLGAH+SGFAGKRVQELKLGK+SEIIGLDPA PSF  N CSER+CET
Sbjct  141  YKVPMTNIRLVGHSLGAHISGFAGKRVQELKLGKFSEIIGLDPAGPSFKKNDCSERICET 200
Query  184  DAEYVQIIHTSNYLGTEKILGTVDFYMNNGKNNPGCGRFFSEVCSHTRAVIYMAECIKHE 243
            DA YVQI+HTS+ LGTE+ LGTVDFY+NNG N PGC     E CSHTRAV Y  ECI+ E
Sbjct  201  DAHYVQILHTSSNLGTERTLGTVDFYINNGSNQPGCRYIIGETCSHTRAVKYFTECIRRE 260
Query  244  CCLIGIPRSKSSQPISRCTKQECVCVGLNAKKYPSRGSFYVPVESTAPFCNNKGKII 300
            CCLIG+P+SK+ QP+S+CT+ ECVCVGLNAKKYP RGSFYVPVE+ AP+CNN GKII
Sbjct  261  CCLIGVPQSKNPQPVSKCTRNECVCVGLNAKKYPKRGSFYVPVEAEAPYCNNNGKII 317

Sequence Alignment: 5. Allergen Name: Ves s 1.0101 Sequence ID: 3989146

 Score = 333.6 bits 1435,  Expect = 5e-93
 Identities = 213/297 71%, Positives = 248/297 83%, Gaps = 4/297 1%
Query  1    GPKCPFNSDTVSIIIETRENRNRDLYTLQTLQNHPEFKKKTITRPVVFITHGFTSSASEK 60
            G KCPF+ DTV+++I TRENRNRD+YTLQTL+NH EFKKK ITRPVVFITHGFTSSA+ +
Sbjct  1    GSKCPFSDDTVAMVIVTRENRNRDFYTLQTLRNHDEFKKKAITRPVVFITHGFTSSATVE 60
Query  61   NFINLAKALVDKDNYMVISIDWQTAACTNEYPGLKYAYYPTAASNTRLVGQYIATITQKL 120
            +F++L  A+++     V   DW+ AAC N   GL   YY TA SNTRLVG+YIAT+T+KL
Sbjct  61   SFVDLQTAILEXXXXKVTVSDWRVAAC-NRTTGL--LYYVTAVSNTRLVGRYIATVTKKL 117
Query  121  VKDYKISMANIRLIGHSLGAHVSGFAGKRVQELKLGKYSEIIGLDPARPSFDSNHCSERL 180
            V DY +SMA+IRLIGHSLGAHVSGFAGK VQ+LKL KYSEIIGLDPA PSF+SN C+ERL
Sbjct  118  VTDYNVSMADIRLIGHSLGAHVSGFAGKEVQKLKLEKYSEIIGLDPAGPSFESNDCAERL 177
Query  181  CETDAEYVQIIHTSNYLGTEKILGTVDFYMNNGKNNPGCGRF-FSEVCSHTRAVIYMAEC 239
            C+TDA YVQIIHTS  +G EK +G VDFY+N G N PGCG   + +VCSH+RA+ YM EC
Sbjct  178  CKTDAHYVQIIHTSKKFGIEKSIGHVDFYVNQGNNQPGCGIIPLKDVCSHSRAITYMTEC 237
Query  240  IKHECCLIGIPRSKSSQPISRCTKQECVCVGLNAKKYPSRGSFYVPVESTAPFCNNKGKI 299
            IK ECCLIGIP+SKSS+ IS CT+QECVCVGL AK YP+ GSFYVPVESTAPFCNNKGKI
Sbjct  238  IKRECCLIGIPQSKSSKSISSCTRQECVCVGLKAKSYPNTGSFYVPVESTAPFCNNKGKI 297
Query  300  I 300
            I
Sbjct  298  I 298

