The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN
LNEDNARSIPPKCGVNLPYTISLNIDCSRV
Sequence Info Allergen Name Length Opt Bits Score E Value
19846220 Tri a 14.0101 90 652 124.3 4.9e-31
AAA32970 Hor v 1 117 508 98.8 3e-23
CAA42832 Hor v 1 134 504 98.1 5.6e-23
P19656-1 Zea m 14.0101 120 390 77.9 6.1e-17
P19656-2 Zea m 14.0102 128 385 77.0 1.2e-16
A0AT29 Len c 3.0101 118 365 73.5 1.3e-15
ABX75045 Ara h 9.0201 92 335 68.1 4.1e-14
P81651 Pru ar 3 91 332 67.6 5.9e-14
P82534 Pru d 3 91 332 67.6 5.9e-14
P81402 Pru p 3 91 330 67.3 7.6e-14
CAB96876 Pru p 3 91 329 67.1 8.5e-14
CAH69206 Tri tu 14.0101 115 330 67.3 9.4e-14
Q9M5X8 Pru av 3 117 330 67.3 9.5e-14
A0A059SSZ0 Pun g 1.0201 120 330 67.3 9.7e-14
ADC80502 Pha v 3.0101 115 329 67.1 1.1e-13
Q8VX12 Fra a 3.0101 117 327 66.8 1.4e-13
AAL25839 Hev b 12 116 325 66.4 1.7e-13
Q9M5X7 Mal d 3 115 323 66.0 2.2e-13
ANC85023 Art gm 3.0102 117 320 65.5 3.3e-13
Q4PLT9 Fra a 3.0102 117 318 65.2 4.2e-13
ANC85020 Art ar 3.0102 116 317 65.0 4.7e-13
ANC85027 Art si 3.0102 116 317 65.0 4.7e-13
ACE07187 Art v 3.0202 116 317 65.0 4.7e-13
A0A510A9S3 Ara h 17.0101 93 314 64.4 5.5e-13
QIN55516 Art ca 3.0102 117 315 64.6 6e-13
Q0Z8V0 Rub i 3.0101 117 315 64.6 6e-13
ABY21307 Pla or 3.0101 118 315 64.6 6.1e-13
Q9M5X6 Pyr c 3 115 311 63.9 9.7e-13
ANC85022 Art gm 3.0101 117 311 63.9 9.8e-13
CAL07989 Pla a 3.0101 118 311 63.9 9.9e-13
ABX56711 Ara h 9.0101 116 310 63.7 1.1e-12
Q4PLT6 Fra a 3.0202 117 310 63.7 1.1e-12
W0U0V5 Can s 3.0101 91 308 63.4 1.1e-12
ANC85021 Art ca 3.0101 117 309 63.6 1.3e-12
ANC85017 Art an 3.0101 117 309 63.6 1.3e-12
P85894 Mor n 3.0101 91 307 63.2 1.3e-12
EU564845 Art v 3.0201 114 308 63.4 1.4e-12
ANC85024 Art la 3.0101 116 308 63.4 1.4e-12
ANC85019 Art ar 3.0101 116 308 63.4 1.4e-12
ACV04796 Api g 2 118 308 63.4 1.4e-12
XP_019446786 Lup an 3.0101 116 307 63.2 1.6e-12
ANC85018 Art an 3.0102 117 307 63.2 1.6e-12
ANC85025 Art la 3.0102 115 303 62.5 2.6e-12
EU564847 Art v 3.0301 117 303 62.5 2.6e-12
AAB42069 Lyc e 3 114 301 62.1 3.3e-12
P93224 Sola l 3.0101 114 301 62.1 3.3e-12
Q4PLU0 Fra a 3.0201 117 301 62.1 3.4e-12
AAK28533 Cor a 8 115 295 61.1 6.9e-12
ABU95411 Sin a 3.0101 92 292 60.5 8.1e-12
A0A161AT60 Pis s 3.0101 120 293 60.7 9.2e-12
A0A059STC4 Pun g 1.0101 120 293 60.7 9.2e-12
NP_001316123 Sola l 7.0101 115 292 60.6 1e-11
ANC85026 Art si 3.0101 116 292 60.6 1e-11
ADC80503 Pha v 3.0201 118 292 60.6 1e-11
ACN11576 Pru du 3.0101 123 289 60.0 1.5e-11
A0A059ST23 Pun g 1.0301 120 278 58.1 5.8e-11
P82007 Hel a 3.0101 116 246 52.4 2.9e-09
O04403 Par j 2 133 227 49.0 3.4e-08
P55958 Par j 2 133 216 47.1 1.3e-07
O04004 Amb a 6 118 209 45.8 2.7e-07
Q40905 Par j 1 138 198 43.9 1.2e-06
P43217 Par j 1 139 197 43.7 1.4e-06
O04404 Par j 1 176 195 43.4 2.2e-06
CAI94601 Par j 1.0103 139 193 43.0 2.3e-06
CAA54587 Par j 1.0101 133 185 41.6 5.8e-06
10998016 Cas s 8 36 118 29.6 0.0066
P0C088 Art v 3.0101 37 117 29.4 0.0077
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Tri a 14.0101 Sequence ID: 19846220

