The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE
DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY
HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP
Sequence Info Allergen Name Length Opt Bits Score E Value
P25985 Pha v 1 155 989 242.6 3.6e-66
CAA43637 Pha v 1 156 989 242.6 3.6e-66
CAA43636 Pha v 1 155 890 219.0 4.5e-59
Q2VU97 Vig r 1.0101 155 860 211.9 6.4e-57
CAA42646 Gly m 4 158 805 198.8 5.8e-53
AAQ91847 Ara h 8.0101 157 722 179.0 5.2e-47
AAD48405 Cor a 1.0401 161 554 138.9 6e-35
AAG40331 Cor a 1.0404 161 554 138.9 6e-35
AAG40329 Cor a 1.0402 161 546 137.0 2.3e-34
EF436550 Ara h 8.0201 153 543 136.4 3.5e-34
AAG40330 Cor a 1.0403 161 543 136.3 3.7e-34
ACJ23864 Fag s 1.0101 160 541 135.9 5.1e-34
CAA54696.1 Bet v 1.0301 160 541 135.9 5.1e-34
APD76154 Jug r 5.0101 160 534 134.2 1.6e-33
O50001 Pru ar 1 160 513 129.2 5.2e-32
CAD10374 Cas s 1 160 512 128.9 6.2e-32
O24248 Pru av 1 160 509 128.2 1e-31
Q2I6V8 Pru p 1.0101 160 508 128.0 1.2e-31
B6CQS9 Pru du 1.0101 160 506 127.5 1.7e-31
CAA96549 Cor a 1.0301 160 496 125.1 8.7e-31
Q256S2 Fra a 1 160 494 124.7 1.2e-30
Q256S7 Fra a 1 160 492 124.2 1.7e-30
AAB01362 Mal d 1.0201 159 491 123.9 2e-30
AAD26548 Mal d 1.0204 159 491 123.9 2e-30
AAD26545 Mal d 1.0202 159 491 123.9 2e-30
Q3T923 Fra a 1 160 490 123.7 2.3e-30
AAD26555 Mal d 1.0107 159 489 123.5 2.7e-30
AAD13683 Mal d 1.0206 159 486 122.8 4.5e-30
AAD26547 Mal d 1.0203 159 485 122.5 5.3e-30
AAK13030 Mal d 1.0207 159 485 122.5 5.3e-30
ABZ81046 Que a 1.0301 160 485 122.5 5.3e-30
CAD32318 Mal d 1.0208 158 483 122.0 7.3e-30
AAD26546 Mal d 1.0103 159 483 122.0 7.3e-30
AAD26558 Mal d 1.0205 159 483 122.0 7.3e-30
Q256S6 Fra a 1 160 483 122.0 7.4e-30
ABZ81047 Que a 1.0401 160 483 122.0 7.4e-30
AAD29671 Mal d 1.0108 159 481 121.6 1e-29
CAA04828.1 Bet v 1.0206 159 480 121.3 1.2e-29
AAD26552 Mal d 1.0104 159 479 121.1 1.4e-29
Q39427 Bet v 1.0205 160 479 121.1 1.4e-29
O65200 Pyr c 1 159 477 120.6 2e-29
CAA58646 Mal d 1.0101 159 476 120.4 2.3e-29
P43186 Bet v 1.0204 160 476 120.4 2.4e-29
CAA54481 Bet v 1.0202 160 476 120.4 2.4e-29
AAD26554 Mal d 1.0106 159 475 120.1 2.8e-29
AAD26553 Mal d 1.0105 159 475 120.1 2.8e-29
P43184 Bet v 1.0203 160 475 120.1 2.8e-29
CAA96535 Mal d 1.0401 160 475 120.1 2.8e-29
CAA88833 Mal d 1.0102 159 474 119.9 3.2e-29
CAA54421 Bet v 1.0201 160 474 119.9 3.3e-29
AAO25113 Mal d 1.0304 159 471 119.2 5.3e-29
Q256S4 Fra a 1 159 471 119.2 5.3e-29
AAK13029 Mal d 1.0109 159 470 118.9 6.3e-29
AUH28179 Que m 1.0101 160 469 118.7 7.5e-29
CAA96548 Cor a 1.0201 160 469 118.7 7.5e-29
CAA04827.1 Bet v 1.0116 159 466 118.0 1.2e-28
CAB02159 Bet v 1.0112 160 465 117.7 1.4e-28
CAA54487 Bet v 1.0106 160 465 117.7 1.4e-28
CAA33887 Bet v 1.0101 160 465 117.7 1.4e-28
CAB02161 Bet v 1.0114 160 464 117.5 1.7e-28
CAA54483 Bet v 1.0103 160 464 117.5 1.7e-28
CAB02156 Bet v 1.0109 160 464 117.5 1.7e-28
AFN42528 Can s 5.0101 161 463 117.3 2e-28
ABZ81045 Que a 1.0201 159 462 117.0 2.4e-28
CAA54484 Bet v 1.0104 160 462 117.0 2.4e-28
CAA96536 Mal d 1.0402 160 462 117.0 2.4e-28
AAK13027 Mal d 1.0302 159 460 116.6 3.3e-28
QOL10866 Que ac 1.0101 159 460 116.6 3.3e-28
NP_001275580 Sola l 4.0201 160 460 116.6 3.3e-28
CAA07329.1 Bet v 1.0118 160 458 116.1 4.6e-28
CAA96537 Mal d 1.0403 160 458 116.1 4.6e-28
AAK13028 Mal d 1.0303 159 457 115.8 5.4e-28
CAB02160 Bet v 1.0113 160 457 115.8 5.4e-28
CAA96534 Mal d 1.0301 159 453 114.9 1e-27
CAB02217 Car b 1.0302 161 453 114.9 1.1e-27
CAA07323.1 Bet v 1.0117 160 452 114.6 1.2e-27
ACF75030.1 Bet v 1.0207 150 451 114.4 1.3e-27
CAB02155 Bet v 1.0108 160 451 114.4 1.5e-27
P38948 Aln g 1 159 450 114.2 1.7e-27
AAB24432 Aln g 1 160 450 114.2 1.7e-27
CAB02216 Car b 1.0301 161 449 113.9 2.1e-27
P38950 Car b 1 159 448 113.7 2.4e-27
CAA96547 Bet v 1.0115 160 448 113.7 2.4e-27
CAB02207 Car b 1.0104 160 448 113.7 2.4e-27
ABZ81044 Car b 1.0113 160 447 113.5 2.8e-27
ABZ81043 Car b 1.0112 160 447 113.5 2.8e-27
ABZ81041 Car b 1.0110 160 446 113.2 3.3e-27
CAB02157 Bet v 1.0110 160 446 113.2 3.3e-27
CAA50325 Cor a 1.0103 160 446 113.2 3.3e-27
ABZ81040 Car b 1.0109 160 445 113.0 3.9e-27
CAB02209 Car b 1.0106 160 444 112.7 4.6e-27
CAB02213 Car b 1.0107 160 443 112.5 5.5e-27
CAB02158 Bet v 1.0111 160 443 112.5 5.5e-27
CAB02206 Car b 1.0103 160 442 112.3 6.5e-27
ABZ81042 Car b 1.0111 160 442 112.3 6.5e-27
CAM31908 Act c 8.0101 159 441 112.0 7.6e-27
ADK39021 Ost c 1.0101 160 440 111.8 9e-27
QGS84240 Que i 1.0101 159 439 111.6 1.1e-26
Q08407 Cor a 1 159 439 111.6 1.1e-26
CAB02208 Car b 1.0105 160 439 111.6 1.1e-26
CAA50327 Cor a 1.0101 160 439 111.6 1.1e-26
CAA50328 Cor a 1.0102 160 437 111.1 1.5e-26
CAA47357 Car b 1.0102 159 436 110.8 1.7e-26
CAA54482 Bet v 1.0102 160 435 110.6 2.1e-26
CAA54485 Bet v 1.0105 160 434 110.4 2.4e-26
CAB02215 Car b 1.0108 160 433 110.1 2.9e-26
CAA54489 Bet v 1.0107 160 430 109.4 4.7e-26
CAA50326 Cor a 1.0104 160 427 108.7 7.7e-26
ABC41615.1 Bet v 1.0119 150 425 108.2 9.8e-26
AHC08073 Sola l 4.0101 160 425 108.2 1.1e-25
P38949 Car b 1 159 424 108.0 1.3e-25
CAM31909 Act d 8.0101 157 404 103.2 3.4e-24
Q0Z8U9 Rub i 1.0101 137 378 97.1 2e-22
AAL76932 Dau c 1.0201 154 369 94.9 1.1e-21
CAA75803 Lyc e 4.0101 178 370 95.1 1.1e-21
P92918 Api g 1.0201 159 354 91.3 1.3e-20
P49372 Api g 1 154 339 87.7 1.5e-19
AAB92255 Tar o RAP 157 329 85.4 8e-19
CAA67246 Pet c PR10 155 317 82.5 5.7e-18
BAA13604 Dau c 1.0102 154 314 81.8 9.3e-18
AAB01092 Dau c 1.0101 168 312 81.3 1.5e-17
CAB06416 Dau c 1.0105 154 308 80.4 2.5e-17
CAB03715 Dau c 1.0103 154 301 78.7 8e-17
CAB03716 Dau c 1.0104 154 298 78.0 1.3e-16
Q5ULZ4 Fra a 1.0101 100 211 57.5 1.3e-10
P85126 Que a 1.0101 50 195 54.0 6.9e-10
Q9ZWP8 Vig r 6.0101 155 186 51.3 1.4e-08
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 242.6 bits 989,  Expect = 4e-66
 Identities = 155/155 100%, Positives = 155/155 100%, Gaps = 0/155 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE
Sbjct  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
            DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP
Sbjct  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155

Sequence Alignment: 2. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 242.6 bits 989,  Expect = 4e-66
 Identities = 155/155 100%, Positives = 155/155 100%, Gaps = 0/155 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE
Sbjct  2    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
            DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY
Sbjct  62   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP
Sbjct  122  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 156

Sequence Alignment: 3. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 219.0 bits 890,  Expect = 5e-59
 Identities = 138/153 90%, Positives = 146/153 95%, Gaps = 1/153 0%
Query  2    VFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVED 61
            VFTFEDQTTSPVAPATLYKA+ KDADTI PKA+ DSFKSVEIVEGNGGPGTIKKISFVED
Sbjct  3    VFTFEDQTTSPVAPATLYKALVKDADTIVPKAV-DSFKSVEIVEGNGGPGTIKKISFVED 61
Query  62   GETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITYH 121
            GETKFVLHKIE IDEANLGYSYSIVGG ALP+TAEKI+ DSKLSDGPNGGS++KLSI YH
Sbjct  62   GETKFVLHKIEEIDEANLGYSYSIVGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIKYH 121
Query  122  SKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            SKGDAPPNEDELKAGKAKSD+LFK +EAYLLANP
Sbjct  122  SKGDAPPNEDELKAGKAKSDALFKVIEAYLLANP 155

