The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP
Sequence Info Allergen Name Length Opt Bits Score E Value
P85126 Que a 1.0101 50 316 87.6 1.8e-20
ABZ81045 Que a 1.0201 159 316 87.8 4.9e-20
ABZ81047 Que a 1.0401 160 316 87.8 4.9e-20
QOL10866 Que ac 1.0101 159 266 75.0 3.4e-16
QGS84240 Que i 1.0101 159 263 74.2 5.8e-16
ABZ81046 Que a 1.0301 160 260 73.5 1e-15
APD76154 Jug r 5.0101 160 254 71.9 2.9e-15
ACJ23864 Fag s 1.0101 160 247 70.1 1e-14
AUH28179 Que m 1.0101 160 246 69.9 1.2e-14
CAA96549 Cor a 1.0301 160 236 67.3 7e-14
CAD10374 Cas s 1 160 234 66.8 9.9e-14
AAO25113 Mal d 1.0304 159 225 64.5 4.9e-13
AAK13027 Mal d 1.0302 159 225 64.5 4.9e-13
CAA04828.1 Bet v 1.0206 159 223 64.0 6.9e-13
O24248 Pru av 1 160 223 64.0 7e-13
Q2I6V8 Pru p 1.0101 160 223 64.0 7e-13
P43186 Bet v 1.0204 160 223 64.0 7e-13
AFN42528 Can s 5.0101 161 223 64.0 7e-13
AAD26555 Mal d 1.0107 159 220 63.3 1.2e-12
CAA07329.1 Bet v 1.0118 160 220 63.3 1.2e-12
Q39427 Bet v 1.0205 160 220 63.3 1.2e-12
CAA88833 Mal d 1.0102 159 219 63.0 1.4e-12
AAD26554 Mal d 1.0106 159 219 63.0 1.4e-12
CAA58646 Mal d 1.0101 159 219 63.0 1.4e-12
AAD29671 Mal d 1.0108 159 219 63.0 1.4e-12
AAD26546 Mal d 1.0103 159 219 63.0 1.4e-12
CAB02160 Bet v 1.0113 160 219 63.0 1.4e-12
CAA54696.1 Bet v 1.0301 160 219 63.0 1.4e-12
AAK13028 Mal d 1.0303 159 218 62.7 1.7e-12
AAD26552 Mal d 1.0104 159 218 62.7 1.7e-12
CAA96534 Mal d 1.0301 159 217 62.5 2e-12
CAA96535 Mal d 1.0401 160 217 62.5 2e-12
CAA54485 Bet v 1.0105 160 217 62.5 2e-12
CAD32318 Mal d 1.0208 158 215 62.0 2.8e-12
CAA04827.1 Bet v 1.0116 159 215 62.0 2.9e-12
CAB02157 Bet v 1.0110 160 215 62.0 2.9e-12
CAA96547 Bet v 1.0115 160 215 62.0 2.9e-12
CAA96537 Mal d 1.0403 160 215 62.0 2.9e-12
CAA54487 Bet v 1.0106 160 215 62.0 2.9e-12
CAB02155 Bet v 1.0108 160 215 62.0 2.9e-12
CAB02156 Bet v 1.0109 160 215 62.0 2.9e-12
CAB02161 Bet v 1.0114 160 215 62.0 2.9e-12
CAB02158 Bet v 1.0111 160 215 62.0 2.9e-12
CAA33887 Bet v 1.0101 160 215 62.0 2.9e-12
CAB02159 Bet v 1.0112 160 215 62.0 2.9e-12
CAA07323.1 Bet v 1.0117 160 215 62.0 2.9e-12
CAA54483 Bet v 1.0103 160 215 62.0 2.9e-12
CAA54482 Bet v 1.0102 160 214 61.7 3.4e-12
AAK13029 Mal d 1.0109 159 213 61.5 4.1e-12
AAD26553 Mal d 1.0105 159 213 61.5 4.1e-12
AAK13030 Mal d 1.0207 159 212 61.2 4.9e-12
AAD26548 Mal d 1.0204 159 212 61.2 4.9e-12
AAB01362 Mal d 1.0201 159 212 61.2 4.9e-12
AAD26558 Mal d 1.0205 159 212 61.2 4.9e-12
AAD26545 Mal d 1.0202 159 212 61.2 4.9e-12
O65200 Pyr c 1 159 212 61.2 4.9e-12
AAD26547 Mal d 1.0203 159 212 61.2 4.9e-12
O50001 Pru ar 1 160 212 61.2 4.9e-12
CAA96548 Cor a 1.0201 160 212 61.2 4.9e-12
CAB02217 Car b 1.0302 161 211 61.0 5.9e-12
AAG40331 Cor a 1.0404 161 211 61.0 5.9e-12
CAA96536 Mal d 1.0402 160 210 60.7 7e-12
CAA54481 Bet v 1.0202 160 210 60.7 7e-12
CAA54484 Bet v 1.0104 160 210 60.7 7e-12
CAA54489 Bet v 1.0107 160 210 60.7 7e-12
P43184 Bet v 1.0203 160 210 60.7 7e-12
AAD48405 Cor a 1.0401 161 208 60.2 1e-11
AAD13683 Mal d 1.0206 159 207 59.9 1.2e-11
CAA54421 Bet v 1.0201 160 207 59.9 1.2e-11
AAG40329 Cor a 1.0402 161 206 59.7 1.4e-11
ACF75030.1 Bet v 1.0207 150 204 59.2 1.9e-11
P38950 Car b 1 159 203 58.9 2.4e-11
CAA50325 Cor a 1.0103 160 203 58.9 2.4e-11
B6CQS9 Pru du 1.0101 160 203 58.9 2.4e-11
AAG40330 Cor a 1.0403 161 203 58.9 2.4e-11
CAB02216 Car b 1.0301 161 203 58.9 2.4e-11
ABC41615.1 Bet v 1.0119 150 198 57.6 5.5e-11
Q256S7 Fra a 1 160 198 57.6 5.8e-11
Q256S4 Fra a 1 159 197 57.4 6.9e-11
P38948 Aln g 1 159 197 57.4 6.9e-11
Q256S2 Fra a 1 160 197 57.4 7e-11
Q3T923 Fra a 1 160 197 57.4 7e-11
AAB24432 Aln g 1 160 197 57.4 7e-11
P25985 Pha v 1 155 195 56.9 9.6e-11
CAA43637 Pha v 1 156 195 56.9 9.7e-11
Q08407 Cor a 1 159 194 56.6 1.2e-10
CAA50327 Cor a 1.0101 160 194 56.6 1.2e-10
CAA50328 Cor a 1.0102 160 194 56.6 1.2e-10
CAA47357 Car b 1.0102 159 189 55.3 2.8e-10
CAB02206 Car b 1.0103 160 189 55.3 2.9e-10
ABZ81041 Car b 1.0110 160 189 55.3 2.9e-10
ABZ81043 Car b 1.0112 160 189 55.3 2.9e-10
ABZ81044 Car b 1.0113 160 189 55.3 2.9e-10
CAB02207 Car b 1.0104 160 189 55.3 2.9e-10
ABZ81042 Car b 1.0111 160 189 55.3 2.9e-10
ABZ81040 Car b 1.0109 160 189 55.3 2.9e-10
Q256S6 Fra a 1 160 189 55.3 2.9e-10
CAA50326 Cor a 1.0104 160 187 54.8 4.1e-10
Q0Z8U9 Rub i 1.0101 137 186 54.5 4.3e-10
CAB02209 Car b 1.0106 160 186 54.6 4.9e-10
CAB02208 Car b 1.0105 160 186 54.6 4.9e-10
CAB02213 Car b 1.0107 160 186 54.6 4.9e-10
P38949 Car b 1 159 184 54.1 6.9e-10
ADK39021 Ost c 1.0101 160 184 54.1 6.9e-10
CAB02215 Car b 1.0108 160 183 53.8 8.3e-10
EF436550 Ara h 8.0201 153 177 52.3 2.3e-09
NP_001275580 Sola l 4.0201 160 175 51.8 3.4e-09
AHC08073 Sola l 4.0101 160 174 51.5 4.1e-09
CAA75803 Lyc e 4.0101 178 174 51.5 4.5e-09
CAA43636 Pha v 1 155 171 50.7 6.7e-09
CAA42646 Gly m 4 158 171 50.7 6.9e-09
Q2VU97 Vig r 1.0101 155 161 48.2 4e-08
CAM31908 Act c 8.0101 159 158 47.4 6.9e-08
AAQ91847 Ara h 8.0101 157 156 46.9 9.7e-08
CAA67246 Pet c PR10 155 152 45.9 1.9e-07
AAL76932 Dau c 1.0201 154 143 43.6 9.5e-07
Q9S8Q4 Cas s 1 24 130 39.9 1.9e-06
CAM31909 Act d 8.0101 157 137 42.1 2.8e-06
P92918 Api g 1.0201 159 134 41.3 4.8e-06
P49372 Api g 1 154 124 38.7 2.7e-05
AAB92255 Tar o RAP 157 119 37.5 6.8e-05
CAB06416 Dau c 1.0105 154 111 35.4 0.00027
CAB03716 Dau c 1.0104 154 107 34.4 0.00056
BAA13604 Dau c 1.0102 154 107 34.4 0.00056
AAB01092 Dau c 1.0101 168 105 33.9 0.00086
CAB03715 Dau c 1.0103 154 100 32.6 0.0019
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Que a 1.0101 Sequence ID: P85126