 Score = 124.3 bits 652,  Expect = 5e-31
 Identities = 90/90 100%, Positives = 90/90 100%, Gaps = 0/90 0%
Query  1    IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN 60
            IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN
Sbjct  1    IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN 60
Query  61   LNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            LNEDNARSIPPKCGVNLPYTISLNIDCSRV
Sbjct  61   LNEDNARSIPPKCGVNLPYTISLNIDCSRV 90

Sequence Alignment: 2. Allergen Name: Hor v 1 Sequence ID: AAA32970

 Score = 98.8 bits 508,  Expect = 3e-23
 Identities = 65/90 72%, Positives = 81/90 90%, Gaps = 0/90 0%
Query  1    IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN 60
            ++CG+VDS ++PCL+YVQGGPGPSG+CC+GV++LHNQA+S  DRQ+ CNCLKGIARGIHN
Sbjct  27   LNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHN 86
Query  61   LNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            LN +NA SIP KC VN+PYTIS +IDCSR+
Sbjct  87   LNLNNAASIPSKCNVNVPYTISPDIDCSRI 116

Sequence Alignment: 3. Allergen Name: Hor v 1 Sequence ID: CAA42832

 Score = 98.1 bits 504,  Expect = 6e-23
 Identities = 65/89 73%, Positives = 80/89 89%, Gaps = 0/89 0%
Query  1    IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN 60
            ++CG+VDS ++PCL+YVQGGPGPSG+CC+GV++LHNQA+S  DRQ+ CNCLKGIARGIHN
Sbjct  27   LNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHN 86
Query  61   LNEDNARSIPPKCGVNLPYTISLNIDCSR 89
            LN +NA SIP KC VN+PYTIS +IDCSR
Sbjct  87   LNLNNAASIPSKCNVNVPYTISPDIDCSR 115

Sequence Alignment: 4. Allergen Name: Zea m 14.0101 Sequence ID: P19656-1

 Score = 77.9 bits 390,  Expect = 6e-17
 Identities = 53/90 58%, Positives = 68/90 75%, Gaps = 1/90 1%
Query  1    IDCGHVDSLVRPCLSYVQG-GPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIH 59
            I CG+V S + PC+SY +G G GPS  CC GV++L+N AR+ +DR++ACNCLK  A G+ 
Sbjct  29   ISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVS 88
Query  60   NLNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
             LN  NA SIP KCGV++PYTIS + DCSRV
Sbjct  89   GLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119

Sequence Alignment: 5. Allergen Name: Zea m 14.0102 Sequence ID: P19656-2

 Score = 77.0 bits 385,  Expect = 1e-16
 Identities = 52/89 58%, Positives = 67/89 75%, Gaps = 1/89 1%
Query  1    IDCGHVDSLVRPCLSYVQG-GPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIH 59
            I CG+V S + PC+SY +G G GPS  CC GV++L+N AR+ +DR++ACNCLK  A G+ 
Sbjct  29   ISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVS 88
Query  60   NLNEDNARSIPPKCGVNLPYTISLNIDCSR 89
             LN  NA SIP KCGV++PYTIS + DCSR
Sbjct  89   GLNAGNAASIPSKCGVSIPYTISTSTDCSR 118