Sequence Alignment: 4. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 211.9 bits 860,  Expect = 6e-57
 Identities = 133/153 86%, Positives = 145/153 94%, Gaps = 1/153 0%
Query  2    VFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVED 61
            VFTF+DQ TSPVAPATLY A+AKDAD I PKA+  SF+SVEIVEGNGGPGTIKKISFVED
Sbjct  3    VFTFDDQATSPVAPATLYNALAKDADNIIPKAV-GSFQSVEIVEGNGGPGTIKKISFVED 61
Query  62   GETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITYH 121
            GETKFVLHKIES+DEANLGYSYSIVGGVALP+TAEKIT D+K+SDG +GGSLIKL+I+YH
Sbjct  62   GETKFVLHKIESVDEANLGYSYSIVGGVALPDTAEKITIDTKISDGADGGSLIKLTISYH 121
Query  122  SKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
             KGDAPPNEDELKAGKAKSD+LFKAVEAYLLANP
Sbjct  122  GKGDAPPNEDELKAGKAKSDALFKAVEAYLLANP 155

Sequence Alignment: 5. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 198.8 bits 805,  Expect = 6e-53
 Identities = 123/154 79%, Positives = 138/154 89%, Gaps = 1/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVFTFED+  SPVAPATLYKA+  DAD + PKAL DSFKSVE VEGNGGPGTIKKI+F+E
Sbjct  2    GVFTFEDEINSPVAPATLYKALVTDADNVIPKAL-DSFKSVENVEGNGGPGTIKKITFLE 60
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
            DGETKFVLHKIESIDEANLGYSYS+VGG ALP+TAEKITFDSKL  GPNGGS  KL++ Y
Sbjct  61   DGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVKY 120
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
             +KGDA PN+DELK GKAK+D+LFKA+EAYLLA+P
Sbjct  121  ETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHP 155

Sequence Alignment: 6. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 179.0 bits 722,  Expect = 5e-47
 Identities = 109/153 71%, Positives = 132/153 86%, Gaps = 2/153 1%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVFTFED+ TS V PA LY A+ KDAD+I PK + D  KSVEIVEGNGGPGTIKK++ VE
Sbjct  2    GVFTFEDEITSTVPPAKLYNAM-KDADSITPKII-DDVKSVEIVEGNGGPGTIKKLTIVE 59
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
            DGETKF+LHK+ESIDEAN  Y+YS+VGGVALP TAEKITF++KL +GPNGGS+ KL++ Y
Sbjct  60   DGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLKY 119
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            H+KGDA P+E+ELK GKAK + LF+A+E Y+LANP
Sbjct  120  HTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANP 154

Sequence Alignment: 7. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 138.9 bits 554,  Expect = 6e-35
 Identities = 84/155 54%, Positives = 113/155 72%, Gaps = 1/155 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +ED+ TS + PA L+K+   DAD + PK  P  F S E +EGNGGPGTIKKI+F E
Sbjct  2    GVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFAE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGG-SLIKLSIT 119
              E K++ HK+E ID AN+ Y YSI+ G  L  T EKI+++ K++  P+GG S++K++  
Sbjct  62   GNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITSK 121
Query  120  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            YH+KG+A  NE+E+KAGK K+  LFKAVEAYLLA+P
Sbjct  122  YHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHP 157

Sequence Alignment: 8. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 138.9 bits 554,  Expect = 6e-35
 Identities = 84/155 54%, Positives = 113/155 72%, Gaps = 1/155 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF++ED+ TS + PA L+K+   DAD + PK  P  F S E +EGNGGPGTIKKI+F E
Sbjct  2    GVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFAE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGG-SLIKLSIT 119
              E K++ HK+E ID AN+ Y YSI+ G  L  T EKI ++ K++  P+GG S++K++  
Sbjct  62   GNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHGGGSILKITSK 121
Query  120  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            YH+KG+A  NE+E+KAGK K+  LFKAVEAYLLA+P
Sbjct  122  YHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHP 157

Sequence Alignment: 9. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 137.0 bits 546,  Expect = 2e-34
 Identities = 82/155 52%, Positives = 113/155 72%, Gaps = 1/155 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF++ED+ TS + PA L+K+   DAD + PK  P  F   E +EGNGGPGTIKKI+F E
Sbjct  2    GVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFAE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGG-SLIKLSIT 119
              E K++ HK+E ID AN+ Y YSI+ G  L  T EKI+++ K++  P+GG S++K++  
Sbjct  62   GSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITSK 121
Query  120  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            YH+KG+A  +E+E+KAGK K+  LFKAVEAYLLA+P
Sbjct  122  YHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHP 157

Sequence Alignment: 10. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 136.4 bits 543,  Expect = 3e-34
 Identities = 81/152 53%, Positives = 115/152 75%, Gaps = 2/152 1%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GV TFE+++TSPV PA L+KA   D D + PK +P + +S+EIVEGNGGPGT+KK++ VE
Sbjct  2    GVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP-AIQSIEIVEGNGGPGTVKKVTAVE 60
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
            DG+T +VLHKI++IDEA   Y Y+I GG  + E  EK++F +KL +  +GGS IK+S+T+
Sbjct  61   DGKTSYVLHKIDAIDEATYTYDYTISGGTGFQEILEKVSFKTKL-EAADGGSKIKVSVTF 119
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGDAP  ++  +  K KS  +FKA+E Y+L+N
Sbjct  120  HTKGDAPLPDEVHQDVKQKSQGIFKAIEGYVLSN 153

Sequence Alignment: 11. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 136.3 bits 543,  Expect = 4e-34
 Identities = 82/155 52%, Positives = 112/155 72%, Gaps = 1/155 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +ED+ TS + PA L+K+   DAD + PK  P  F   E +EGNGGPGTIKKI+F E
Sbjct  2    GVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFAE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGG-SLIKLSIT 119
              E K++ HK+E ID AN+ Y YSI+ G  L  T EKI+++ K++  P+GG S++K++  
Sbjct  62   GSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITSK 121
Query  120  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            YH+KG+A  +E+E+KAGK K+  LFKAVEAYLLA+P
Sbjct  122  YHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHP 157

Sequence Alignment: 12. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 135.9 bits 541,  Expect = 5e-34
 Identities = 80/155 51%, Positives = 112/155 72%, Gaps = 0/155 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVFT+E +TT+ + PA L+KA   DAD + PK  P + KS EI+EG+GGPGTIKKI+F E
Sbjct  2    GVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGPGTIKKITFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
              +  +V H+I+ ID AN+ Y+ +++ G A+ ET EKI ++ KL   P+GGS++K +  Y
Sbjct  62   GSQFNYVKHRIDEIDNANFTYACTLIEGDAISETLEKIAYEIKLVASPDGGSILKSTSKY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            H+KGD    ED++KAGK ++  +FKAVEAYLLANP
Sbjct  122  HTKGDHEIKEDQIKAGKEEASGIFKAVEAYLLANP 156

Sequence Alignment: 13. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 135.9 bits 541,  Expect = 5e-34
 Identities = 79/155 50%, Positives = 110/155 70%, Gaps = 0/155 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +ED+ TS +APA L+K+   DAD + PK  P++  S E +EGNGGPGTIKKI+F E
Sbjct  2    GVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFPE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                K++ H+++ ID AN+ Y YSI+ G  L +T EKI+++ K+   P GGS++K++  Y
Sbjct  62   GSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSKY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            H+KGD   NE+E+KAGK K   LFKAVE YL+A+P
Sbjct  122  HTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAHP 156

Sequence Alignment: 14. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 134.2 bits 534,  Expect = 2e-33
 Identities = 80/155 51%, Positives = 112/155 72%, Gaps = 0/155 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVFT+E ++TS + PA L+KA   DAD + PK +P + KS EI+EGNGGPGTIKKI+F E
Sbjct  2    GVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
              + K+V H+ ++IDEAN+ Y+YS++ G AL +  EKI++++K+     GGS++K    Y
Sbjct  62   GSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISHY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            HSKGD    E+++K GK K+  LFKAVE YLLA+P
Sbjct  122  HSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHP 156

Sequence Alignment: 15. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 129.2 bits 513,  Expect = 5e-32
 Identities = 76/155 49%, Positives = 106/155 68%, Gaps = 0/155 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVFT+E + TS + P  L+KA   DAD + PK  P + K  EI+EG+GG GTIKK++F E
Sbjct  2    GVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
              +  +V H+++ ID+ NL YSY+++ G AL +  E I +D KL   P+GGS++K +  Y
Sbjct  62   GSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKLVASPDGGSIVKTTSHY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            H+KGD    E+++KAGK K+  LFK VEAYLLANP
Sbjct  122  HTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANP 156

Sequence Alignment: 16. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 128.9 bits 512,  Expect = 6e-32
 Identities = 77/154 50%, Positives = 109/154 70%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVFT E++ TS + P  L+KA   DAD + PK  P + KS EI+EGNGGPGTIKKI+F E
Sbjct  2    GVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGPGTIKKITFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
              + K+V H+I+ ID+AN+ Y YS++ G  + E  EKI+++ K+   P+GGS++K +  Y
Sbjct  62   GSQFKYVKHRIDEIDQANFTYCYSVIEGDVVNELLEKISYEIKIVASPDGGSILKNTSKY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KG+    E+++ AGK K+  LFKAVEAYLLA+
Sbjct  122  HTKGEQEIKEEKVMAGKEKAAGLFKAVEAYLLAH 155

Sequence Alignment: 17. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 128.2 bits 509,  Expect = 1e-31
 Identities = 76/155 49%, Positives = 108/155 69%, Gaps = 0/155 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVFT+E + TS + P  L+KA   DAD + PK  P + K  EI+EG+GGPGTIKKI+F E
Sbjct  2    GVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
              +  +V HKI+SID+ N  YSY+++ G AL +T EKI++++KL   P+GGS+IK +  Y
Sbjct  62   GSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSHY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            H+KG+    E+ +KAGK K+ +LFK +E YL  +P
Sbjct  122  HTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHP 156

Sequence Alignment: 18. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 128.0 bits 508,  Expect = 1e-31
 Identities = 76/155 49%, Positives = 107/155 69%, Gaps = 0/155 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVFT+E + TS + P  L+KA   DAD + PK  P + K  EI+EG+GGPGTIKKI+F E
Sbjct  2    GVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
              +  +V HKI+SID+ N  YSY+++ G AL +  EKI++++KL   P+GGS+IK +  Y
Sbjct  62   GSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSHY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            H+KGD    E+ +KAGK K+ +LFK +E YL  +P
Sbjct  122  HTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHP 156

Sequence Alignment: 19. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 127.5 bits 506,  Expect = 2e-31
 Identities = 77/155 49%, Positives = 109/155 70%, Gaps = 0/155 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            G+FT+ D++TS + P  L+KA+  +ADT+ PK  P S KS EIVEG+GG GTIKKISF E
Sbjct  2    GIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGGVGTIKKISFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                 +V H+I+ +D+ N+ Y+YS+V G AL +  EKI+++ KL    +GGS+IK +  Y
Sbjct  62   GSHYSYVKHQIDGLDKDNFVYNYSLVEGDALSDKVEKISYEIKLVASADGGSVIKSTSNY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            H+KGD    E+++KAGK K+  LFK +E YL+ANP
Sbjct  122  HTKGDVEIKEEDVKAGKEKATGLFKLIENYLVANP 156