 Score = 87.6 bits 316,  Expect = 2e-20
 Identities = 50/50 100%, Positives = 50/50 100%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP
Sbjct  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50

Sequence Alignment: 2. Allergen Name: Que a 1.0201 Sequence ID: ABZ81045

 Score = 87.8 bits 316,  Expect = 5e-20
 Identities = 50/50 100%, Positives = 50/50 100%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP
Sbjct  2    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 51

Sequence Alignment: 3. Allergen Name: Que a 1.0401 Sequence ID: ABZ81047

 Score = 87.8 bits 316,  Expect = 5e-20
 Identities = 50/50 100%, Positives = 50/50 100%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP
Sbjct  2    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 51

Sequence Alignment: 4. Allergen Name: Que ac 1.0101 Sequence ID: QOL10866

 Score = 75.0 bits 266,  Expect = 3e-16
 Identities = 41/50 82%, Positives = 46/50 92%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GV+ +ESQETSVI PARLFKA+ LDSDNLI KVLP+A+KSTEIIEGNGGP
Sbjct  2    GVYNYESQETSVIPPARLFKAFVLDSDNLISKVLPHAVKSTEIIEGNGGP 51

Sequence Alignment: 5. Allergen Name: Que i 1.0101 Sequence ID: QGS84240

 Score = 74.2 bits 263,  Expect = 6e-16
 Identities = 43/50 86%, Positives = 44/50 88%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GV THESQETSVI PARLFKA+ LDSDNLI KVLPQAIKS E IEGNGGP
Sbjct  2    GVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLPQAIKSIERIEGNGGP 51

Sequence Alignment: 6. Allergen Name: Que a 1.0301 Sequence ID: ABZ81046

 Score = 73.5 bits 260,  Expect = 1e-15
 Identities = 40/50 80%, Positives = 46/50 92%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVFT+ES++ SVI PARLFKA+ LDSDNLI KV+PQA+KSTEIIEGNGGP
Sbjct  2    GVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGP 51

Sequence Alignment: 7. Allergen Name: Jug r 5.0101 Sequence ID: APD76154

 Score = 71.9 bits 254,  Expect = 3e-15
 Identities = 38/50 76%, Positives = 46/50 92%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVFT+E++ TSVI PARLFKA+ LD+DNLI KV+PQA+KS+EIIEGNGGP
Sbjct  2    GVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGP 51

Sequence Alignment: 8. Allergen Name: Fag s 1.0101 Sequence ID: ACJ23864

 Score = 70.1 bits 247,  Expect = 1e-14
 Identities = 38/50 76%, Positives = 45/50 90%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVFT+ES+ T+VI PARLFKA+ LD+DNLI KV PQAIKS+EIIEG+GGP
Sbjct  2    GVFTYESETTTVITPARLFKAFVLDADNLIPKVAPQAIKSSEIIEGSGGP 51

Sequence Alignment: 9. Allergen Name: Que m 1.0101 Sequence ID: AUH28179

 Score = 69.9 bits 246,  Expect = 1e-14
 Identities = 38/50 76%, Positives = 44/50 88%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GV  +ES++ SVI PARLFKA+ LDSDNLI KV+PQA+KSTEIIEGNGGP
Sbjct  2    GVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVPQALKSTEIIEGNGGP 51

Sequence Alignment: 10. Allergen Name: Cor a 1.0301 Sequence ID: CAA96549

 Score = 67.3 bits 236,  Expect = 7e-14
 Identities = 37/50 74%, Positives = 42/50 84%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E++ TSVI PARLFK + LDSDNLI KV P+AIKS EIIEGNGGP
Sbjct  2    GVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGP 51

Sequence Alignment: 11. Allergen Name: Cas s 1 Sequence ID: CAD10374

 Score = 66.8 bits 234,  Expect = 1e-13
 Identities = 36/50 72%, Positives = 42/50 84%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVFTHE++ TS I P RLFKA+ LD+DNLI K+ P+AIKS EIIEGNGGP
Sbjct  2    GVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAPHAIKSAEIIEGNGGP 51

Sequence Alignment: 12. Allergen Name: Mal d 1.0304 Sequence ID: AAO25113

 Score = 64.5 bits 225,  Expect = 5e-13
 Identities = 34/49 69%, Positives = 42/49 85%, Gaps = 0/49 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG 49
            GVFT+ES+ TSVI PARLF A+ LD+DNLI K+ PQA+KS EI+EG+GG
Sbjct  2    GVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGG 50

Sequence Alignment: 13. Allergen Name: Mal d 1.0302 Sequence ID: AAK13027

 Score = 64.5 bits 225,  Expect = 5e-13
 Identities = 34/49 69%, Positives = 42/49 85%, Gaps = 0/49 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG 49
            GVFT+ES+ TSVI PARLF A+ LD+DNLI K+ PQA+KS EI+EG+GG
Sbjct  2    GVFTYESEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGG 50

Sequence Alignment: 14. Allergen Name: Bet v 1.0206 Sequence ID: CAA04828.1

 Score = 64.0 bits 223,  Expect = 7e-13
 Identities = 36/50 72%, Positives = 39/50 78%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +ES+ TSVI  ARLFKA+ LD DNLI KV PQAI S E IEGNGGP
Sbjct  1    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGP 50