Sequence Alignment: 6. Allergen Name: Poly p 1.0101 Sequence ID: ABN13879

 Score = 310.4 bits 1333,  Expect = 6e-86
 Identities = 192/296 64%, Positives = 229/296 77%, Gaps = 3/296 1%
Query  2    PKCPFNSDTVSIIIETRENRNRDLYTLQTLQNHPEFKKKTITRPVVFITHGFTSSASEKN 61
            P+CPFN   +   + TR+ R+  + T +TLQN+  FKK TI+R VVFI HGF S+ + +N
Sbjct  21   PECPFNEYDILFFVYTRQQRDGIVLTEETLQNYDLFKKSTISRQVVFIDHGFLSNGNNEN 80
Query  62   FINLAKALVDKDNYMVISIDWQTAACTNEYPGLKYAYYPTAASNTRLVGQYIATITQKLV 121
            FI +AKAL++KDN++VIS+DW+  AC      L Y  Y TA  NTR VG+Y+A  T+ LV
Sbjct  81   FIAMAKALIEKDNFLVISVDWKKGACNAFASTLDYLGYSTAVGNTRHVGKYVADFTKLLV 140
Query  122  KDYKISMANIRLIGHSLGAHVSGFAGKRVQELKLGKYSEIIGLDPARPSFDSNHCSERLC 181
            + YK+SM+NIRLIGHSLGAH SGFAGK VQELKL KYS I GLDPA PSFDSN C ERLC
Sbjct  141  EQYKVSMSNIRLIGHSLGAHTSGFAGKEVQELKLNKYSNIDGLDPAGPSFDSNDCPERLC 200
Query  182  ETDAEYVQIIHTSNYLGTEKILGTVDFYMNNGKNNPGCGRFFSEVCSHTRAVIYMAECIK 241
            ETDAEYVQIIHTSN LG    +GTVDFYMN G + PGCGRFFS  CSHT+AV Y+ ECIK
Sbjct  201  ETDAEYVQIIHTSNILGVYSKIGTVDFYMNYGSHQPGCGRFFSPSCSHTKAVKYLTECIK 260
Query  242  HECCLIGIPRSK---SSQPISRCTKQECVCVGLNAKKYPSRGSFYVPVESTAPFCNNKG 297
            HECCLIG P  K   + +PIS+CTK  CVCVGLNAK YP+RGSFYVPVE+TAP+C+N+G
Sbjct  261  HECCLIGTPWKKYFSTPKPISQCTKDTCVCVGLNAKSYPARGSFYVPVEATAPYCHNEG 319

Sequence Alignment: 7. Allergen Name: Vesp v 1.0101 Sequence ID: C0HLL3

 Score = 305.4 bits 1311,  Expect = 2e-84
 Identities = 187/299 62%, Positives = 234/299 78%, Gaps = 2/299 0%
Query  2    PKCPFNSDTVSIIIETRENRNRDLYTLQTLQNHPEFKKKTITRP-VVFITHGFTSSASEK 60
            PKC +  + +S I+ TRENRN  + TL +L+    + K  ++   VVF+ HGF SSA+  
Sbjct  4    PKCKLVPEQISFILSTRENRNGVFLTLDSLKKGGILNKSDLSSTQVVFLIHGFISSANNS 63
Query  61   NFINLAKALVDKDNYMVISIDWQTAACTNEYPGLKYAYYPTAASNTRLVGQYIATITQKL 120
            N++++ KAL++K++ MVISIDW+  ACTNE+  LK+  YP A  NTR VG+YIA  ++ L
Sbjct  64   NYMDMTKALLEKNDCMVISIDWRNGACTNEFQILKFIGYPKAVENTRTVGKYIADFSKLL 123
Query  121  VKDYKISMANIRLIGHSLGAHVSGFAGKRVQELKLGKYSEIIGLDPARPSFDSNHCSERL 180
            ++ YK+S+ANIRLIGHSLGA+++GFAGK  Q++KLGKY EIIGLDPA P F SN CS+R+
Sbjct  124  MQKYKVSLANIRLIGHSLGAQIAGFAGKEYQKFKLGKYPEIIGLDPAGPLFKSNDCSQRI 183
Query  181  CETDAEYVQIIHTSNYLGTEKILGTVDFYMNNGKNNPGCGR-FFSEVCSHTRAVIYMAEC 239
            CETDA YVQIIHTSN LGTE+ LGTVDFYMNNG N PGC   F  E CSHTRAV Y  EC
Sbjct  184  CETDAHYVQIIHTSNNLGTERTLGTVDFYMNNGYNQPGCYYSFIGETCSHTRAVQYFTEC 243
Query  240  IKHECCLIGIPRSKSSQPISRCTKQECVCVGLNAKKYPSRGSFYVPVESTAPFCNNKGKI 299
            I+HECCLIG+P+SK+ QP+S+CT+ ECVCVGLNAK+YP  GSFYVPVES AP+CNNKGK 
Sbjct  244  IRHECCLIGVPQSKNPQPVSKCTRNECVCVGLNAKRYPKTGSFYVPVESKAPYCNNKGKK 303
Query  300  I 300
            I
Sbjct  304  I 304