Sequence Alignment: 20. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 125.1 bits 496,  Expect = 9e-31
 Identities = 74/154 48%, Positives = 105/154 68%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +TTS + PA L+K    D+D + PK  P + KS+EI+EGNGGPGTIKKI F E
Sbjct  2    GVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFDE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                 ++ +K+E ID+AN+ Y YS++ G AL +  EKI ++ K+   P+GGS++K    Y
Sbjct  62   GSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISKY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+ GD    ++++KAGK K+  LFKAVE YLLA+
Sbjct  122  HTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAH 155

Sequence Alignment: 21. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 124.7 bits 494,  Expect = 1e-30
 Identities = 75/155 48%, Positives = 103/155 66%, Gaps = 0/155 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GV+T+E++ TS +    L+KA   DAD + PK  P + K  EI+EG+GGPGTIKKI+F E
Sbjct  2    GVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                 +V HKI SID+ N  YSYS++ G AL E  EKI +++KL   P+GG++IK +  Y
Sbjct  62   GSHYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSKY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            H+KGD    E+ +KAGK K+  LFK +E YL  +P
Sbjct  122  HTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHP 156

Sequence Alignment: 22. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 124.2 bits 492,  Expect = 2e-30
 Identities = 74/155 47%, Positives = 103/155 66%, Gaps = 0/155 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GV+T+E++ TS +    L+KA   DAD + PK  P + K  EI+EG+GGPGTIKKI+F E
Sbjct  2    GVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                 +V HKI SID+ N  YSYS++ G AL +  EKI +++KL   P+GG++IK +  Y
Sbjct  62   GSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSKY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            H+KGD    E+ +KAGK K+  LFK +E YL  +P
Sbjct  122  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHP 156

Sequence Alignment: 23. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 123.9 bits 491,  Expect = 2e-30
 Identities = 74/154 48%, Positives = 106/154 68%, Gaps = 1/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GV+TFE++ TS + P  L+KA   DAD + PK  P + K  EI+EG+GGPGTIKKI+F E
Sbjct  2    GVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
              +  +V HKI+S+DEAN  Y+Y+++ G AL +T EK+++++KL      GS+IK    Y
Sbjct  62   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISHY 120
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            H+KGD    E+ +KAGK K+  LFK +E+YL  +P
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHP 155

Sequence Alignment: 24. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 123.9 bits 491,  Expect = 2e-30
 Identities = 74/154 48%, Positives = 106/154 68%, Gaps = 1/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GV+TFE++ TS + P  L+KA   DAD + PK  P + K  EI+EG+GGPGTIKKI+F E
Sbjct  2    GVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
              +  +V HKI+S+DEAN  Y+Y+++ G AL +T EK+++++KL      GS+IK    Y
Sbjct  62   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLM-ASGSGSIIKSISHY 120
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            H+KGD    E+ +KAGK K+  LFK +E+YL  +P
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHP 155

Sequence Alignment: 25. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 123.9 bits 491,  Expect = 2e-30
 Identities = 74/154 48%, Positives = 106/154 68%, Gaps = 1/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GV+TFE++ TS + P  L+KA   DAD + PK  P + K  EI+EG+GGPGTIKKI+F E
Sbjct  2    GVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
              +  +V HKI+S+DEAN  Y+Y+++ G AL +T EK+++++KL      GS+IK    Y
Sbjct  62   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISHY 120
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            H+KGD    E+ +KAGK K+  LFK +E+YL  +P
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHP 155

Sequence Alignment: 26. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 123.7 bits 490,  Expect = 2e-30
 Identities = 74/155 47%, Positives = 103/155 66%, Gaps = 0/155 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GV+T+E++ TS +    L+KA   DAD + PK  P + K  EI+EG+GGPGTIKKI+F E
Sbjct  2    GVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                 +V HKI SID+ N  YSYS++ G AL +  EKI +++KL   P+GG++IK +  Y
Sbjct  62   GSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSKY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            H+KGD    E+ +KAGK K+  LFK +E YL  +P
Sbjct  122  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHP 156

Sequence Alignment: 27. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 123.5 bits 489,  Expect = 3e-30
 Identities = 76/154 49%, Positives = 107/154 69%, Gaps = 1/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GV+TFE++ TS + P+ L+KA   DAD + PK  P + K  EI+EGNGGPGTIKKI+F E
Sbjct  2    GVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
              +  +V H+I+SIDEA+  YSY+++ G AL +T EKI++++KL      GS IK    Y
Sbjct  62   GSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLV-ACGSGSTIKSISHY 120
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            H+KG+    E+ +KAGKAK+  LFK +E+YL  +P
Sbjct  121  HTKGNIEIKEEHVKAGKAKAHGLFKLIESYLKGHP 155

Sequence Alignment: 28. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 122.8 bits 486,  Expect = 4e-30
 Identities = 73/154 47%, Positives = 105/154 68%, Gaps = 1/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GV+TFE++ TS + P  L+K    DAD + PK  P + K  EI+EG+GGPGTIKKI+F E
Sbjct  2    GVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
              +  +V HKI+S+DEAN  Y+Y+++ G AL +T EK+++++KL      GS+IK    Y
Sbjct  62   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISHY 120
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            H+KGD    E+ +KAGK K+  LFK +E+YL  +P
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHP 155

Sequence Alignment: 29. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 122.5 bits 485,  Expect = 5e-30
 Identities = 73/154 47%, Positives = 106/154 68%, Gaps = 1/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GV+TFE++ TS + P  L+KA   DAD + PK  P + K  EI+EG+GGPGTIKKI+F E
Sbjct  2    GVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
              +  +V HKI+S+DEAN  Y+Y+++ G AL +T EK+++++KL      GS+IK    Y
Sbjct  62   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISHY 120
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            H+KGD    E+ +KAGK K+  LFK +E++L  +P
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESHLKGHP 155

Sequence Alignment: 30. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 122.5 bits 485,  Expect = 5e-30
 Identities = 73/154 47%, Positives = 105/154 68%, Gaps = 1/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GV+TFE++ TS + P  L+KA   DAD + PK  P + K  EI+EG+GGPGT KKI+F E
Sbjct  2    GVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTTKKITFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
              +  +V HKI+S+DEAN  Y+Y+++ G AL +T EK+++++KL      GS+IK    Y
Sbjct  62   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISHY 120
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            H+KGD    E+ +KAGK K+  LFK +E+YL  +P
Sbjct  121  HTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHP 155

Sequence Alignment: 31. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 122.5 bits 485,  Expect = 5e-30
 Identities = 70/155 45%, Positives = 107/155 69%, Gaps = 0/155 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVFT+E +  S + PA L+KA   D+D + PK +P ++KS EI+EGNGGPGTIKKI+F E
Sbjct  2    GVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                K   H+I+ ID  N+ YS+S++ G AL +  E ++ ++K+   P+GGS++K +  Y
Sbjct  62   GSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTSKY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            ++KGD    ++ ++ GK K+  +FKAVEAYL+A+P
Sbjct  122  QTKGDFQLTDELIRGGKEKASEVFKAVEAYLVAHP 156

Sequence Alignment: 32. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 122.0 bits 483,  Expect = 7e-30
 Identities = 73/154 47%, Positives = 106/154 68%, Gaps = 1/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GV+T+E++ TS + P  L+KA   DAD + PK  P + K  EI+EG+GGPGTIKKI+F E
Sbjct  1    GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 60
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
              +  +V HKI+S+DEAN  Y+Y+++ G AL +T EK+++++KL      GS+IK    Y
Sbjct  61   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISHY 119
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            H+KGD    E+ +KAGK K+  LFK +E+YL  +P
Sbjct  120  HTKGDVEIMEEHVKAGKEKAHGLFKLIESYLKDHP 154

Sequence Alignment: 33. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 122.0 bits 483,  Expect = 7e-30
 Identities = 75/154 48%, Positives = 106/154 68%, Gaps = 1/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GV+TFE++ TS + P+ L+KA   DAD + PK  P + K  EI+EGNGGPGTIKKI+F E
Sbjct  2    GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
              +  +V H+I+SIDEA+  YSY+++ G AL +T EKI++++KL      GS IK    Y
Sbjct  62   GSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLV-ACGSGSTIKSISHY 120
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            H+KG+    E+ +KAGK K+  LFK +E+YL  +P
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKGHP 155

Sequence Alignment: 34. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 122.0 bits 483,  Expect = 7e-30
 Identities = 73/154 47%, Positives = 105/154 68%, Gaps = 1/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GV+TFE++ TS + P  L+KA   DAD + PK  P + K  EI+EG+GGPGTIKKI+F E
Sbjct  2    GVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
              +  +V HKI+S+DEAN  Y+Y+++ G AL +T EK+++++KL      GS+IK    Y
Sbjct  62   GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLV-ASGSGSIIKSISHY 120
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            H+KGD    E+ + AGK K+  LFK +E+YL  +P
Sbjct  121  HTKGDVEIKEEHVMAGKEKAHGLFKLIESYLKGHP 155

Sequence Alignment: 35. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 122.0 bits 483,  Expect = 7e-30
 Identities = 73/155 47%, Positives = 102/155 65%, Gaps = 0/155 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            G +T+E++ TS +    L+KA   DAD + PK  P + K  EI+EG+GGPGTIKKI+F E
Sbjct  2    GGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGPGTIKKITFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                 +V HKI SID+ N  YSYS++ G AL +  EKI +++KL   P+GG++IK +  Y
Sbjct  62   GSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSKY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            H+KGD    E+ +KAGK K+  LFK +E YL  +P
Sbjct  122  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHP 156

Sequence Alignment: 36. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 122.0 bits 483,  Expect = 7e-30
 Identities = 73/155 47%, Positives = 106/155 68%, Gaps = 0/155 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVFT E Q TS +APA L+KA+  D+D +  K LP + KS EI+EGNGGPGTIKKI+F E
Sbjct  2    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                K   H+I+ ID  N+ YS+S++ G AL +  E ++ ++K+   P+GGS+ K +  Y
Sbjct  62   GSHLKHAKHRIDVIDPENFTYSFSVIEGDALFDKLENVSTETKIVASPDGGSIAKSTSKY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            ++KGD    ++ ++ GK K+  +FKAVEAYL+A+P
Sbjct  122  QTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHP 156

Sequence Alignment: 37. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 121.6 bits 481,  Expect = 1e-29
 Identities = 75/154 48%, Positives = 106/154 68%, Gaps = 1/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GV+TFE++ TS + P+ L+KA   DAD + PK  P + K  EI+EGNGGPGTIKKI+F E
Sbjct  2    GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
              +  +V H+I+SIDEA+  YSY+++ G AL +T EKI++++KL      GS IK    Y
Sbjct  62   GSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLV-ACGSGSTIKSISHY 120
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            H+KG+    E+ +KAGK K+  LFK +E+YL  +P
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHP 155