Sequence Alignment: 15. Allergen Name: Pru av 1 Sequence ID: O24248

 Score = 64.0 bits 223,  Expect = 7e-13
 Identities = 33/50 66%, Positives = 42/50 84%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVFT+ES+ TS I P RLFKA+ LD+DNL+ K+ PQAIK +EI+EG+GGP
Sbjct  2    GVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGP 51

Sequence Alignment: 16. Allergen Name: Pru p 1.0101 Sequence ID: Q2I6V8

 Score = 64.0 bits 223,  Expect = 7e-13
 Identities = 33/50 66%, Positives = 42/50 84%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVFT+ES+ TS I P RLFKA+ LD+DNL+ K+ PQAIK +EI+EG+GGP
Sbjct  2    GVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGP 51

Sequence Alignment: 17. Allergen Name: Bet v 1.0204 Sequence ID: P43186

 Score = 64.0 bits 223,  Expect = 7e-13
 Identities = 36/50 72%, Positives = 39/50 78%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +ES+ TSVI  ARLFKA+ LD DNLI KV PQAI S E IEGNGGP
Sbjct  2    GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGP 51

Sequence Alignment: 18. Allergen Name: Can s 5.0101 Sequence ID: AFN42528

 Score = 64.0 bits 223,  Expect = 7e-13
 Identities = 33/49 67%, Positives = 41/49 83%, Gaps = 0/49 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG 49
            GVFT+ES+ TS IAPARLFKA+ LD DNL+ K+ PQA++  EI+EGNGG
Sbjct  2    GVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAPQAVEKVEILEGNGG 50

Sequence Alignment: 19. Allergen Name: Mal d 1.0107 Sequence ID: AAD26555

 Score = 63.3 bits 220,  Expect = 1e-12
 Identities = 33/50 66%, Positives = 41/50 82%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GV+T E++ TS I P+RLFKA+ LD+DNLI K+ PQAIK  EI+EGNGGP
Sbjct  2    GVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGP 51

Sequence Alignment: 20. Allergen Name: Bet v 1.0118 Sequence ID: CAA07329.1

 Score = 63.3 bits 220,  Expect = 1e-12
 Identities = 35/50 70%, Positives = 39/50 78%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E++ TSVI  ARLFKA+ LD DNLI KV PQAI S E IEGNGGP
Sbjct  2    GVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGP 51

Sequence Alignment: 21. Allergen Name: Bet v 1.0205 Sequence ID: Q39427

 Score = 63.3 bits 220,  Expect = 1e-12
 Identities = 35/50 70%, Positives = 39/50 78%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E++ TSVI  ARLFKA+ LD DNLI KV PQAI S E IEGNGGP
Sbjct  2    GVFNYETETTSVIPAARLFKAFILDGDNLIPKVAPQAISSVENIEGNGGP 51

Sequence Alignment: 22. Allergen Name: Mal d 1.0102 Sequence ID: CAA88833

 Score = 63.0 bits 219,  Expect = 1e-12
 Identities = 33/50 66%, Positives = 41/50 82%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GV+T E++ TS I P+RLFKA+ LD+DNLI K+ PQAIK  EI+EGNGGP
Sbjct  2    GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGP 51

Sequence Alignment: 23. Allergen Name: Mal d 1.0106 Sequence ID: AAD26554

 Score = 63.0 bits 219,  Expect = 1e-12
 Identities = 33/50 66%, Positives = 41/50 82%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GV+T E++ TS I P+RLFKA+ LD+DNLI K+ PQAIK  EI+EGNGGP
Sbjct  2    GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGP 51

Sequence Alignment: 24. Allergen Name: Mal d 1.0101 Sequence ID: CAA58646

 Score = 63.0 bits 219,  Expect = 1e-12
 Identities = 33/50 66%, Positives = 41/50 82%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GV+T E++ TS I P+RLFKA+ LD+DNLI K+ PQAIK  EI+EGNGGP
Sbjct  2    GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGP 51

Sequence Alignment: 25. Allergen Name: Mal d 1.0108 Sequence ID: AAD29671

 Score = 63.0 bits 219,  Expect = 1e-12
 Identities = 33/50 66%, Positives = 41/50 82%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GV+T E++ TS I P+RLFKA+ LD+DNLI K+ PQAIK  EI+EGNGGP
Sbjct  2    GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGP 51

Sequence Alignment: 26. Allergen Name: Mal d 1.0103 Sequence ID: AAD26546

 Score = 63.0 bits 219,  Expect = 1e-12
 Identities = 33/50 66%, Positives = 41/50 82%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GV+T E++ TS I P+RLFKA+ LD+DNLI K+ PQAIK  EI+EGNGGP
Sbjct  2    GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGP 51

Sequence Alignment: 27. Allergen Name: Bet v 1.0113 Sequence ID: CAB02160

 Score = 63.0 bits 219,  Expect = 1e-12
 Identities = 34/50 68%, Positives = 39/50 78%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E++ TSVI  ARLFKA+ LD DNL+ KV PQAI S E IEGNGGP
Sbjct  2    GVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGP 51

Sequence Alignment: 28. Allergen Name: Bet v 1.0301 Sequence ID: CAA54696.1

 Score = 63.0 bits 219,  Expect = 1e-12
 Identities = 33/50 66%, Positives = 40/50 80%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E + TSVIAPARLFK++ LD+DNLI KV P+ + S E IEGNGGP
Sbjct  2    GVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGP 51

Sequence Alignment: 29. Allergen Name: Mal d 1.0303 Sequence ID: AAK13028

 Score = 62.7 bits 218,  Expect = 2e-12
 Identities = 33/49 67%, Positives = 42/49 85%, Gaps = 0/49 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG 49
            GVFT+E + TSVI PARL+ A+ LD+DNLI K+ PQA+KSTEI+EG+GG
Sbjct  2    GVFTYEFEFTSVIPPARLYNAFVLDADNLIPKIAPQAVKSTEILEGDGG 50

Sequence Alignment: 30. Allergen Name: Mal d 1.0104 Sequence ID: AAD26552

 Score = 62.7 bits 218,  Expect = 2e-12
 Identities = 33/50 66%, Positives = 40/50 80%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GV+T E++ TS I P RLFKA+ LD+DNLI K+ PQAIK  EI+EGNGGP
Sbjct  2    GVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGP 51

Sequence Alignment: 31. Allergen Name: Mal d 1.0301 Sequence ID: CAA96534

 Score = 62.5 bits 217,  Expect = 2e-12
 Identities = 32/49 65%, Positives = 41/49 83%, Gaps = 0/49 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG 49
            GVF +E++ TSVI PARLF A+ LD+DNLI K+ PQA+KS EI+EG+GG
Sbjct  2    GVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAPQAVKSAEILEGDGG 50

Sequence Alignment: 32. Allergen Name: Mal d 1.0401 Sequence ID: CAA96535

 Score = 62.5 bits 217,  Expect = 2e-12
 Identities = 34/49 69%, Positives = 40/49 81%, Gaps = 0/49 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG 49
            GVF +E++ TSVI   RLFKA+ LD DNLI K+ PQAIKSTEIIEG+GG
Sbjct  2    GVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGG 50