Sequence Alignment: 8. Allergen Name: Dol m 1.02 Sequence ID: P53357

 Score = 301.0 bits 1292,  Expect = 4e-83
 Identities = 178/299 59%, Positives = 229/299 76%, Gaps = 1/299 0%
Query  2    PKCPFNSDTVSIIIETRENRNRDLYTLQTLQNHPEFKKKTIT-RPVVFITHGFTSSASEK 60
            P+C +  + +S ++ TRENR+    TLQ L+N   FK   ++ + V F+ HGF SSA+ K
Sbjct  4    PECKLVPEEISFVLSTRENRDGVYLTLQKLKNGKMFKNSDLSSKKVPFLIHGFISSATNK 63
Query  61   NFINLAKALVDKDNYMVISIDWQTAACTNEYPGLKYAYYPTAASNTRLVGQYIATITQKL 120
            N+ ++ +AL+DKD+ MVISIDW+  AC+NE+  LK+  YP A  NTR VG+YIA  ++ L
Sbjct  64   NYADMTRALLDKDDIMVISIDWRDGACSNEFALLKFIGYPKAVENTRAVGKYIADFSKIL 123
Query  121  VKDYKISMANIRLIGHSLGAHVSGFAGKRVQELKLGKYSEIIGLDPARPSFDSNHCSERL 180
            ++ YK+ + NIRLIGHSLGA+++GFAGK  Q +KLGKY EIIGLDPA PSF    C ER+
Sbjct  124  IQKYKVLLENIRLIGHSLGAQIAGFAGKEFQRFKLGKYPEIIGLDPAGPSFKKKDCPERI 183
Query  181  CETDAEYVQIIHTSNYLGTEKILGTVDFYMNNGKNNPGCGRFFSEVCSHTRAVIYMAECI 240
            CETDA YVQI+HTS+ LGTE+ LGTVDFY+N+G N PGC     E CSHTRAV Y+ ECI
Sbjct  184  CETDAHYVQILHTSSNLGTERTLGTVDFYINDGSNQPGCTYIIGETCSHTRAVKYLTECI 243
Query  241  KHECCLIGIPRSKSSQPISRCTKQECVCVGLNAKKYPSRGSFYVPVESTAPFCNNKGKII 300
            + ECCLIG+P+SK+ QP+S+CT+ ECVCVGLNAK+YP +GSFYVPVE+ APFCNN GKII
Sbjct  244  RRECCLIGVPQSKNPQPVSKCTRNECVCVGLNAKEYPKKGSFYVPVEAKAPFCNNNGKII 303