Sequence Alignment: 38. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 121.3 bits 480,  Expect = 1e-29
 Identities = 74/154 48%, Positives = 105/154 68%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +TTS +  A L+KA   D D + PK  P +  SVE +EGNGGPGTIKKI+F E
Sbjct  1    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 60
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                K+V  +++ +D AN+ YSYS++ G AL +T EKI  + KL   P+GGS++K+S  Y
Sbjct  61   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 120
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGD     + +KA K K ++L++AVE+YLLA+
Sbjct  121  HTKGDHEMKAEHMKAIKEKGETLLRAVESYLLAH 154

Sequence Alignment: 39. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 121.1 bits 479,  Expect = 1e-29
 Identities = 75/154 48%, Positives = 105/154 68%, Gaps = 1/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GV+TFE++ TS + P  L+KA   DAD + PK  P + K  EI+EGNGGPGTIKKI+F E
Sbjct  2    GVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
              +  +V H+I+SIDEA+  YSY+++ G AL +T EKI++++KL      GS IK    Y
Sbjct  62   GSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLV-ACGSGSTIKSISHY 120
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            H+KG+    E+ +KAGK K+  LFK +E+YL  +P
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHP 155

Sequence Alignment: 40. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 121.1 bits 479,  Expect = 1e-29
 Identities = 74/154 48%, Positives = 106/154 68%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +TTS +  A L+KA   D D + PK  P +  SVE +EGNGGPGTIKKI+F E
Sbjct  2    GVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                K+V  +++ +D AN+ YSYS++ G AL +T EKI  + KL   P+GGS++K+S  Y
Sbjct  62   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKLVATPDGGSILKISNKY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGD     + +KA K K+++L++AVE+YLLA+
Sbjct  122  HTKGDHEMKAEHMKAIKEKAEALLRAVESYLLAH 155

Sequence Alignment: 41. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 120.6 bits 477,  Expect = 2e-29
 Identities = 73/154 47%, Positives = 105/154 68%, Gaps = 1/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            G++TFE++ TS + P  L+KA   DAD + PK  P + K  EI+EGNGGPGTIKKI+F E
Sbjct  2    GLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
              +  +V H+++SIDEA+  Y+Y+++ G AL +T EKI++++KL      GS IK    Y
Sbjct  62   GSQYGYVKHRVDSIDEASYSYAYTLIEGDALTDTIEKISYEAKLV-ASGSGSTIKSISHY 120
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            H+KGD    E+ +KAGK K+  LFK +E+YL  +P
Sbjct  121  HTKGDIEIKEEHVKAGKEKAHGLFKLIESYLKDHP 155

Sequence Alignment: 42. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 120.4 bits 476,  Expect = 2e-29
 Identities = 74/154 48%, Positives = 105/154 68%, Gaps = 1/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GV+TFE++ TS + P+ L+KA   DAD + PK  P + K  EI+EGNGGPGTIKKI+F E
Sbjct  2    GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
              +  +V H+I+SIDEA+  YSY+++ G AL +T EKI++++KL      GS IK    Y
Sbjct  62   GSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLV-ACGSGSTIKSISHY 120
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            H+KG+    E+ +K GK K+  LFK +E+YL  +P
Sbjct  121  HTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHP 155

Sequence Alignment: 43. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 120.4 bits 476,  Expect = 2e-29
 Identities = 73/154 47%, Positives = 105/154 68%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +TTS +  A L+KA   D D + PK  P +  SVE +EGNGGPGTIKKI+F E
Sbjct  2    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                K+V  +++ +D AN+ YSYS++ G AL +T EKI  + K+   P+GGS++K+S  Y
Sbjct  62   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGD     + +KA K K ++L++AVE+YLLA+
Sbjct  122  HTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAH 155

Sequence Alignment: 44. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 120.4 bits 476,  Expect = 2e-29
 Identities = 73/154 47%, Positives = 106/154 68%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +TTS +  A L+KA   + DT+ PK  P +  SVE +EGNGGPGTIKKI+F E
Sbjct  2    GVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                K+V  +++ +D AN+ YSYS++ G AL +T EKI  + K+   P+GGS++K+S  Y
Sbjct  62   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGD     + +KA K K ++L++AVE+YLLA+
Sbjct  122  HTKGDQEMKAEHMKAIKEKGEALLRAVESYLLAH 155

Sequence Alignment: 45. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 120.1 bits 475,  Expect = 3e-29
 Identities = 74/154 48%, Positives = 105/154 68%, Gaps = 1/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GV+TFE++ TS + P+ L+KA   DAD + PK  P + K  EI+EGNGGPGTIKKI+F E
Sbjct  2    GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
              +  +V H+I+SIDEA+  YSY+++ G AL +T E I++++KL      GS IK    Y
Sbjct  62   GSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIENISYETKLV-ACGSGSTIKSISHY 120
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            H+KG+    E+ +KAGK K+  LFK +E+YL  +P
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHP 155

Sequence Alignment: 46. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 120.1 bits 475,  Expect = 3e-29
 Identities = 75/154 48%, Positives = 105/154 68%, Gaps = 1/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GV TFE++ TS + P+ L+KA   DAD + PK  P + K  EI+EGNGGPGTIKKI+F E
Sbjct  2    GVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
              +  +V H+I+SIDEA+  YSY+++ G AL +T EKI++++KL      GS IK    Y
Sbjct  62   GSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLV-ACGSGSTIKSISHY 120
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            H+KG+    E+ +KAGK K+  LFK +E+YL  +P
Sbjct  121  HTKGNIEIKEEHVKAGKEKAHGLFKLIESYLKDHP 155

Sequence Alignment: 47. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 120.1 bits 475,  Expect = 3e-29
 Identities = 73/154 47%, Positives = 106/154 68%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +TTS +  A L+KA   + DT+ PK  P +  SVE +EGNGGPGTIKKI+F E
Sbjct  2    GVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                K+V  +++ +D AN+ YSYS++ G AL +T EKI  + K+   P+GGS++K+S  Y
Sbjct  62   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGD     + +KA K K ++L++AVE+YLLA+
Sbjct  122  HTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAH 155

Sequence Alignment: 48. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 120.1 bits 475,  Expect = 3e-29
 Identities = 72/154 46%, Positives = 104/154 67%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +TTS +    L+KA   D D + PK  P + KS EI+EG+GG GTIKK++F E
Sbjct  2    GVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
              +  +V +++  ID+ N+ YSYS++ G  L +  EKIT+++KL   P+GGS+IK +  Y
Sbjct  62   GSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSHY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGD    E+ +KAGK K+  LFK +EAYLLA+
Sbjct  122  HAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAH 155

Sequence Alignment: 49. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 119.9 bits 474,  Expect = 3e-29
 Identities = 72/154 46%, Positives = 105/154 68%, Gaps = 1/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GV+TFE++ TS + P+ L+KA   DAD + PK  P + K  EI+EGNGGPGTIKKI+F E
Sbjct  2    GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
              +  +V H+I+SIDEA+  YSY+++ G AL +T EKI++++KL    +G ++  +S  Y
Sbjct  62   GSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGATIKSIS-HY 120
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            H KG+    E+ +K GK K   LFK +E+YL  +P
Sbjct  121  HPKGNIEIKEEHVKVGKEKGHGLFKLIESYLKGHP 155

Sequence Alignment: 50. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 119.9 bits 474,  Expect = 3e-29
 Identities = 73/154 47%, Positives = 106/154 68%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +TTS +  A L+KA   + DT+ PK  P +  SVE +EGNGGPGTIKKI+F E
Sbjct  2    GVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGPGTIKKITFPE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                K+V  +++ +D AN+ YSYS++ G AL +T EKI  + K+   P+GGS++K+S  Y
Sbjct  62   GSPFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGD     + +KA K K ++L++AVE+YLLA+
Sbjct  122  HTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAH 155

Sequence Alignment: 51. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 119.2 bits 471,  Expect = 5e-29
 Identities = 73/154 47%, Positives = 103/154 66%, Gaps = 1/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVFT+E + TS + PA L+ A   DAD + PK  P + KS EI+EG+GG GTIKKI+F E
Sbjct  2    GVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                 +V H+I+ +D+ N+ Y YS++ G A+ ET EKI++++KL      GS+IK +  Y
Sbjct  62   GSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLV-ASGSGSVIKSTSHY 120
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            H+KGD    E+ +KAGK K+  LFK +E YLL +P
Sbjct  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLLEHP 155

Sequence Alignment: 52. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 119.2 bits 471,  Expect = 5e-29
 Identities = 73/154 47%, Positives = 102/154 66%, Gaps = 1/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GV+T+E++ TS +    L+KA   DAD + PK  P + K  EI+EG+GGPGTIKKI+F E
Sbjct  2    GVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                 +V HKI SID+ N  YSYS++ G AL +  EKI +++KL   P+G ++IK +  Y
Sbjct  62   GSHYGYVKHKIHSIDKENHTYSYSLIEGDALSDNIEKIDYETKLVSAPHG-TIIKTTSKY 120
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            H+KGD    E+ +KAGK K+  LFK +E YL  +P
Sbjct  121  HTKGDVEIKEEHVKAGKEKASHLFKLIEGYLKDHP 155

Sequence Alignment: 53. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 118.9 bits 470,  Expect = 6e-29
 Identities = 74/154 48%, Positives = 104/154 67%, Gaps = 1/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GV TFE++ TS + P+ L+KA   DAD + PK  P + K  EI+EGNGGPGTIKKI+F E
Sbjct  2    GVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
              +  +V H+I+SIDEA+  YSY+++ G AL +T EKI++++KL      GS IK    Y
Sbjct  62   GSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLV-ACGSGSTIKSISHY 120
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            H+KG+    E+ +K GK K+  LFK +E+YL  +P
Sbjct  121  HTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHP 155

Sequence Alignment: 54. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 118.7 bits 469,  Expect = 7e-29
 Identities = 67/155 43%, Positives = 105/155 67%, Gaps = 0/155 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GV  +E +  S + PA L+KA   D+D + PK +P ++KS EI+EGNGGPGTIKKI+F E
Sbjct  2    GVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGPGTIKKITFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                K   H+I+ ID  N+ +S+S++ G AL +  E ++ ++K+   P+GGS++K +  Y
Sbjct  62   GSHLKHAKHRIDVIDPENFTFSFSVIEGDALFDKLENVSTETKIVASPDGGSIVKSTCKY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            ++KGD    ++ ++ GK K+  +FKAVEAYL+A+P
Sbjct  122  QTKGDFQLTDELIRGGKEKASGVFKAVEAYLVAHP 156

Sequence Alignment: 55. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 118.7 bits 469,  Expect = 7e-29
 Identities = 70/154 45%, Positives = 102/154 66%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E ++TS +  A L+KA   D + + PK  P +  SVE VEGNGGPGTIKKI+F E
Sbjct  2    GVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFSE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                K+V  ++E +D  N+ YSY+++ G  + +  EKI  + K+   P+GGS++K+S  Y
Sbjct  62   GSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNKY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGD   + + +K GK K + LF+AVEAYLLA+
Sbjct  122  HTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAH 155

Sequence Alignment: 56. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 118.0 bits 466,  Expect = 1e-28
 Identities = 71/154 46%, Positives = 105/154 68%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E + TS +  A L+KA   D D +FPK  P +  SVE +EGNGGPGTIKKISF E
Sbjct  1    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                K+V  +++ +D AN+ YSYS++ G  + +T EKI+ + K+   P+GGS++K+S  Y
Sbjct  61   GIPFKYVKDRVDEVDHANFKYSYSLIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 120
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGD     +++KA K   ++L++AVE+YLLA+
Sbjct  121  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAH 154