Sequence Alignment: 33. Allergen Name: Bet v 1.0105 Sequence ID: CAA54485

 Score = 62.5 bits 217,  Expect = 2e-12
 Identities = 35/50 70%, Positives = 39/50 78%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +ES+ TSVI  ARLFKA+ L+ DNLI KV PQAI S E IEGNGGP
Sbjct  2    GVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGP 51

Sequence Alignment: 34. Allergen Name: Mal d 1.0208 Sequence ID: CAD32318

 Score = 62.0 bits 215,  Expect = 3e-12
 Identities = 32/50 64%, Positives = 41/50 82%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GV+T+E++ TS I P RLFKA+ LD+DNLI K+ PQAIK  EI+EG+GGP
Sbjct  1    GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGP 50

Sequence Alignment: 35. Allergen Name: Bet v 1.0116 Sequence ID: CAA04827.1

 Score = 62.0 bits 215,  Expect = 3e-12
 Identities = 34/50 68%, Positives = 38/50 76%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E++ TSVI  ARLFKA+ LD DNL  KV PQAI S E IEGNGGP
Sbjct  1    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGP 50

Sequence Alignment: 36. Allergen Name: Bet v 1.0110 Sequence ID: CAB02157

 Score = 62.0 bits 215,  Expect = 3e-12
 Identities = 34/50 68%, Positives = 38/50 76%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E++ TSVI  ARLFKA+ LD DNL  KV PQAI S E IEGNGGP
Sbjct  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGP 51

Sequence Alignment: 37. Allergen Name: Bet v 1.0115 Sequence ID: CAA96547

 Score = 62.0 bits 215,  Expect = 3e-12
 Identities = 34/50 68%, Positives = 38/50 76%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E++ TSVI  ARLFKA+ LD DNL  KV PQAI S E IEGNGGP
Sbjct  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGP 51

Sequence Alignment: 38. Allergen Name: Mal d 1.0403 Sequence ID: CAA96537

 Score = 62.0 bits 215,  Expect = 3e-12
 Identities = 34/49 69%, Positives = 40/49 81%, Gaps = 0/49 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG 49
            GVF +E++ TSVI   RLFKA+ LD DNLI K+ PQAIKSTEIIEG+GG
Sbjct  2    GVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTEIIEGDGG 50

Sequence Alignment: 39. Allergen Name: Bet v 1.0106 Sequence ID: CAA54487

 Score = 62.0 bits 215,  Expect = 3e-12
 Identities = 34/50 68%, Positives = 38/50 76%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E++ TSVI  ARLFKA+ LD DNL  KV PQAI S E IEGNGGP
Sbjct  2    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGP 51

Sequence Alignment: 40. Allergen Name: Bet v 1.0108 Sequence ID: CAB02155

 Score = 62.0 bits 215,  Expect = 3e-12
 Identities = 34/50 68%, Positives = 38/50 76%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E++ TSVI  ARLFKA+ LD DNL  KV PQAI S E IEGNGGP
Sbjct  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGP 51

Sequence Alignment: 41. Allergen Name: Bet v 1.0109 Sequence ID: CAB02156

 Score = 62.0 bits 215,  Expect = 3e-12
 Identities = 34/50 68%, Positives = 38/50 76%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E++ TSVI  ARLFKA+ LD DNL  KV PQAI S E IEGNGGP
Sbjct  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGP 51

Sequence Alignment: 42. Allergen Name: Bet v 1.0114 Sequence ID: CAB02161

 Score = 62.0 bits 215,  Expect = 3e-12
 Identities = 34/50 68%, Positives = 38/50 76%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E++ TSVI  ARLFKA+ LD DNL  KV PQAI S E IEGNGGP
Sbjct  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGP 51

Sequence Alignment: 43. Allergen Name: Bet v 1.0111 Sequence ID: CAB02158

 Score = 62.0 bits 215,  Expect = 3e-12
 Identities = 34/50 68%, Positives = 38/50 76%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E++ TSVI  ARLFKA+ LD DNL  KV PQAI S E IEGNGGP
Sbjct  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGP 51

Sequence Alignment: 44. Allergen Name: Bet v 1.0101 Sequence ID: CAA33887

 Score = 62.0 bits 215,  Expect = 3e-12
 Identities = 34/50 68%, Positives = 38/50 76%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E++ TSVI  ARLFKA+ LD DNL  KV PQAI S E IEGNGGP
Sbjct  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGP 51

Sequence Alignment: 45. Allergen Name: Bet v 1.0112 Sequence ID: CAB02159

 Score = 62.0 bits 215,  Expect = 3e-12
 Identities = 34/50 68%, Positives = 38/50 76%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E++ TSVI  ARLFKA+ LD DNL  KV PQAI S E IEGNGGP
Sbjct  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGP 51

Sequence Alignment: 46. Allergen Name: Bet v 1.0117 Sequence ID: CAA07323.1

 Score = 62.0 bits 215,  Expect = 3e-12
 Identities = 34/50 68%, Positives = 38/50 76%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E++ TSVI  ARLFKA+ LD DNL  KV PQAI S E IEGNGGP
Sbjct  2    GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGP 51

Sequence Alignment: 47. Allergen Name: Bet v 1.0103 Sequence ID: CAA54483

 Score = 62.0 bits 215,  Expect = 3e-12
 Identities = 34/50 68%, Positives = 38/50 76%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E++ TSVI  ARLFKA+ LD DNL  KV PQAI S E IEGNGGP
Sbjct  2    GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGP 51

Sequence Alignment: 48. Allergen Name: Bet v 1.0102 Sequence ID: CAA54482

 Score = 61.7 bits 214,  Expect = 3e-12
 Identities = 34/50 68%, Positives = 38/50 76%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E + TSVI  ARLFKA+ LD DNL+ KV PQAI S E IEGNGGP
Sbjct  2    GVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGP 51

Sequence Alignment: 49. Allergen Name: Mal d 1.0109 Sequence ID: AAK13029

 Score = 61.5 bits 213,  Expect = 4e-12
 Identities = 33/50 66%, Positives = 40/50 80%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GV T E++ TS I P+RLFKA+ LD+DNLI K+ PQAIK  EI+EGNGGP
Sbjct  2    GVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGP 51

Sequence Alignment: 50. Allergen Name: Mal d 1.0105 Sequence ID: AAD26553

 Score = 61.5 bits 213,  Expect = 4e-12
 Identities = 33/50 66%, Positives = 40/50 80%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GV T E++ TS I P+RLFKA+ LD+DNLI K+ PQAIK  EI+EGNGGP
Sbjct  2    GVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGP 51

Sequence Alignment: 51. Allergen Name: Mal d 1.0207 Sequence ID: AAK13030

 Score = 61.2 bits 212,  Expect = 5e-12
 Identities = 32/50 64%, Positives = 40/50 80%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GV+T E++ TS I P RLFKA+ LD+DNLI K+ PQAIK  EI+EG+GGP
Sbjct  2    GVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGP 51

Sequence Alignment: 52. Allergen Name: Mal d 1.0204 Sequence ID: AAD26548

 Score = 61.2 bits 212,  Expect = 5e-12
 Identities = 32/50 64%, Positives = 40/50 80%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GV+T E++ TS I P RLFKA+ LD+DNLI K+ PQAIK  EI+EG+GGP
Sbjct  2    GVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGP 51