Sequence Alignment: 9. Allergen Name: Pol a 1 Sequence ID: Q9U6W0

 Score = 264.8 bits 1133,  Expect = 3e-72
 Identities = 162/292 55%, Positives = 213/292 72%, Gaps = 8/292 2%
Query  2    PKCPFNSDTVSIIIETRENRNRDLYTLQTLQNHPEFKKKTITRPVVFITHGFTSSASEKN 61
            P C FN   +   + +R+ R+  +   +TL N+  F K TI++ VVF+ HGF S+ + +N
Sbjct  3    PDCTFNEKDIVFYVYSRDKRDGIILKKETLTNYDLFTKSTISKQVVFLIHGFLSTGNNEN 62
Query  62   FINLAKALVDKDNYMVISIDWQTAACTNEYPGLKYAY-YPTAASNTRLVGQYIATITQKL 120
            F+ ++KAL++KD+++VIS+DW+  AC N +   K A  Y  A  NTR VG+++A  T+ L
Sbjct  63   FVAMSKALIEKDDFLVISVDWKKGAC-NAFASTKDALGYSKAVGNTRHVGKFVADFTKLL 121
Query  121  VKDYKISMANIRLIGHSLGAHVSGFAGKRVQELKLGKYSEIIGLDPARPSFDSNHCSERL 180
            V+ YK+ ++NIRLIGHSLGAH SGFAGK VQ+LKLGKY EIIGLDPA P F  + C +RL
Sbjct  122  VEKYKVLISNIRLIGHSLGAHTSGFAGKEVQKLKLGKYKEIIGLDPAGPYFHRSDCPDRL 181
Query  181  CETDAEYVQIIHTSNYLGTEKILGTVDFYMNNGKNNPGCGRFFSEVCSHTRAVIYMAECI 240
            C TDAEYVQ+IHTS  LG    +G+VDFY+N GKN PGC       CSHT+AV Y+ ECI
Sbjct  182  CVTDAEYVQVIHTSIILGVYYNVGSVDFYVNYGKNQPGCNE---PSCSHTKAVKYLTECI 238
Query  241  KHECCLIGIPRSK---SSQPISRCTKQECVCVGLNAKKYPSRGSFYVPVESTAPFCNNKG 297
            KHECCLIG P  K   + +PIS+C    CVCVGLNAK YP+RG+FY PVE+ AP+C+N+G
Sbjct  239  KHECCLIGTPWKKYFSTPKPISQCRGDTCVCVGLNAKSYPARGAFYAPVEANAPYCHNEG 298

Sequence Alignment: 10. Allergen Name: Pol d 1.0102 Sequence ID: AAS67042

 Score = 259.1 bits 1108,  Expect = 2e-70
 Identities = 160/292 54%, Positives = 208/292 71%, Gaps = 8/292 2%
Query  2    PKCPFNSDTVSIIIETRENRNRDLYTLQTLQNHPEFKKKTITRPVVFITHGFTSSASEKN 61
            P C FN   + + + +R+ RN  +   + L+N+  F+K  I+  +  + HGF S+ + +N
Sbjct  18   PDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISHQIAILIHGFLSTGNNEN 77
Query  62   FINLAKALVDKDNYMVISIDWQTAACTNEYPGLKYAY-YPTAASNTRLVGQYIATITQKL 120
            F  +AKAL++ DN++VIS+DW+  AC N +        Y  A  NTR VG+Y+A  T+ L
Sbjct  78   FDAMAKALIEIDNFLVISVDWKKGAC-NAFASTNDVLGYSQAVGNTRHVGKYVADFTKLL 136
Query  121  VKDYKISMANIRLIGHSLGAHVSGFAGKRVQELKLGKYSEIIGLDPARPSFDSNHCSERL 180
            V+ YK+ M+NIRLIGHSLGAH SGFAGK VQ LKLGKY EIIGLDPA PSF +N C  RL
Sbjct  137  VEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGLDPAGPSFLTNKCPNRL 196
Query  181  CETDAEYVQIIHTSNYLGTEKILGTVDFYMNNGKNNPGCGRFFSEVCSHTRAVIYMAECI 240
            CETDAEYVQ IHTS  LG    +G+VDFY+N GK+ PGC       CSHT+AV Y+ ECI
Sbjct  197  CETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSE---PSCSHTKAVKYLTECI 253
Query  241  KHECCLIGIP-RS--KSSQPISRCTKQECVCVGLNAKKYPSRGSFYVPVESTAPFCNNKG 297
            K ECCLIG P +S   + +PIS+C +  CVCVGLNA+ YP++GSFYVPVE  AP+C+N+G
Sbjct  254  KRECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYVPVEKDAPYCHNEG 313

Sequence Alignment: 11. Allergen Name: Pol d 1.0101 Sequence ID: AAS67041

 Score = 258.2 bits 1104,  Expect = 3e-70
 Identities = 159/292 54%, Positives = 208/292 71%, Gaps = 8/292 2%
Query  2    PKCPFNSDTVSIIIETRENRNRDLYTLQTLQNHPEFKKKTITRPVVFITHGFTSSASEKN 61
            P C FN   + + + +R+ RN  +   + L+N+  F+K  I+  +  + HGF S+ + +N
Sbjct  39   PDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISHQIAILIHGFLSTGNNEN 98
Query  62   FINLAKALVDKDNYMVISIDWQTAACTNEYPGLKYAY-YPTAASNTRLVGQYIATITQKL 120
            F  +AKAL++ DN++VIS+DW+  AC N +        Y  A  NTR VG+Y+A  T+ L
Sbjct  99   FDAMAKALIEIDNFLVISVDWKKGAC-NAFASTNDVLGYSQAVGNTRHVGKYVADFTKLL 157
Query  121  VKDYKISMANIRLIGHSLGAHVSGFAGKRVQELKLGKYSEIIGLDPARPSFDSNHCSERL 180
            V+ YK+ M+NIRLIGHSLGAH SGFAGK VQ LKLGKY EIIGLDPA PSF +N C  RL
Sbjct  158  VEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGLDPAGPSFLTNKCPNRL 217
Query  181  CETDAEYVQIIHTSNYLGTEKILGTVDFYMNNGKNNPGCGRFFSEVCSHTRAVIYMAECI 240
            CETDAEYVQ IHTS  LG    +G+VDFY+N GK+ PGC       CSHT+AV Y+ ECI
Sbjct  218  CETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSE---PSCSHTKAVKYLTECI 274
Query  241  KHECCLIGIP-RS--KSSQPISRCTKQECVCVGLNAKKYPSRGSFYVPVESTAPFCNNKG 297
            K ECCLIG P +S   + +PIS+C +  CVCVGLNA+ YP++GSFYVPV+  AP+C+N+G
Sbjct  275  KRECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYVPVDKDAPYCHNEG 334

Sequence Alignment: 12. Allergen Name: Pol d 1.0104 Sequence ID: AAS67044

 Score = 257.3 bits 1100,  Expect = 6e-70
 Identities = 160/292 54%, Positives = 208/292 71%, Gaps = 8/292 2%
Query  2    PKCPFNSDTVSIIIETRENRNRDLYTLQTLQNHPEFKKKTITRPVVFITHGFTSSASEKN 61
            P C FN   + + + +R+ RN  +   + L+N+  F+K  I+  +  + HGF S+ + +N
Sbjct  18   PDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISHQIAILIHGFLSTGNNEN 77
Query  62   FINLAKALVDKDNYMVISIDWQTAACTNEYPGLKYAY-YPTAASNTRLVGQYIATITQKL 120
            F  +AKAL++ DN++VIS+DW+  AC N +        Y  A  NTR VG+Y+A  T+ L
Sbjct  78   FDAMAKALIEIDNFLVISVDWKKGAC-NAFASTNDVLGYSQAVGNTRHVGKYVADFTKLL 136
Query  121  VKDYKISMANIRLIGHSLGAHVSGFAGKRVQELKLGKYSEIIGLDPARPSFDSNHCSERL 180
            V+ YK+ M+NIRLIGHSLGAH SGFAGK VQ LKLGKY EIIGLDPA PSF ++ C +RL
Sbjct  137  VEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGLDPAGPSFLTSKCPDRL 196
Query  181  CETDAEYVQIIHTSNYLGTEKILGTVDFYMNNGKNNPGCGRFFSEVCSHTRAVIYMAECI 240
            CETDAEYVQ IHTS  LG    +G+VDFY+N GK+ PGC       CSHT+AV Y+ ECI
Sbjct  197  CETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSE---PSCSHTKAVKYLTECI 253
Query  241  KHECCLIGIP-RSKSSQP--ISRCTKQECVCVGLNAKKYPSRGSFYVPVESTAPFCNNKG 297
            K ECCLIG P +S  S P  IS+C +  CVCVGLNA+ YP++GSFYVPVE  AP+C+N+G
Sbjct  254  KRECCLIGTPWKSYFSTPKSISQCKRDTCVCVGLNAQSYPAKGSFYVPVEKDAPYCHNEG 313