Sequence Alignment: 57. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 117.7 bits 465,  Expect = 1e-28
 Identities = 70/154 45%, Positives = 105/154 68%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +TTS +  A L+KA   D D +FPK  P +  SVE +EGNGGPGTIKKISF E
Sbjct  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                K+V  +++ +D  N+ Y+YS++ G  + +T EKI+ + K+   P+GGS++K+S  Y
Sbjct  62   GLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGD     +++KA K   ++L++AVE+YLLA+
Sbjct  122  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 58. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 117.7 bits 465,  Expect = 1e-28
 Identities = 70/154 45%, Positives = 104/154 67%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E + TS +  A L+KA   D D +FPK  P +  SVE +EGNGGPGTIKKISF E
Sbjct  2    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                K+V  +++ +D  N+ YSYS++ G  + +T EKI+ + K+   PNGGS++K++  Y
Sbjct  62   GFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNKY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGD     +++KA K   ++L++AVE+YLLA+
Sbjct  122  HTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 59. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 117.7 bits 465,  Expect = 1e-28
 Identities = 70/154 45%, Positives = 105/154 68%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +TTS +  A L+KA   D D +FPK  P +  SVE +EGNGGPGTIKKISF E
Sbjct  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                K+V  +++ +D  N+ Y+YS++ G  + +T EKI+ + K+   P+GGS++K+S  Y
Sbjct  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGD     +++KA K   ++L++AVE+YLLA+
Sbjct  122  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 60. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 117.5 bits 464,  Expect = 2e-28
 Identities = 70/154 45%, Positives = 105/154 68%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +TTS +  A L+KA   D D +FPK  P +  SVE +EGNGGPGTIKKISF E
Sbjct  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                K+V  +++ +D  N+ Y+YS++ G  + +T EKI+ + K+   P+GGS++K+S  Y
Sbjct  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGD     +++KA K   ++L++AVE+YLLA+
Sbjct  122  HTKGDHEVKAEQVKASKEMRETLLRAVESYLLAH 155

Sequence Alignment: 61. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 117.5 bits 464,  Expect = 2e-28
 Identities = 70/154 45%, Positives = 104/154 67%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E + TS +  A L+KA   D D +FPK  P +  SVE +EGNGGPGTIKKISF E
Sbjct  2    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                K+V  +++ +D  N+ YSYS++ G  + +T EKI+ + K+   PNGGS++K++  Y
Sbjct  62   GIPFKYVKGRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNKY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGD     +++KA K   ++L++AVE+YLLA+
Sbjct  122  HTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 62. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 117.5 bits 464,  Expect = 2e-28
 Identities = 70/154 45%, Positives = 105/154 68%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +TTS +  A L+KA   D D +FPK  P +  SVE +EGNGGPGTIKKISF E
Sbjct  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                K+V  +++ +D  N+ Y+YS++ G  + +T EKI+ + K+   P+GGS++K+S  Y
Sbjct  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGSILKISNKY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGD     +++KA K   ++L++AVE+YLLA+
Sbjct  122  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 63. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 117.3 bits 463,  Expect = 2e-28
 Identities = 77/155 49%, Positives = 106/155 68%, Gaps = 1/155 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVFT+E + TS +APA L+KA   D D + PK  P + + VEI+EGNGG GTIKKI+F +
Sbjct  2    GVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGGVGTIKKITFGQ 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALP-ETAEKITFDSKLSDGPNGGSLIKLSIT 119
                K+V HKIE+ID+ +L YSYSI+ G AL     EKIT +SKL    +GG++IK    
Sbjct  62   GVPFKYVKHKIEAIDKESLTYSYSIIEGDALEGNQLEKITHESKLVASGDGGNVIKTVSK 121
Query  120  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            Y+S GDA  NE+++K G+ ++  ++K VEAYL  +P
Sbjct  122  YYSAGDAQVNEEKVKEGEKQATQMLKTVEAYLKDHP 157

Sequence Alignment: 64. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 117.0 bits 462,  Expect = 2e-28
 Identities = 72/154 46%, Positives = 106/154 68%, Gaps = 1/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVFT E Q TS +APA L+KA+  D+D +  K LP + KS EI+EGNGGPGTIKKI+F E
Sbjct  2    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGPGTIKKITFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
              + K+  H+I+++D  N  YS+S++ G AL    E ++ + K    P+GGS++K +  Y
Sbjct  62   ASKFKYAKHRIDALDPENCTYSFSVIEGDALT-VMESVSTEIKCVASPDGGSIMKSTTKY 120
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            ++KGD    E++++A   K+  L+KAVEAYL+A+P
Sbjct  121  QTKGDFQLKEEQIQAAIEKAAGLLKAVEAYLVAHP 155

Sequence Alignment: 65. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 117.0 bits 462,  Expect = 2e-28
 Identities = 70/154 45%, Positives = 104/154 67%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E + TS +  A L+KA   D D +FPK  P +  SVE +EGNGGPGTIKKISF E
Sbjct  2    GVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                K+V  +++ +D  N+ YSYS++ G  + +T EKI+ + K+   PNGGS++K++  Y
Sbjct  62   GFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNKY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGD     +++KA K   ++L++AVE+YLLA+
Sbjct  122  HTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 66. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 117.0 bits 462,  Expect = 2e-28
 Identities = 70/154 45%, Positives = 103/154 66%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E + TS +    L+KA   D D + PK  P + KS +I+EG+GG GTIKK++F E
Sbjct  2    GVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
              +  +V +++  ID+ N+ YSYS++ G  L +  EKIT+++KL   P+GGS+IK +  Y
Sbjct  62   GSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSHY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGD    E+ +KAGK K+  LFK +EAYLLA+
Sbjct  122  HAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAH 155

Sequence Alignment: 67. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 116.6 bits 460,  Expect = 3e-28
 Identities = 72/151 47%, Positives = 101/151 66%, Gaps = 1/151 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVFT+E + TS + PA L+ A   DAD + PK  P + KS EI+EG+GG GTIKKI+F E
Sbjct  2    GVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                 +V H+I+ +D+ N+ Y YS++ G A+ ET EKI++++KL      GS+IK +  Y
Sbjct  62   GSTYSYVKHRIDGVDKDNFVYKYSVIEGDAISETIEKISYETKLV-AAGSGSVIKSTSHY 120
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLL 152
            H+KGD    E+ +KAGK K+  LFK +E YLL
Sbjct  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLL 152

Sequence Alignment: 68. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 116.6 bits 460,  Expect = 3e-28
 Identities = 70/154 45%, Positives = 103/154 66%, Gaps = 1/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GV+ +E Q TS + PA L+KA   D+D +  K LP + KS EI+EGNGGPGTIKK +F E
Sbjct  2    GVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGPGTIKKFTFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
              + K+  H+I+++D  N  YS+S++ G AL + A  I+ + K+   P+GGS++K +  Y
Sbjct  62   ASKVKYAKHRIDTLDPENCSYSFSVIEGEALTDIA-SISTEVKFVASPDGGSIMKSTTKY 120
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            ++KG     E++++A   K   LFKAVEAYLLA+P
Sbjct  121  QTKGGFQLKEEQIQAAVEKGTGLFKAVEAYLLAHP 155

Sequence Alignment: 69. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 116.6 bits 460,  Expect = 3e-28
 Identities = 71/155 45%, Positives = 101/155 65%, Gaps = 0/155 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GV TF  ++T+ +AP  L+K +  D D++ PK L    KS+EIVEG+GG G+IK+++FVE
Sbjct  2    GVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGGAGSIKQMNFVE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
             G  K++ HKI  ID+ NL   YS++ G  L +  E I +D K+    +GG + K +  Y
Sbjct  62   GGPIKYLKHKIHVIDDKNLVTKYSLIEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTEY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            H+KGD   +E+E   GK K+  LFKA+EAYLLANP
Sbjct  122  HTKGDHVVSEEEHNVGKGKAIDLFKAIEAYLLANP 156

Sequence Alignment: 70. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 116.1 bits 458,  Expect = 5e-28
 Identities = 70/154 45%, Positives = 104/154 67%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +TTS +  A L+KA   D D + PK  P +  SVE +EGNGGPGTIKKISF E
Sbjct  2    GVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                K+V  +++ +D  N+ Y+YS++ G  + +T EKI+ + KL   P+GGS++++S  Y
Sbjct  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKLVATPDGGSILEISNKY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGD     + +KA K K ++L++AVE+YLLA+
Sbjct  122  HTKGDHEMKAEHMKAIKEKGEALLRAVESYLLAH 155

Sequence Alignment: 71. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 116.1 bits 458,  Expect = 5e-28
 Identities = 70/154 45%, Positives = 102/154 66%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E + TS +    L+KA   D D + PK  P + KS EI+EG+GG GTIKK++F E
Sbjct  2    GVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGGVGTIKKVTFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
              +  +V +++  ID+ N+ YSYS++ G  L +  EKIT+++KL   P+GGS+IK +  Y
Sbjct  62   GSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTTSHY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
             +KGD    E+ +KAGK K+  LFK +EAYLLA+
Sbjct  122  RAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAH 155

Sequence Alignment: 72. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 115.8 bits 457,  Expect = 5e-28
 Identities = 74/151 49%, Positives = 100/151 66%, Gaps = 1/151 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVFT+E + TS + PA LY A   DAD + PK  P + KS EI+EG+GG GTIKKI+F E
Sbjct  2    GVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGGVGTIKKINFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                 +V HKI+ +D+ N+ Y YS++ G A+ ET EKI++++KL      GS+IK    Y
Sbjct  62   GSTYSYVKHKIDGVDKDNFVYQYSVIEGDAISETIEKISYETKLV-ASGSGSVIKSISHY 120
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLL 152
            H+KGD    E+ +KAGK K+  LFK +E YLL
Sbjct  121  HTKGDVEIKEEHVKAGKEKASHLFKLIENYLL 152

Sequence Alignment: 73. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 115.8 bits 457,  Expect = 5e-28
 Identities = 69/154 44%, Positives = 104/154 67%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +TTS +  A L+KA   D D + PK  P +  SVE +EGNGGPGTIKKISF E
Sbjct  2    GVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                K+V  +++ +D  N+ Y+YS++ G  + +T EKI+ + K+   P+GGS++K+S  Y
Sbjct  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPMGDTLEKISNEIKIVATPDGGSILKISNKY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGD     +++KA K   ++L++AVE+YLLA+
Sbjct  122  HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 74. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 114.9 bits 453,  Expect = 1e-27
 Identities = 71/153 46%, Positives = 101/153 66%, Gaps = 1/153 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E + TS + PA L+ A   DAD + PK  P + KS EI+EG+GG GTIKKI+F E
Sbjct  2    GVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGGVGTIKKINFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                 +V H+I+ +D+ N+ Y YS++ G A+ ET EKI++++KL      GS+IK +  Y
Sbjct  62   GSTYSYVKHRIDGVDKENFVYKYSVIEGDAISETIEKISYETKLV-ASGSGSVIKSTSHY 120
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+K D    E+ +KAGK K+  LFK +E YLLA+
Sbjct  121  HTKSDVEIKEEHVKAGKEKASHLFKLIENYLLAH 154