Sequence Alignment: 53. Allergen Name: Mal d 1.0201 Sequence ID: AAB01362

 Score = 61.2 bits 212,  Expect = 5e-12
 Identities = 32/50 64%, Positives = 40/50 80%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GV+T E++ TS I P RLFKA+ LD+DNLI K+ PQAIK  EI+EG+GGP
Sbjct  2    GVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGP 51

Sequence Alignment: 54. Allergen Name: Mal d 1.0205 Sequence ID: AAD26558

 Score = 61.2 bits 212,  Expect = 5e-12
 Identities = 32/50 64%, Positives = 40/50 80%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GV+T E++ TS I P RLFKA+ LD+DNLI K+ PQAIK  EI+EG+GGP
Sbjct  2    GVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGP 51

Sequence Alignment: 55. Allergen Name: Mal d 1.0202 Sequence ID: AAD26545

 Score = 61.2 bits 212,  Expect = 5e-12
 Identities = 32/50 64%, Positives = 40/50 80%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GV+T E++ TS I P RLFKA+ LD+DNLI K+ PQAIK  EI+EG+GGP
Sbjct  2    GVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGP 51

Sequence Alignment: 56. Allergen Name: Pyr c 1 Sequence ID: O65200

 Score = 61.2 bits 212,  Expect = 5e-12
 Identities = 32/50 64%, Positives = 40/50 80%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            G++T E++ TS I P RLFKA+ LD+DNLI K+ PQAIK  EI+EGNGGP
Sbjct  2    GLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGP 51

Sequence Alignment: 57. Allergen Name: Mal d 1.0203 Sequence ID: AAD26547

 Score = 61.2 bits 212,  Expect = 5e-12
 Identities = 32/50 64%, Positives = 40/50 80%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GV+T E++ TS I P RLFKA+ LD+DNLI K+ PQAIK  EI+EG+GGP
Sbjct  2    GVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGP 51

Sequence Alignment: 58. Allergen Name: Pru ar 1 Sequence ID: O50001

 Score = 61.2 bits 212,  Expect = 5e-12
 Identities = 32/49 65%, Positives = 41/49 83%, Gaps = 0/49 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG 49
            GVFT+E++ TSVI P +LFKA+ LD+DNLI KV P A+K TEI+EG+GG
Sbjct  2    GVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGG 50

Sequence Alignment: 59. Allergen Name: Cor a 1.0201 Sequence ID: CAA96548

 Score = 61.2 bits 212,  Expect = 5e-12
 Identities = 32/50 64%, Positives = 39/50 78%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E++ TSVI  ARLFKA+ LD +NLI KV PQA+ S E +EGNGGP
Sbjct  2    GVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGP 51

Sequence Alignment: 60. Allergen Name: Car b 1.0302 Sequence ID: CAB02217

 Score = 61.0 bits 211,  Expect = 6e-12
 Identities = 32/50 64%, Positives = 39/50 78%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E++ TSVI  ARLFKA+ LD +NLI KV PQA+ S E +EGNGGP
Sbjct  2    GVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGP 51

Sequence Alignment: 61. Allergen Name: Cor a 1.0404 Sequence ID: AAG40331

 Score = 61.0 bits 211,  Expect = 6e-12
 Identities = 32/50 64%, Positives = 39/50 78%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF++E + TSVI PARLFK++ LD+DNLI KV PQ   S E +EGNGGP
Sbjct  2    GVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGP 51

Sequence Alignment: 62. Allergen Name: Mal d 1.0402 Sequence ID: CAA96536

 Score = 60.7 bits 210,  Expect = 7e-12
 Identities = 33/49 67%, Positives = 40/49 81%, Gaps = 0/49 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG 49
            GVF +E++ TSVI   RLFKA+ LD DNLI K+ PQAIKST+IIEG+GG
Sbjct  2    GVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGG 50

Sequence Alignment: 63. Allergen Name: Bet v 1.0202 Sequence ID: CAA54481

 Score = 60.7 bits 210,  Expect = 7e-12
 Identities = 34/50 68%, Positives = 38/50 76%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +ES+ TSVI  ARLFKA+ L+ D LI KV PQAI S E IEGNGGP
Sbjct  2    GVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGP 51

Sequence Alignment: 64. Allergen Name: Bet v 1.0104 Sequence ID: CAA54484

 Score = 60.7 bits 210,  Expect = 7e-12
 Identities = 34/50 68%, Positives = 37/50 74%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E + TSVI  ARLFKA+ LD DNL  KV PQAI S E IEGNGGP
Sbjct  2    GVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGP 51

Sequence Alignment: 65. Allergen Name: Bet v 1.0107 Sequence ID: CAA54489

 Score = 60.7 bits 210,  Expect = 7e-12
 Identities = 32/50 64%, Positives = 38/50 76%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E++ TSVI  AR+FKA+ LD D L+ KV PQAI S E IEGNGGP
Sbjct  2    GVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGP 51

Sequence Alignment: 66. Allergen Name: Bet v 1.0203 Sequence ID: P43184

 Score = 60.7 bits 210,  Expect = 7e-12
 Identities = 34/50 68%, Positives = 38/50 76%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +ES+ TSVI  ARLFKA+ L+ D LI KV PQAI S E IEGNGGP
Sbjct  2    GVFNYESETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGP 51

Sequence Alignment: 67. Allergen Name: Cor a 1.0401 Sequence ID: AAD48405

 Score = 60.2 bits 208,  Expect = 1e-11
 Identities = 32/50 64%, Positives = 38/50 76%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E + TSVI PARLFK++ LD+DNLI KV PQ   S E +EGNGGP
Sbjct  2    GVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGP 51

Sequence Alignment: 68. Allergen Name: Mal d 1.0206 Sequence ID: AAD13683

 Score = 59.9 bits 207,  Expect = 1e-11
 Identities = 31/50 62%, Positives = 39/50 78%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GV+T E++ TS I P RLFK + LD+DNLI K+ PQAIK  EI+EG+GGP
Sbjct  2    GVYTFENEYTSEIPPPRLFKGFVLDADNLIPKIAPQAIKHAEILEGDGGP 51

Sequence Alignment: 69. Allergen Name: Bet v 1.0201 Sequence ID: CAA54421

 Score = 59.9 bits 207,  Expect = 1e-11
 Identities = 33/50 66%, Positives = 38/50 76%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E++ TSVI  ARLFKA+ L+ D LI KV PQAI S E IEGNGGP
Sbjct  2    GVFNYETETTSVIPAARLFKAFILEGDTLIPKVAPQAISSVENIEGNGGP 51

Sequence Alignment: 70. Allergen Name: Cor a 1.0402 Sequence ID: AAG40329

 Score = 59.7 bits 206,  Expect = 1e-11
 Identities = 31/50 62%, Positives = 38/50 76%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF++E + TSVI PARLFK++ LD+DNLI KV PQ     E +EGNGGP
Sbjct  2    GVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGP 51

Sequence Alignment: 71. Allergen Name: Bet v 1.0207 Sequence ID: ACF75030.1

 Score = 59.2 bits 204,  Expect = 2e-11
 Identities = 33/48 68%, Positives = 37/48 77%, Gaps = 0/48 0%
Query  3    FTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            F +ES+ TSVI  ARLFKA+ L+ DNLI KV PQAI S E IEGNGGP
Sbjct  1    FNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGP 48