Sequence Alignment: 13. Allergen Name: Pol d 1.0103 Sequence ID: AAS67043

 Score = 257.3 bits 1100,  Expect = 6e-70
 Identities = 158/292 54%, Positives = 209/292 71%, Gaps = 8/292 2%
Query  2    PKCPFNSDTVSIIIETRENRNRDLYTLQTLQNHPEFKKKTITRPVVFITHGFTSSASEKN 61
            P C FN   + + + +R+ RN  +   + L+N+  F+K  I+  +  + HGF S+ + +N
Sbjct  18   PDCTFNEKDIELHVYSRDKRNGIILKKEILKNYDLFQKSQISHQIAILIHGFLSTGNNEN 77
Query  62   FINLAKALVDKDNYMVISIDWQTAACTNEYPGLKYAY-YPTAASNTRLVGQYIATITQKL 120
            F  +AKAL++ DN++VIS+DW+  AC N +        Y  A  NTR VG+Y+A  T+ L
Sbjct  78   FDAMAKALIEIDNFLVISVDWKKGAC-NAFASTNDVLGYSQAVGNTRHVGKYVADFTKLL 136
Query  121  VKDYKISMANIRLIGHSLGAHVSGFAGKRVQELKLGKYSEIIGLDPARPSFDSNHCSERL 180
            V+ YK+ M+NIRLIGHSLGAH SGFAGK VQ LKLGKY EIIGLDPA PSF ++ C +RL
Sbjct  137  VEQYKVPMSNIRLIGHSLGAHTSGFAGKEVQRLKLGKYKEIIGLDPAGPSFLTSKCPDRL 196
Query  181  CETDAEYVQIIHTSNYLGTEKILGTVDFYMNNGKNNPGCGRFFSEVCSHTRAVIYMAECI 240
            CETDAEYVQ IHTS  LG    +G+VDFY+N GK+ PGC       CSHT+AV Y+ ECI
Sbjct  197  CETDAEYVQAIHTSAILGVYYNVGSVDFYVNYGKSQPGCSE---PSCSHTKAVKYLTECI 253
Query  241  KHECCLIGIP-RS--KSSQPISRCTKQECVCVGLNAKKYPSRGSFYVPVESTAPFCNNKG 297
            K ECCLIG P +S   + +PIS+C +  CVCVGLNA+ YP++GSFYVPV+  AP+C+N+G
Sbjct  254  KRECCLIGTPWKSYFSTPKPISQCKRDTCVCVGLNAQSYPAKGSFYVPVDKDAPYCHNEG 313