Sequence Alignment: 75. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 114.9 bits 453,  Expect = 1e-27
 Identities = 68/154 44%, Positives = 100/154 64%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +TTS +  A L+KA   D + + PK  P +  SVE VEGNGGPGTIKKI+F E
Sbjct  2    GVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFSE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                K+V  ++E +D  N+ YSY+++ G  + +  EKI  + K+   P+GGS++K++  Y
Sbjct  62   GSPVKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKITSKY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGD     + +K GK + + L+K VEAYLLA+
Sbjct  122  HTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAH 155

Sequence Alignment: 76. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 114.6 bits 452,  Expect = 1e-27
 Identities = 68/154 44%, Positives = 104/154 67%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +TTS +  A L+KA   D D +FPK  P +  SVE +EGNGGPGTIKKISF E
Sbjct  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                K+V  +++ +D  N+ Y+YS++ G  + +T EKI+ + K+   P+GG ++K+S  Y
Sbjct  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNKY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KG+     +++KA K   ++L++AVE+YLLA+
Sbjct  122  HTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 77. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 114.4 bits 451,  Expect = 1e-27
 Identities = 69/150 46%, Positives = 101/150 67%, Gaps = 0/150 0%
Query  3    FTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVEDG 62
            F +E +TTS +  A L+KA   + D + PK  P +  SVE +EGNGGPGTIKKI+F E  
Sbjct  1    FNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKITFPEGS 60
Query  63   ETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITYHS 122
              K+V  +++ +D AN+ YSYS++ G AL +T EKI  + K+   P+GGS++K+S  YH+
Sbjct  61   PFKYVKERVDEVDHANFKYSYSMIEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHT 120
Query  123  KGDAPPNEDELKAGKAKSDSLFKAVEAYLL 152
            KGD     + +KA K K ++L++AVE+YLL
Sbjct  121  KGDHEMKAEHMKAIKEKGEALLRAVESYLL 150

Sequence Alignment: 78. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 114.4 bits 451,  Expect = 1e-27
 Identities = 68/154 44%, Positives = 104/154 67%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +TTS +  A L+KA   D D +FPK  P +  SVE +EGNGGPGTIKKISF E
Sbjct  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                K+V  +++ +D  N+ Y+YS++ G  + +T EKI+ + K+   P+GG ++K+S  Y
Sbjct  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNKY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KG+     +++KA K   ++L++AVE+YLLA+
Sbjct  122  HTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 79. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 114.2 bits 450,  Expect = 2e-27
 Identities = 67/154 43%, Positives = 104/154 67%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +T S +  A L+KA   D D ++PK  P++  SVE +EGNGGPGTIKKI+F E
Sbjct  1    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 60
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                K+V  +++ +D  N+ YS+S++ G A+ +  EK+  + K+   P+GGS++K+S  +
Sbjct  61   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 120
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGD   N +++K  K K+  L+KAVE+YLLA+
Sbjct  121  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAH 154

Sequence Alignment: 80. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 114.2 bits 450,  Expect = 2e-27
 Identities = 67/154 43%, Positives = 104/154 67%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +T S +  A L+KA   D D ++PK  P++  SVE +EGNGGPGTIKKI+F E
Sbjct  2    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                K+V  +++ +D  N+ YS+S++ G A+ +  EK+  + K+   P+GGS++K+S  +
Sbjct  62   GSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKF 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGD   N +++K  K K+  L+KAVE+YLLA+
Sbjct  122  HTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAH 155

Sequence Alignment: 81. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 113.9 bits 449,  Expect = 2e-27
 Identities = 68/154 44%, Positives = 100/154 64%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +TTS +  A L+KA   D + + PK  P +  SVE VEGNGGPGTIKKI+F E
Sbjct  2    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                K+V  ++E +D  N+ YSY+++ G  + +  EKI  + K+   P+GGS++K++  Y
Sbjct  62   GSPVKYVKERVEEVDHTNFKYSYTVIEGGFVGDKVEKICNEIKIVAAPDGGSILKITSKY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGD     + +K GK + + L+K VEAYLLA+
Sbjct  122  HTKGDHEVPAEHIKGGKERVEGLLKPVEAYLLAH 155

Sequence Alignment: 82. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 113.7 bits 448,  Expect = 2e-27
 Identities = 67/154 43%, Positives = 101/154 65%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +TTS +  A L+KA   D + + PK  P +  SVE VEGNGGPGTIKKI+F E
Sbjct  1    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSE 60
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                K+V  ++E ID  N+ Y+Y+++ G  L +  EK++ + K+   P GGS++K+S  +
Sbjct  61   GSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KG    N +E+K  K  ++ L++AVE+YLLA+
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAH 154

Sequence Alignment: 83. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 113.7 bits 448,  Expect = 2e-27
 Identities = 69/154 44%, Positives = 103/154 66%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +TTS +  A L+KA   D D +FPK  P +  SVE +EGNGGPGTIKKISF E
Sbjct  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                K+V  +++ +   N+ YSYS++ G  + +T EKI+ + K+   P+G S++K+S  Y
Sbjct  62   GFPFKYVKDRVDEVAHKNFKYSYSVIEGGPIGDTLEKISNEIKIVATPDGRSILKISNKY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGD     +++KA K   ++L++AVE+YLLA+
Sbjct  122  HTKGDHEVKAEQIKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 84. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 113.7 bits 448,  Expect = 2e-27
 Identities = 65/154 42%, Positives = 100/154 64%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +T S +  A L+K+   D D + PK  P +  SVE V GNGGPGTIK I+F E
Sbjct  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                KFV  +++ +D AN+ Y+Y+++ G  L +  EK++ + K+   P GGS++K+S  +
Sbjct  62   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSKF 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGD   N +E+K  K  ++ L++AVE+YLLA+
Sbjct  122  HAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 85. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 113.5 bits 447,  Expect = 3e-27
 Identities = 66/154 42%, Positives = 100/154 64%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +T S +  A L+K+   D D + PK  P +  SVE V GNGGPGTIK I+F E
Sbjct  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                KFV  +++ +D AN+ YSY+++ G  L +  EK++ + K+   P GGS++K+S  +
Sbjct  62   GIPFKFVKERVDEVDNANFKYSYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGD   N +E+K  K  ++ L++AVE+YLLA+
Sbjct  122  HAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 86. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 113.5 bits 447,  Expect = 3e-27
 Identities = 65/154 42%, Positives = 100/154 64%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +T S +  A L+K+   D D + PK  P +  SVE V GNGGPGTIK I+F E
Sbjct  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                KFV  +++ +D AN+ Y+Y+++ G  L +  EK++ + K+   P GGS++K+S  +
Sbjct  62   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGD   N +E+K  K  ++ L++AVE+YLLA+
Sbjct  122  HAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 87. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 113.2 bits 446,  Expect = 3e-27
 Identities = 65/154 42%, Positives = 100/154 64%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +T S +  A L+K+   D D + PK  P +  SVE V GNGGPGTIK I+F E
Sbjct  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                KFV  +++ +D AN+ Y+Y+++ G  L +  EK++ + K+   P GGS++K+S  +
Sbjct  62   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSKF 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGD   N +E+K  K  ++ L++AVE+YLLA+
Sbjct  122  HAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 88. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 113.2 bits 446,  Expect = 3e-27
 Identities = 67/154 43%, Positives = 103/154 66%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +TTS +  A L+KA   D D +FPK  P +  SVE +EGNGGPGTIKKISF E
Sbjct  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                K+V  +++ +D  N+ Y+YS++ G  + +  EKI+ + K+   P+GG ++K+S  Y
Sbjct  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDILEKISNEIKIVATPDGGCVLKISNKY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KG+     +++KA K   ++L++AVE+YLLA+
Sbjct  122  HTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 89. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 113.2 bits 446,  Expect = 3e-27
 Identities = 66/154 42%, Positives = 99/154 64%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +TTS +  A L+K+   D D + PK  P +  SVE VEGNGGPGTIK I+F E
Sbjct  2    GVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                K+V  +++ +D  N+ YSY+++ G  L +  EK+  + K+   P GGS++K+S  +
Sbjct  62   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGD   N +E+K  K  ++ L++AVE YLLA+
Sbjct  122  HAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAH 155

Sequence Alignment: 90. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 113.0 bits 445,  Expect = 4e-27
 Identities = 65/154 42%, Positives = 100/154 64%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +T S +  A L+K+   D D + PK  P +  SVE V GNGGPGTIK I+F E
Sbjct  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                KFV  +++ +D AN+ Y+Y+++ G  L +  EK++ + K+   P GGS++K+S  +
Sbjct  62   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSKF 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGD   N +E+K  K  ++ L++AVE+YLLA+
Sbjct  122  HAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 91. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 112.7 bits 444,  Expect = 5e-27
 Identities = 65/154 42%, Positives = 100/154 64%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +T S +  A L+K+   D D + PK  P +  SVE V GNGGPGTIK I+F E
Sbjct  2    GVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                KFV  +++ +D AN+ Y+Y+++ G  L +  EK++ + K+   P GGS++K+S  +
Sbjct  62   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGD   N +E+K  K  ++ L++AVE+YLLA+
Sbjct  122  HAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 92. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 112.5 bits 443,  Expect = 5e-27
 Identities = 65/154 42%, Positives = 101/154 65%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +T S +  A L+K+   D D + PK  P +  SVE V GNGGPGTIK I+F E
Sbjct  2    GVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                KFV  +++ +D AN+ +SY+++ G  L +  EK++++ K+   P GGS++K+S  +
Sbjct  62   GSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELKIVAAPGGGSILKISGKF 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGD   N +E+K  K  ++ L++AVE+YLLA+
Sbjct  122  HAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 93. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 112.5 bits 443,  Expect = 5e-27
 Identities = 67/154 43%, Positives = 103/154 66%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +TTS +  A L+KA   D D +FPK  P +  SVE +EGNGGPGTIKKISF  
Sbjct  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPG 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                K+V  +++ +D  N+ Y+YS++ G  + +T EKI+ + K+   P+GG ++K+S  Y
Sbjct  62   GLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGCVLKISNKY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KG+     +++KA K   ++L++AVE+YLLA+
Sbjct  122  HTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 94. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 112.3 bits 442,  Expect = 6e-27
 Identities = 64/154 41%, Positives = 100/154 64%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +T S +  A L+K+   D D + PK  P +  SVE V GNGGPGTIK I+F E
Sbjct  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                KFV  +++ +D AN+ Y+Y+++ G  L +  EK++ + K+   P GGS++K+S  +
Sbjct  62   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGD   N +++K  K  ++ L++AVE+YLLA+
Sbjct  122  HAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 95. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 112.3 bits 442,  Expect = 6e-27
 Identities = 64/154 41%, Positives = 100/154 64%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +T S +  A L+K+   D D + PK  P +  SVE V GNGGPGTIK I+F E
Sbjct  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                KFV  +++ +D AN+ Y+Y+++ G  L +  EK++ + K+   P GGS++K+S  +
Sbjct  62   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGD   N +++K  K  ++ L++AVE+YLLA+
Sbjct  122  HAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 96. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 112.0 bits 441,  Expect = 8e-27
 Identities = 71/155 45%, Positives = 102/155 65%, Gaps = 0/155 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GV T++ +  S V P  LYKA   D DT+ PK LP + K V+I+EG+G  GTIK+++F E
Sbjct  2    GVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDGCAGTIKEVTFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                K V +++++ID+ NL YSY+I+ G  L E  E I++  K+   P+GGS+ K    Y
Sbjct  62   GSHHKCVKQRVDAIDKDNLTYSYTIIEGDVLAEKFESISYHIKIVACPDGGSICKNRSIY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
             +KGD   +E+E+K GK K+  +FKA+EAYLLANP
Sbjct  122  TTKGDCKVSEEEIKLGKEKAAEIFKALEAYLLANP 156