Sequence Alignment: 72. Allergen Name: Car b 1 Sequence ID: P38950

 Score = 58.9 bits 203,  Expect = 2e-11
 Identities = 31/50 62%, Positives = 38/50 76%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E++ TSVI  ARLFKA+ LD + LI KV PQA+ S E +EGNGGP
Sbjct  1    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGP 50

Sequence Alignment: 73. Allergen Name: Cor a 1.0103 Sequence ID: CAA50325

 Score = 58.9 bits 203,  Expect = 2e-11
 Identities = 32/50 64%, Positives = 37/50 74%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E++ TSVI  ARLFK+  LD D LI KV PQAI S E +EGNGGP
Sbjct  2    GVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGP 51

Sequence Alignment: 74. Allergen Name: Pru du 1.0101 Sequence ID: B6CQS9

 Score = 58.9 bits 203,  Expect = 2e-11
 Identities = 29/49 59%, Positives = 39/49 79%, Gaps = 0/49 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG 49
            G+FT+  + TSVI P RLFKAL L++D LI K+ PQ++KS EI+EG+GG
Sbjct  2    GIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAPQSVKSAEIVEGDGG 50

Sequence Alignment: 75. Allergen Name: Cor a 1.0403 Sequence ID: AAG40330

 Score = 58.9 bits 203,  Expect = 2e-11
 Identities = 31/50 62%, Positives = 37/50 74%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E + TSVI PARLFK++ LD+DNLI KV PQ     E +EGNGGP
Sbjct  2    GVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGP 51

Sequence Alignment: 76. Allergen Name: Car b 1.0301 Sequence ID: CAB02216

 Score = 58.9 bits 203,  Expect = 2e-11
 Identities = 31/50 62%, Positives = 38/50 76%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E++ TSVI  ARLFKA+ LD + LI KV PQA+ S E +EGNGGP
Sbjct  2    GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGP 51

Sequence Alignment: 77. Allergen Name: Bet v 1.0119 Sequence ID: ABC41615.1

 Score = 57.6 bits 198,  Expect = 6e-11
 Identities = 31/48 64%, Positives = 36/48 75%, Gaps = 0/48 0%
Query  3    FTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            F +E++ TSVI  ARLFKA+ LD DNL  KV PQAI S + IEGNGGP
Sbjct  1    FNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVQNIEGNGGP 48

Sequence Alignment: 78. Allergen Name: Fra a 1 Sequence ID: Q256S7

 Score = 57.6 bits 198,  Expect = 6e-11
 Identities = 30/50 60%, Positives = 40/50 80%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GV+T+E++ TS I   +LFKA+ LD+DNLI K+ PQAIK  EI+EG+GGP
Sbjct  2    GVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGP 51

Sequence Alignment: 79. Allergen Name: Fra a 1 Sequence ID: Q256S4

 Score = 57.4 bits 197,  Expect = 7e-11
 Identities = 29/50 58%, Positives = 40/50 80%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GV+T+E++ TS I   +LFKA+ LD+DNLI K+ PQA+K  EI+EG+GGP
Sbjct  2    GVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGP 51

Sequence Alignment: 80. Allergen Name: Aln g 1 Sequence ID: P38948

 Score = 57.4 bits 197,  Expect = 7e-11
 Identities = 30/50 60%, Positives = 37/50 74%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E++  SVI  ARLFKA+ LD D L+ KV P+A+ S E IEGNGGP
Sbjct  1    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGP 50

Sequence Alignment: 81. Allergen Name: Fra a 1 Sequence ID: Q256S2

 Score = 57.4 bits 197,  Expect = 7e-11
 Identities = 29/50 58%, Positives = 40/50 80%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GV+T+E++ TS I   +LFKA+ LD+DNLI K+ PQA+K  EI+EG+GGP
Sbjct  2    GVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGP 51

Sequence Alignment: 82. Allergen Name: Fra a 1 Sequence ID: Q3T923

 Score = 57.4 bits 197,  Expect = 7e-11
 Identities = 29/50 58%, Positives = 40/50 80%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GV+T+E++ TS I   +LFKA+ LD+DNLI K+ PQA+K  EI+EG+GGP
Sbjct  2    GVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGP 51

Sequence Alignment: 83. Allergen Name: Aln g 1 Sequence ID: AAB24432

 Score = 57.4 bits 197,  Expect = 7e-11
 Identities = 30/50 60%, Positives = 37/50 74%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E++  SVI  ARLFKA+ LD D L+ KV P+A+ S E IEGNGGP
Sbjct  2    GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGP 51

Sequence Alignment: 84. Allergen Name: Pha v 1 Sequence ID: P25985

 Score = 56.9 bits 195,  Expect = 1e-10
 Identities = 29/50 58%, Positives = 36/50 72%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVFT E Q TS +APA L+KA+  D+D +  K LP + KS EI+EGNGGP
Sbjct  1    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGP 50

Sequence Alignment: 85. Allergen Name: Pha v 1 Sequence ID: CAA43637

 Score = 56.9 bits 195,  Expect = 1e-10
 Identities = 29/50 58%, Positives = 36/50 72%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVFT E Q TS +APA L+KA+  D+D +  K LP + KS EI+EGNGGP
Sbjct  2    GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALPDSFKSVEIVEGNGGP 51

Sequence Alignment: 86. Allergen Name: Cor a 1 Sequence ID: Q08407

 Score = 56.6 bits 194,  Expect = 1e-10
 Identities = 31/50 62%, Positives = 35/50 70%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E +  SVI  ARLFK+  LD D LI KV PQAI S E +EGNGGP
Sbjct  1    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGP 50

Sequence Alignment: 87. Allergen Name: Cor a 1.0101 Sequence ID: CAA50327

 Score = 56.6 bits 194,  Expect = 1e-10
 Identities = 31/50 62%, Positives = 35/50 70%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E +  SVI  ARLFK+  LD D LI KV PQAI S E +EGNGGP
Sbjct  2    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGP 51

Sequence Alignment: 88. Allergen Name: Cor a 1.0102 Sequence ID: CAA50328

 Score = 56.6 bits 194,  Expect = 1e-10
 Identities = 31/50 62%, Positives = 35/50 70%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E +  SVI  ARLFK+  LD D LI KV PQAI S E +EGNGGP
Sbjct  2    GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGP 51

Sequence Alignment: 89. Allergen Name: Car b 1.0102 Sequence ID: CAA47357

 Score = 55.3 bits 189,  Expect = 3e-10
 Identities = 30/50 60%, Positives = 35/50 70%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E++  SVI  ARLFK+  LD D LI KV PQAI S E + GNGGP
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGP 50

Sequence Alignment: 90. Allergen Name: Car b 1.0103 Sequence ID: CAB02206

 Score = 55.3 bits 189,  Expect = 3e-10
 Identities = 30/50 60%, Positives = 35/50 70%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E++  SVI  ARLFK+  LD D LI KV PQAI S E + GNGGP
Sbjct  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGP 51

Sequence Alignment: 91. Allergen Name: Car b 1.0110 Sequence ID: ABZ81041

 Score = 55.3 bits 189,  Expect = 3e-10
 Identities = 30/50 60%, Positives = 35/50 70%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E++  SVI  ARLFK+  LD D LI KV PQAI S E + GNGGP
Sbjct  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGP 51