Sequence Alignment: 14. Allergen Name: Pol e 1.0101 Sequence ID: 3989146

 Score = 211.5 bits 899,  Expect = 3e-56
 Identities = 133/292 45%, Positives = 184/292 63%, Gaps = 8/292 2%
Query  2    PKCPFNSDTVSIIIETRENRNRDLYTLQTLQNHPEFKKK-TITRPVVFITHGFTSSASEK 60
            P C FN   +   + +R+ R+  +    +L N+  F K  T+++ VVF+ HGF +S    
Sbjct  4    PDCTFNEKDIVFYVYSRDKRDGIILKKDSLTNYDLFTKSITVSKQVVFLIHGFLTSXXXX 63
Query  61   NFINLAKALVDKDNYMVISIDWQTAACTNEYPGLKYAYYPTAASNTRLVGQYIATITQKL 120
               +L+ AL++ D+++V+S+DW+               Y   AS    +G Y+A  T+  
Sbjct  64   XXXSLSGALIEGDDFLVMSVDWKKXXXXXXXXXXGALGYSKXASIKDALGTYVADFTKLK 123
Query  121  VKDYKISMANIRLIGHSLGAHVSGFAGKRVQELKLGKYSEIIGLDPARPSFDSNHCSERL 180
            +  YK+     R IGHSLGAH SGFAGK VQ+LKLGKY EIIGLDPA PSF ++ C +RL
Sbjct  124  LGKYKVLRXXXRGIGHSLGAHTSGFAGKEVQKLKLGKYKEIIGLDPAGPSFLTSKCPDRL 183
Query  181  CETDAEYVQIIHTSNYLGTEKILGTVDFYMNNGKNNPGCGRFFSEVCSHTRAVIYMAECI 240
            CE+  +Y QI+HTS   G    +G+VDFY+N GK+ PGC       C   +A  Y+ ECI
Sbjct  184  CESGTDYTQILHTSXXXGVYYNVGSVDFYVNYGKSQPGCNE---PSCXXXKATKYLTECI 240
Query  241  KHECCLIGIPRSK---SSQPISRCTKQECVCVGLNAKKYPSRGSFYVPVESTAPFCNNKG 297
            K ECCLI  P  K   + +PIS+C +  CVCVGLNAK YP+RG+FY PVE+ AP+C+N+G
Sbjct  241  KEECCLISTPWFKYFSTPKPISQC-RDTCVCVGLNAKSYPARGAFYAPVEANAPYCHNEG 299

Sequence Alignment: 15. Allergen Name: Sol i 1.0101 Sequence ID: AAT95008

 Score = 142.1 bits 595,  Expect = 3e-35
 Identities = 105/282 37%, Positives = 161/282 57%, Gaps = 12/282 4%
Query  4    CPF-NSDTVSIIIETRENRNRDLYTLQTLQNHPEFKKKTITRPVVFITHGFTSSASEKNF 62
            C + NS  +++ +     + ++L   Q+ Q+         + PVVFITHGFTSSA    F
Sbjct  40   CVYGNSSYINVYLYNSRFQGKNLGNQQSCQD------INASLPVVFITHGFTSSAQVSTF 93
Query  63   INLAKALVDKDNYMVISIDWQTAACTNEYPGLKYAYYPTAASNTRLVGQYIATITQKLVK 122
             +LA A+V K +   I +DW  AACT+  PG+++A Y  AASNT  +GQ +A  T  L+ 
Sbjct  94   KDLANAFVQKGHTAFI-VDWSEAACTDGLPGVQFAEYNAAASNTYDIGQLMAKYTVDLMN 152
Query  123  DYKISMANIRLIGHSLGAHVSGFAGKRVQELKLGKYSEIIGLDPARPSFDSNHCSERLCE 182
              KI + NI+ +GHSLG+HV GFA K V++L       I+ LDPA PSF SN C ER+C+
Sbjct  153  KCKIPLNNIQYVGHSLGSHVCGFAAKHVKKLINKTMPYILALDPADPSFGSNKCGERICK 212
Query  183  TDAEYVQIIHTSNYLGT-EKILGTVDFYMNNGKNNPGCGRFFSEVCSHTRAVIYMAECIK 241
            +DA+ + +  TS  LG  E I+G +    + GK+ P C  ++   CSH+ +++Y    + 
Sbjct  213  SDAKRIVVFKTS-ILGIGENIIGHLLIVFDGGKSQPACS-WYDVPCSHSESIVYATGMVS 270
Query  242  HECCLIGIPRSKSSQPISRCTKQECVCVGLNAKKYPSRGSFYVPVESTAPFCNN 295
              C  + +P + + Q I+    +       N   YP+  +    V +T  F N+
Sbjct  271  GRCQHLAVPWT-AQQRINPIQWKFWRVFTSNIPAYPTSDTTNCVVLNTNVFKND 323

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.