Sequence Alignment: 97. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 111.8 bits 440,  Expect = 9e-27
 Identities = 64/154 41%, Positives = 99/154 64%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +T S +  A L+K+   D D + PK  P +   VE V GNGGPGTIK I+F E
Sbjct  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGPGTIKNITFAE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                KFV  +++ +D AN+ Y+Y+++ G  L +  EK++ + K+   P GGS++K+S  +
Sbjct  62   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSILKISSKF 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGD   N +E+K  K  ++ L++AVE+YLLA+
Sbjct  122  HAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 98. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 111.6 bits 439,  Expect = 1e-26
 Identities = 70/154 45%, Positives = 102/154 66%, Gaps = 1/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GV T E Q TS + PA L+KA   D+D + PK LP + KS+E +EGNGGPGTIKKI+F E
Sbjct  2    GVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGPGTIKKITFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
              + K+  H+I+++D  N  YS+S++ G AL +    ++ + K+   P+GGS+ K +  Y
Sbjct  62   ASKFKYSKHRIDALDPENCTYSFSVIEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTKY 120
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            ++KGD    E++++A   K   L KAVEAYLLA+P
Sbjct  121  QTKGDFQLKEEQIQATIEKITGLSKAVEAYLLAHP 155

Sequence Alignment: 99. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 111.6 bits 439,  Expect = 1e-26
 Identities = 65/154 42%, Positives = 98/154 63%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +T S +  A L+K+   D D + PK  P +  SVE VEGNGGPGTIK I+F E
Sbjct  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 60
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                K+V  +++ +D  N+ YSY+++ G  L +  EK+  + K+   P GGS++K+S  +
Sbjct  61   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 120
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGD   N +E+K  K  ++ L++AVE YLLA+
Sbjct  121  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 154

Sequence Alignment: 100. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 111.6 bits 439,  Expect = 1e-26
 Identities = 64/154 41%, Positives = 100/154 64%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +T S +  A L+K+   D D + PK  P +  SVE V GNGGPGTIK I+F E
Sbjct  2    GVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                KFV  +++ +D AN+ Y+Y+++ G  L +  EK++ + K+   P GGS++K+S  +
Sbjct  62   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGD   N +++K  K  ++ L++AVE+YLLA+
Sbjct  122  HAKGDHEVNAEKMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 101. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 111.6 bits 439,  Expect = 1e-26
 Identities = 65/154 42%, Positives = 98/154 63%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +T S +  A L+K+   D D + PK  P +  SVE VEGNGGPGTIK I+F E
Sbjct  2    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                K+V  +++ +D  N+ YSY+++ G  L +  EK+  + K+   P GGS++K+S  +
Sbjct  62   GSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKF 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGD   N +E+K  K  ++ L++AVE YLLA+
Sbjct  122  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155

Sequence Alignment: 102. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 111.1 bits 437,  Expect = 1e-26
 Identities = 65/154 42%, Positives = 98/154 63%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +T S +  A L+K+   D D + PK  P +  SVE VEGNGGPGTIK I+F E
Sbjct  2    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                K+V  +++ +D  N+ YSY+++ G  L +  EK+  + K+   P GGS++K+S  +
Sbjct  62   GSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSKF 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGD   N +E+K  K  ++ L++AVE YLLA+
Sbjct  122  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155

Sequence Alignment: 103. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 110.8 bits 436,  Expect = 2e-26
 Identities = 64/154 41%, Positives = 99/154 64%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +T S +  A L+K+   D D + PK  P +  SVE V GNGGPGTIK I+F E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 60
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                KFV  +++ +D AN+ Y+Y+++ G  L +  EK++ + K+   P GGS++K+S  +
Sbjct  61   GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KG    N +E+K  K  ++ L++AVE+YLLA+
Sbjct  121  HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAH 154

Sequence Alignment: 104. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 110.6 bits 435,  Expect = 2e-26
 Identities = 66/154 42%, Positives = 103/154 66%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +TTS +  A L+KA   D D + PK  P +  SVE +EGNGGPGTIKKI+F E
Sbjct  2    GVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFPE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                K+V  +++ +D  N+ Y+YS++ G  + +T EKI+ + K+   P+GG ++K+S  Y
Sbjct  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNKY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KG+     +++KA K   ++L++AVE+YLLA+
Sbjct  122  HTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 105. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 110.4 bits 434,  Expect = 2e-26
 Identities = 65/154 42%, Positives = 103/154 66%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +TTS +  A L+KA   + D + PK  P +  SVE +EGNGGPGTIKKI+F E
Sbjct  2    GVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFPE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                K+V  +++ +D  N+ Y+YS++ G  + +T EKI+ + K+   P+GG ++K+S  Y
Sbjct  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNKY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KG+     +++KA K   ++L++AVE+YLLA+
Sbjct  122  HTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 106. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 110.1 bits 433,  Expect = 3e-26
 Identities = 64/154 41%, Positives = 100/154 64%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +T S +  A L+K+   D D + PK  P +  SVE V GNGGPGTIK I+F E
Sbjct  2    GVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                KFV  +++ +D AN+ +SY+++ G  L +  EK++++  +   P GGS++K+S  +
Sbjct  62   GSPFKFVKERVDEVDNANFKFSYTVIEGDVLGDKLEKVSLELTIVAAPGGGSILKISGKF 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGD   N +E+K  K  ++ L++AVE+YLLA+
Sbjct  122  HAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAH 155

Sequence Alignment: 107. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 109.4 bits 430,  Expect = 5e-26
 Identities = 64/154 41%, Positives = 102/154 66%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E + TS +  A ++KA   D D + PK  P +  SVE +EGNGGPGTIKKI+F E
Sbjct  2    GVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFPE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                K+V  +++ +D  N+ Y+YS++ G  + +T EKI+ + K+   P+GG ++K+S  Y
Sbjct  62   GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCVLKISNKY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KG+     +++KA K   ++L++AVE+YLLA+
Sbjct  122  HTKGNHEVKAEQVKASKEMGETLLRAVESYLLAH 155

Sequence Alignment: 108. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 108.7 bits 427,  Expect = 8e-26
 Identities = 64/154 41%, Positives = 97/154 62%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +T S ++ A L+K+   D D + PK  P +  SVE V GNGGPGTIK I+F E
Sbjct  2    GVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                K+V  +++ +D  N+ YSY+++ G  L +  EK+  + K+   P GGS +K+S  +
Sbjct  62   GSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSKF 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGD   N +E+K  K  ++ L++AVE YLLA+
Sbjct  122  HAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAH 155

Sequence Alignment: 109. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 108.2 bits 425,  Expect = 1e-25
 Identities = 63/150 42%, Positives = 100/150 66%, Gaps = 0/150 0%
Query  3    FTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVEDG 62
            F +E +TTS +  A L+KA   D D +FPK  P +  SV+ +EGNGGPGTIKKI+F E  
Sbjct  1    FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGPGTIKKINFPEGF 60
Query  63   ETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITYHS 122
              K+V  +++ +D  N+ Y+YS++ G  + +T EKI+ + K+   P+GG ++K+S  YH+
Sbjct  61   PFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVATPDGGCILKISNKYHT 120
Query  123  KGDAPPNEDELKAGKAKSDSLFKAVEAYLL 152
            KG+     +++KA K   ++L++AVE+YLL
Sbjct  121  KGNHEVKAEQVKASKEMGETLLRAVESYLL 150

Sequence Alignment: 110. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 108.2 bits 425,  Expect = 1e-25
 Identities = 67/155 43%, Positives = 99/155 63%, Gaps = 0/155 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GV T+  ++T+ ++P  L+KA+  D D + PK L    K+ E +EG+GG G+IK+++FVE
Sbjct  2    GVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFVE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
             G  K++ HKI  ID+ NL   YS++ G  L E  E IT+D K+    NGG + K +  Y
Sbjct  62   GGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTEY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            H+KGD   +E+E   G+ +  ++ KAVEAYLLANP
Sbjct  122  HTKGDHVVSEEEHNVGRERIMNISKAVEAYLLANP 156

Sequence Alignment: 111. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 108.0 bits 424,  Expect = 1e-25
 Identities = 63/154 40%, Positives = 98/154 63%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GVF +E +T S +  A L+K+   D D + PK  P    SVE V GNGGPGTIK I+F E
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAE 60
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                KFV  +++ +D AN+ Y+Y+++ G  L +  EK++ + K+   P GGS++K+S  +
Sbjct  61   GIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF 120
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KG    N +++K  K  ++ L++AVE+YLLA+
Sbjct  121  HAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAH 154

Sequence Alignment: 112. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 103.2 bits 404,  Expect = 3e-24
 Identities = 67/154 43%, Positives = 97/154 62%, Gaps = 1/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            G  T++ +  S ++   ++KA   D DTI PKALP +   V+ +EG+GG GTIK  +F E
Sbjct  2    GAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                K V H+I+ +D+ N+ YSYSI+ G AL +  E I++  K+   P+GG + K    Y
Sbjct  62   GSVHKSVKHRIDGLDKENFTYSYSIIEGGAL-DVFESISYHIKIVATPDGGCICKNRSIY 120
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
              K DA  +E+E+KAGK ++  +FK VEAYLLANP
Sbjct  121  TPKCDAQVSEEEIKAGKERASGIFKKVEAYLLANP 155

Sequence Alignment: 113. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 97.1 bits 378,  Expect = 2e-22
 Identities = 63/135 46%, Positives = 87/135 64%, Gaps = 1/135 0%
Query  10   TSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVEDGETKFVLH 69
            TS + P  L+KA   DAD + PK  P + KSVEI+EG+GG GT+KKI + E  E  +V H
Sbjct  2    TSVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVKH 61
Query  70   KIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITYHSKGDAPPN 129
            KI+ +D+ N+ YSYSI  G AL +  EKI+++ KL      GS+IK +  YH KG A   
Sbjct  62   KIDGLDKVNFVYSYSITEGDALGDKIEKISYEIKLV-ASGRGSIIKTTSHYHCKGGAEIK 120
Query  130  EDELKAGKAKSDSLFK 145
            E+++K GK ++  LFK
Sbjct  121  EEQVKDGKERAAGLFK 136