Sequence Alignment: 92. Allergen Name: Car b 1.0112 Sequence ID: ABZ81043

 Score = 55.3 bits 189,  Expect = 3e-10
 Identities = 30/50 60%, Positives = 35/50 70%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E++  SVI  ARLFK+  LD D LI KV PQAI S E + GNGGP
Sbjct  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGP 51

Sequence Alignment: 93. Allergen Name: Car b 1.0113 Sequence ID: ABZ81044

 Score = 55.3 bits 189,  Expect = 3e-10
 Identities = 30/50 60%, Positives = 35/50 70%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E++  SVI  ARLFK+  LD D LI KV PQAI S E + GNGGP
Sbjct  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGP 51

Sequence Alignment: 94. Allergen Name: Car b 1.0104 Sequence ID: CAB02207

 Score = 55.3 bits 189,  Expect = 3e-10
 Identities = 30/50 60%, Positives = 35/50 70%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E++  SVI  ARLFK+  LD D LI KV PQAI S E + GNGGP
Sbjct  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGP 51

Sequence Alignment: 95. Allergen Name: Car b 1.0111 Sequence ID: ABZ81042

 Score = 55.3 bits 189,  Expect = 3e-10
 Identities = 30/50 60%, Positives = 35/50 70%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E++  SVI  ARLFK+  LD D LI KV PQAI S E + GNGGP
Sbjct  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGP 51

Sequence Alignment: 96. Allergen Name: Car b 1.0109 Sequence ID: ABZ81040

 Score = 55.3 bits 189,  Expect = 3e-10
 Identities = 30/50 60%, Positives = 35/50 70%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E++  SVI  ARLFK+  LD D LI KV PQAI S E + GNGGP
Sbjct  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGP 51

Sequence Alignment: 97. Allergen Name: Fra a 1 Sequence ID: Q256S6

 Score = 55.3 bits 189,  Expect = 3e-10
 Identities = 29/50 58%, Positives = 39/50 78%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            G +T+E++ TS I   +LFKA+ LD+DNLI K+ PQAIK  EI+EG+GGP
Sbjct  2    GGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAIKCAEILEGDGGP 51

Sequence Alignment: 98. Allergen Name: Cor a 1.0104 Sequence ID: CAA50326

 Score = 54.8 bits 187,  Expect = 4e-10
 Identities = 30/50 60%, Positives = 35/50 70%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E +  SVI+ ARLFK+  LD D LI KV PQAI S E + GNGGP
Sbjct  2    GVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGP 51

Sequence Alignment: 99. Allergen Name: Rub i 1.0101 Sequence ID: Q0Z8U9

 Score = 54.5 bits 186,  Expect = 4e-10
 Identities = 28/40 70%, Positives = 34/40 85%, Gaps = 0/40 0%
Query  10   TSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG 49
            TSVI P +LFKA+ LD+DNLI K+ PQA+KS EIIEG+GG
Sbjct  2    TSVIPPPKLFKAFVLDADNLIPKIAPQAVKSVEIIEGDGG 41

Sequence Alignment: 100. Allergen Name: Car b 1.0106 Sequence ID: CAB02209

 Score = 54.6 bits 186,  Expect = 5e-10
 Identities = 30/50 60%, Positives = 35/50 70%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E++  SVI  ARLFK+  LD D LI KV PQAI S E + GNGGP
Sbjct  2    GVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGP 51

Sequence Alignment: 101. Allergen Name: Car b 1.0105 Sequence ID: CAB02208

 Score = 54.6 bits 186,  Expect = 5e-10
 Identities = 30/50 60%, Positives = 35/50 70%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E++  SVI  ARLFK+  LD D LI KV PQAI S E + GNGGP
Sbjct  2    GVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGP 51

Sequence Alignment: 102. Allergen Name: Car b 1.0107 Sequence ID: CAB02213

 Score = 54.6 bits 186,  Expect = 5e-10
 Identities = 30/50 60%, Positives = 35/50 70%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E++  SVI  ARLFK+  LD D LI KV PQAI S E + GNGGP
Sbjct  2    GVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGP 51

Sequence Alignment: 103. Allergen Name: Car b 1 Sequence ID: P38949

 Score = 54.1 bits 184,  Expect = 7e-10
 Identities = 29/50 58%, Positives = 34/50 68%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E++  SVI  ARLFK+  LD D LI KV PQ I S E + GNGGP
Sbjct  1    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGP 50

Sequence Alignment: 104. Allergen Name: Ost c 1.0101 Sequence ID: ADK39021

 Score = 54.1 bits 184,  Expect = 7e-10
 Identities = 29/50 58%, Positives = 34/50 68%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E++  SVI  ARLFK+  LD D LI KV PQAI   E + GNGGP
Sbjct  2    GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISKVENVGGNGGP 51

Sequence Alignment: 105. Allergen Name: Car b 1.0108 Sequence ID: CAB02215

 Score = 53.8 bits 183,  Expect = 8e-10
 Identities = 29/50 58%, Positives = 35/50 70%, Gaps = 0/50 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVF +E++  SV+  ARLFK+  LD D LI KV PQAI S E + GNGGP
Sbjct  2    GVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGP 51

Sequence Alignment: 106. Allergen Name: Ara h 8.0201 Sequence ID: EF436550

 Score = 52.3 bits 177,  Expect = 2e-09
 Identities = 28/49 57%, Positives = 36/49 73%, Gaps = 1/49 2%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GV T E + TS + PA+LFKA  +D D L  K++P AI+S EI+EGNGGP
Sbjct  2    GVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP-AIQSIEIVEGNGGP 50

Sequence Alignment: 107. Allergen Name: Sola l 4.0201 Sequence ID: NP_001275580

 Score = 51.8 bits 175,  Expect = 3e-09
 Identities = 28/45 62%, Positives = 36/45 80%, Gaps = 2/45 4%
Query  3    FTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG 49
            FTHES  T+ IAP RLFK L LD D+L+ K+L + +KS EI+EG+GG
Sbjct  6    FTHES--TTTIAPTRLFKGLVLDFDSLVPKLLSHDVKSIEIVEGDGG 50

Sequence Alignment: 108. Allergen Name: Sola l 4.0101 Sequence ID: AHC08073

 Score = 51.5 bits 174,  Expect = 4e-09
 Identities = 27/49 55%, Positives = 36/49 73%, Gaps = 0/49 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG 49
            GV T+  + T+ I+P RLFKAL LD DNL+ K+L Q +K+ E IEG+GG
Sbjct  2    GVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGG 50

Sequence Alignment: 109. Allergen Name: Lyc e 4.0101 Sequence ID: CAA75803

 Score = 51.5 bits 174,  Expect = 4e-09
 Identities = 27/49 55%, Positives = 36/49 73%, Gaps = 0/49 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG 49
            GV T+  + T+ I+P RLFKAL LD DNL+ K+L Q +K+ E IEG+GG
Sbjct  2    GVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLSQHVKNNETIEGDGG 50

Sequence Alignment: 110. Allergen Name: Pha v 1 Sequence ID: CAA43636

 Score = 50.7 bits 171,  Expect = 7e-09
 Identities = 27/48 56%, Positives = 35/48 72%, Gaps = 1/48 2%
Query  2    VFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            VFT E Q TS +APA L+KAL  D+D ++ K +  + KS EI+EGNGGP
Sbjct  3    VFTFEDQTTSPVAPATLYKALVKDADTIVPKAV-DSFKSVEIVEGNGGP 50

Sequence Alignment: 111. Allergen Name: Gly m 4 Sequence ID: CAA42646

 Score = 50.7 bits 171,  Expect = 7e-09
 Identities = 28/49 57%, Positives = 35/49 71%, Gaps = 1/49 2%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVFT E +  S +APA L+KAL  D+DN+I K L  + KS E +EGNGGP
Sbjct  2    GVFTFEDEINSPVAPATLYKALVTDADNVIPKAL-DSFKSVENVEGNGGP 50

Sequence Alignment: 112. Allergen Name: Vig r 1.0101 Sequence ID: Q2VU97

 Score = 48.2 bits 161,  Expect = 4e-08
 Identities = 26/48 54%, Positives = 35/48 72%, Gaps = 1/48 2%
Query  2    VFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            VFT + Q TS +APA L+ AL  D+DN+I K +  + +S EI+EGNGGP
Sbjct  3    VFTFDDQATSPVAPATLYNALAKDADNIIPKAVG-SFQSVEIVEGNGGP 50

Sequence Alignment: 113. Allergen Name: Act c 8.0101 Sequence ID: CAM31908

 Score = 47.4 bits 158,  Expect = 7e-08
 Identities = 23/48 47%, Positives = 35/48 72%, Gaps = 0/48 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNG 48
            GV T++ +  S + P +L+KA+ LD D L+ KVLP+AIK  +I+EG+G
Sbjct  2    GVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLPHAIKCVKILEGDG 49

Sequence Alignment: 114. Allergen Name: Ara h 8.0101 Sequence ID: AAQ91847

 Score = 46.9 bits 156,  Expect = 1e-07
 Identities = 24/48 50%, Positives = 36/48 75%, Gaps = 2/48 4%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GVFT E + TS + PA+L+ A+  D+D++  K++   +KS EI+EGNGGP
Sbjct  2    GVFTFEDEITSTVPPAKLYNAM-KDADSITPKIIDD-VKSVEIVEGNGGP 49

Sequence Alignment: 115. Allergen Name: Pet c PR10 Sequence ID: CAA67246

 Score = 45.9 bits 152,  Expect = 2e-07
 Identities = 27/49 55%, Positives = 33/49 67%, Gaps = 0/49 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG 49
            GV   E   TS +  A+LFKAL LD D L+ +VLP AIK  EI+EG+GG
Sbjct  2    GVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLPGAIKGGEILEGDGG 50

Sequence Alignment: 116. Allergen Name: Dau c 1.0201 Sequence ID: AAL76932

 Score = 43.6 bits 143,  Expect = 1e-06
 Identities = 21/49 42%, Positives = 33/49 67%, Gaps = 0/49 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG 49
            GV   E +  S ++  ++++ ++LD D +  KVLPQ IKS EI+EG+GG
Sbjct  2    GVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGG 50

Sequence Alignment: 117. Allergen Name: Cas s 1 Sequence ID: Q9S8Q4

 Score = 39.9 bits 130,  Expect = 2e-06
 Identities = 21/24 87%, Positives = 22/24 91%, Gaps = 0/24 0%
Query  1    GVFTHESQETSVIAPARLFKALFL 24
            GVFTHESQETSVI PARLFKA+ L
Sbjct  1    GVFTHESQETSVIPPARLFKAFVL 24

Sequence Alignment: 118. Allergen Name: Act d 8.0101 Sequence ID: CAM31909

 Score = 42.1 bits 137,  Expect = 3e-06
 Identities = 20/49 40%, Positives = 32/49 65%, Gaps = 0/49 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG 49
            G  T++ +  S I+  ++FKA+ LD D +I K LP+AI   + +EG+GG
Sbjct  2    GAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGG 50

Sequence Alignment: 119. Allergen Name: Api g 1.0201 Sequence ID: P92918

 Score = 41.3 bits 134,  Expect = 5e-06
 Identities = 20/49 40%, Positives = 32/49 65%, Gaps = 0/49 0%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG 49
            GV     +  S ++  ++++ ++LD D +  KVLPQ IKS EI+EG+GG
Sbjct  2    GVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGG 50

Sequence Alignment: 120. Allergen Name: Api g 1 Sequence ID: P49372

 Score = 38.7 bits 124,  Expect = 3e-05
 Identities = 20/49 40%, Positives = 32/49 65%, Gaps = 1/49 2%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP 50
            GV TH  + TS ++  ++F+ + +D D ++ K  P A KS EI +G+GGP
Sbjct  2    GVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGP 50

Sequence Alignment: 121. Allergen Name: Tar o RAP Sequence ID: AAB92255

 Score = 37.5 bits 119,  Expect = 7e-05
 Identities = 18/44 40%, Positives = 29/44 65%, Gaps = 0/44 0%
Query  6    ESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG 49
            E + TS ++P+ +FKA+ +D D +  K  P+  KS + IEG+GG
Sbjct  5    EFEITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGG 48

Sequence Alignment: 122. Allergen Name: Dau c 1.0105 Sequence ID: CAB06416

 Score = 35.4 bits 111,  Expect = 0.0003
 Identities = 18/48 37%, Positives = 29/48 60%, Gaps = 1/48 2%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG 49
            G  +H  + TS ++  ++F  + LD D +I K  P A KS E+ +G+GG
Sbjct  2    GAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVEV-KGDGG 49

Sequence Alignment: 123. Allergen Name: Dau c 1.0104 Sequence ID: CAB03716

 Score = 34.4 bits 107,  Expect = 0.0006
 Identities = 17/48 35%, Positives = 29/48 60%, Gaps = 1/48 2%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG 49
            G  +H  + TS ++  ++F  + LD D +I K  P A KS ++ +G+GG
Sbjct  2    GAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGG 49

Sequence Alignment: 124. Allergen Name: Dau c 1.0102 Sequence ID: BAA13604

 Score = 34.4 bits 107,  Expect = 0.0006
 Identities = 17/48 35%, Positives = 29/48 60%, Gaps = 1/48 2%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG 49
            G  +H  + TS ++  ++F  + LD D +I K  P A KS ++ +G+GG
Sbjct  2    GAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVDV-KGDGG 49

Sequence Alignment: 125. Allergen Name: Dau c 1.0101 Sequence ID: AAB01092

 Score = 33.9 bits 105,  Expect = 0.0009
 Identities = 17/48 35%, Positives = 29/48 60%, Gaps = 1/48 2%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG 49
            G  +H  + TS ++  ++F  + LD D +I K  P A KS ++ +G+GG
Sbjct  16   GAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAPGAYKSVDV-KGDGG 63

Sequence Alignment: 126. Allergen Name: Dau c 1.0103 Sequence ID: CAB03715

 Score = 32.6 bits 100,  Expect = 0.002
 Identities = 17/48 35%, Positives = 28/48 58%, Gaps = 1/48 2%
Query  1    GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGG 49
            G  +H  + TS ++  ++F  + LD D +I K    A KS E+ +G+GG
Sbjct  2    GAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEV-KGDGG 49

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.