Sequence Alignment: 114. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 94.9 bits 369,  Expect = 1e-21
 Identities = 65/152 42%, Positives = 96/152 63%, Gaps = 3/152 1%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GV   E +  S V+   +Y+    D DT+FPK LP   KSVEI+EG+GG GT++ + + E
Sbjct  2    GVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVRLVHLGE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGP-NGGSLIKLSIT 119
              E   + +K++ ID+A LGY+Y+ +GG  L E  E +   +++   P +GG ++K +  
Sbjct  62   ATEYTTMKQKVDVIDKAGLGYTYTTIGGDILVEGLESVV--NQFVVVPTDGGCIVKNTTI 119
Query  120  YHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            Y++KGDA   ED++K    KS   FKAVEAYLLAN
Sbjct  120  YNTKGDAVLPEDKVKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 115. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 95.1 bits 370,  Expect = 1e-21
 Identities = 57/145 39%, Positives = 89/145 61%, Gaps = 0/145 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GV T+  ++T+ ++P  L+KA+  D D + PK L    K+ E +EG+GG G+IK+++FVE
Sbjct  2    GVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGGVGSIKQMNFVE 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
             G  K++ HKI  ID+ NL   YS++ G  L E  E IT+D K+    NGG + K +  Y
Sbjct  62   GGPIKYLKHKIHVIDDKNLETKYSLIEGDILGEKLESITYDIKFEANDNGGCVYKTTTEY 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFK 145
            H+KGD   +E+E   G+ ++   F+
Sbjct  122  HTKGDHVVSEEEHNVGRRENHEYFQ 146

Sequence Alignment: 116. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 91.3 bits 354,  Expect = 1e-20
 Identities = 61/145 42%, Positives = 92/145 63%, Gaps = 3/145 2%
Query  8    QTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVEDGETKFV 67
            +  S V+   +Y+    D DT+FPK LP   KSVEI+EG+GG GT+K + + E  E   +
Sbjct  9    EAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLGEATEYTTM 68
Query  68   LHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGP-NGGSLIKLSITYHSKGDA 126
             +K++ ID+A L Y+Y+ +GG  L +  E +   +++   P +GG ++K +  Y++KGDA
Sbjct  69   KQKVDVIDKAGLAYTYTTIGGDILVDVLESVV--NEFVVVPTDGGCIVKNTTIYNTKGDA 126
Query  127  PPNEDELKAGKAKSDSLFKAVEAYLLAN 154
               ED++K    KS   FKAVEAYLLAN
Sbjct  127  VLPEDKIKEATEKSALAFKAVEAYLLAN 154

Sequence Alignment: 117. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 87.7 bits 339,  Expect = 1e-19
 Identities = 57/153 37%, Positives = 93/153 60%, Gaps = 1/153 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GV T   + TS V+   +++    D DT++PKA P ++KSVEI +G+GGPGT+K I++ +
Sbjct  2    GVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLPD 60
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
             G    +  +I+ +++  L + YS++ G  L    E I     L    +GGS+ K +  +
Sbjct  61   GGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIF 120
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            H+KGDA   E+ +K    ++ +LFKA+EAYL+AN
Sbjct  121  HTKGDAVVPEENIKYANEQNTALFKALEAYLIAN 154

Sequence Alignment: 118. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 85.4 bits 329,  Expect = 8e-19
 Identities = 54/150 36%, Positives = 88/150 58%, Gaps = 0/150 0%
Query  6    EDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVEDGETK 65
            E + TS ++P+ ++KA   D DTI PKA P+++KS++ +EG+GG GTIK I++ +     
Sbjct  5    EFEITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYSDGVPFT 64
Query  66   FVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITYHSKGD 125
               HK+++ID  N+  SY+I  G  L    E  T   K+    +GGS+ K S+ +  KGD
Sbjct  65   SSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMVFKCKGD 124
Query  126  APPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            A   ++ +   K      FKA+E Y++++P
Sbjct  125  AKLTDENVSLMKEGLKKTFKAIETYVISHP 154

Sequence Alignment: 119. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 82.5 bits 317,  Expect = 6e-18
 Identities = 57/154 37%, Positives = 91/154 59%, Gaps = 0/154 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVE 60
            GV   E   TS V  A L+KA+  D DT++P+ LP + K  EI+EG+GG GT+K +++ +
Sbjct  2    GVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGGVGTVKLVTLGD 61
Query  61   DGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITY 120
                K + +KI++ID+  + +SYSI+ G  L    + I     +    +GG     +  +
Sbjct  62   ASPYKTMKQKIDAIDKEAFTFSYSIIDGDILLGYIDSINNHLSFVPTADGGCTATSTAVF 121
Query  121  HSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLAN 154
            ++KGDA   E+ +K    +++ +FKAVEAYLLAN
Sbjct  122  NTKGDAVVPEENIKFANDQNNLIFKAVEAYLLAN 155

Sequence Alignment: 120. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 81.8 bits 314,  Expect = 9e-18
 Identities = 50/146 34%, Positives = 88/146 60%, Gaps = 1/146 0%
Query  8    QTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVEDGETKFV 67
            + TS V+   ++  +  D DT+ PKA P ++KSV+ V+G+GG GT++ I++ E      +
Sbjct  9    EITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLPEGSPITSM 67
Query  68   LHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITYHSKGDAP 127
              + +++++  L Y  +++ G  L E  E I     +    +GGS+ K +  +H+KGDA 
Sbjct  68   TVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAV 127
Query  128  PNEDELKAGKAKSDSLFKAVEAYLLAN 154
              E+ +K   A++ +LFKA+EAYL+AN
Sbjct  128  VPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 121. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 81.3 bits 312,  Expect = 1e-17
 Identities = 50/146 34%, Positives = 88/146 60%, Gaps = 1/146 0%
Query  8    QTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVEDGETKFV 67
            + TS V+   ++  +  D DT+ PKA P ++KSV+ V+G+GG GT++ I++ E      +
Sbjct  23   EITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLPEGSPITSM 81
Query  68   LHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITYHSKGDAP 127
              + +++++  L Y  +++ G  L E  E I     +    +GGS+ K +  +H+KGDA 
Sbjct  82   TVRTDAVNKEALTYDSTVIDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAV 141
Query  128  PNEDELKAGKAKSDSLFKAVEAYLLAN 154
              E+ +K   A++ +LFKA+EAYL+AN
Sbjct  142  VPEENIKFADAQNTALFKAIEAYLIAN 168

Sequence Alignment: 122. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 80.4 bits 308,  Expect = 3e-17
 Identities = 50/146 34%, Positives = 87/146 59%, Gaps = 1/146 0%
Query  8    QTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVEDGETKFV 67
            + TS V+   ++  +  D DT+ PKA P ++KSVE V+G+GG GT++ I++ E      +
Sbjct  9    EITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVE-VKGDGGAGTVRIITLPEGSPITSM 67
Query  68   LHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITYHSKGDAP 127
              + +++++  L Y  +++ G  L    E I     +    +GGS+ K +  +H+KGDA 
Sbjct  68   TVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAIFHTKGDAV 127
Query  128  PNEDELKAGKAKSDSLFKAVEAYLLAN 154
              E+ +K   A++ +LFKA+EAYL+AN
Sbjct  128  VPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 123. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 78.7 bits 301,  Expect = 8e-17
 Identities = 49/146 33%, Positives = 86/146 58%, Gaps = 1/146 0%
Query  8    QTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVEDGETKFV 67
            + TS V+   ++  +  D DT+ PKA   ++KSVE V+G+GG GT++ I++ E      +
Sbjct  9    EITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLPEGSPITTM 67
Query  68   LHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITYHSKGDAP 127
              + +++++  L Y  +++ G  L    E I     +    +GGS+ K +  +H+KGDA 
Sbjct  68   TVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAIFHTKGDAV 127
Query  128  PNEDELKAGKAKSDSLFKAVEAYLLAN 154
              E+ +K   A++ +LFKA+EAYL+AN
Sbjct  128  VPEENIKFADAQNTALFKAIEAYLIAN 154

Sequence Alignment: 124. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 78.0 bits 298,  Expect = 1e-16
 Identities = 48/146 32%, Positives = 86/146 58%, Gaps = 1/146 0%
Query  8    QTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVEDGETKFV 67
            + TS V+   ++  +  D DT+ PKA P ++KSV+ V+G+GG GT++ I++ E      +
Sbjct  9    EITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVD-VKGDGGAGTVRIITLPEGSPITSM 67
Query  68   LHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKLSITYHSKGDAP 127
              + +++++  L Y  +++ G  L    E I     +    +GGS+ K +  +H+KGDA 
Sbjct  68   TVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAIFHTKGDAV 127
Query  128  PNEDELKAGKAKSDSLFKAVEAYLLAN 154
              E+ +K    ++ +LFKA+EAYL+AN
Sbjct  128  VPEENIKFADEQNTALFKAIEAYLIAN 154

Sequence Alignment: 125. Allergen Name: Fra a 1.0101 Sequence ID: Q5ULZ4

 Score = 57.5 bits 211,  Expect = 1e-10
 Identities = 39/96 40%, Positives = 59/96 61%, Gaps = 3/96 3%
Query  57   SFVEDGETKFVLHKIESIDEANLGYSYSIVGGVALPETAEKITFDSKLSDGPNGGSLIKL 116
            +FV D +  ++  KI +  E +  Y Y  V G AL +T EKI +++KL   P+  ++IK 
Sbjct  1    AFVLDADN-LIPKKI-TFGEGSQ-YGYVKVEGDALSDTLEKIDYETKLVSAPSSSTIIKT 57
Query  117  SITYHSKGDAPPNEDELKAGKAKSDSLFKAVEAYLLANP 155
            +  YH+KGD    E+ +KAGK K+  LFK +E YL  +P
Sbjct  58   TSKYHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHP 96

Sequence Alignment: 126. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 54.0 bits 195,  Expect = 7e-10
 Identities = 29/50 58%, Positives = 36/50 72%, Gaps = 0/50 0%
Query  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGP 50
            GVFT E Q TS +APA L+KA+  D+D +  K LP + KS EI+EGNGGP
Sbjct  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50

Sequence Alignment: 127. Allergen Name: Vig r 6.0101 Sequence ID: Q9ZWP8

 Score = 51.3 bits 186,  Expect = 1e-08
 Identities = 43/142 30%, Positives = 74/142 52%, Gaps = 9/142 6%
Query  5    FEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGPGTIKKISFVEDGET 64
            F  QT   V    L+  ++KD  T+ PK LP   K V+++EG+GG GTI   +F+ +   
Sbjct  5    FNTQTELSVRLEALWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLPEVSP 64
Query  65   KFVLHKIESIDEANLGYSYSIVGGVALPE--TAEKITFDSKLSDGPNGGSLIKLSITYHS 122
             +   +I   DE++      ++ G  L +  +  K TF  KLS+     +L+ + I+Y  
Sbjct  65   SYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTF--KLSEIEEDKTLVNVKISYDH 122
Query  123  KGDAPPNEDELKAGKAKSDSL--FKAVEAYL 151
              D    E+++   K    +L  ++ +E YL
Sbjct  123  DSDI---EEKVTPTKTSQSTLMYLRRLERYL 150

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.