Sequence Alignment: 6. Allergen Name: Len c 3.0101 Sequence ID: A0AT29

 Score = 73.5 bits 365,  Expect = 1e-15
 Identities = 50/90 55%, Positives = 61/90 67%, Gaps = 0/90 0%
Query  1    IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN 60
            I CG V S + PCL+Y+ GGPGPS QCC GVK L   A +  DRQ+ACNCLK  A  I  
Sbjct  27   ISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITK 86
Query  61   LNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            LN +NA ++P KCGVN+PY IS   +C+ V
Sbjct  87   LNTNNAAALPGKCGVNIPYKISTTTNCNTV 116

Sequence Alignment: 7. Allergen Name: Ara h 9.0201 Sequence ID: ABX75045

 Score = 68.1 bits 335,  Expect = 4e-14
 Identities = 40/90 44%, Positives = 64/90 71%, Gaps = 0/90 0%
Query  1    IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN 60
            + CG+V+S + PC++++  G  PSG CC GV+ L   A++ +DRQ+ACNCLK  A  +H 
Sbjct  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
Query  61   LNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            LN+ NA ++P +CGV++PY IS + +C+ +
Sbjct  61   LNQGNAAALPGRCGVSIPYKISTSTNCATI 90

Sequence Alignment: 8. Allergen Name: Pru ar 3 Sequence ID: P81651

 Score = 67.6 bits 332,  Expect = 6e-14
 Identities = 42/90 46%, Positives = 64/90 71%, Gaps = 0/90 0%
Query  1    IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN 60
            I CG+V S + PC+ YV+GG      CC+G++N++N AR+  DR++ACNCLK ++  I  
Sbjct  1    ITCGQVSSSLAPCIGYVRGGGAVPPACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISG 60
Query  61   LNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            +N +NA ++P KCGVN+PY IS + +C+ V
Sbjct  61   VNPNNAAALPGKCGVNIPYKISASTNCATV 90

Sequence Alignment: 9. Allergen Name: Pru d 3 Sequence ID: P82534

 Score = 67.6 bits 332,  Expect = 6e-14
 Identities = 42/90 46%, Positives = 66/90 73%, Gaps = 0/90 0%
Query  1    IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN 60
            I CG+V S + PC++YV+GG      CC+G++N++N AR+ +DR++ACNCLK ++  I  
Sbjct  1    ITCGQVSSNLAPCINYVKGGGAVPPACCNGIRNVNNLARTTADRRAACNCLKQLSGSIPG 60
Query  61   LNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            +N +NA ++P KCGVN+PY IS + +C+ V
Sbjct  61   VNPNNAAALPGKCGVNVPYKISASTNCATV 90

Sequence Alignment: 10. Allergen Name: Pru p 3 Sequence ID: P81402

 Score = 67.3 bits 330,  Expect = 8e-14
 Identities = 41/90 45%, Positives = 64/90 71%, Gaps = 0/90 0%
Query  1    IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN 60
            I CG+V S + PC+ YV+GG      CC+G++N++N AR+  DRQ+ACNCLK ++  +  
Sbjct  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
Query  61   LNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            +N +NA ++P KCGV++PY IS + +C+ V
Sbjct  61   VNPNNAAALPGKCGVHIPYKISASTNCATV 90

Sequence Alignment: 11. Allergen Name: Pru p 3 Sequence ID: CAB96876

 Score = 67.1 bits 329,  Expect = 9e-14
 Identities = 41/90 45%, Positives = 64/90 71%, Gaps = 0/90 0%
Query  1    IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN 60
            I CG+V S + PC+ YV+GG      CC+G++N++N AR+  DRQ+ACNCLK ++  +  
Sbjct  1    ITCGQVSSSLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
Query  61   LNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            +N +NA ++P KCGV++PY IS + +C+ V
Sbjct  61   VNPNNAAALPGKCGVSIPYKISASTNCATV 90

Sequence Alignment: 12. Allergen Name: Tri tu 14.0101 Sequence ID: CAH69206

 Score = 67.3 bits 330,  Expect = 9e-14
 Identities = 44/87 50%, Positives = 62/87 71%, Gaps = 4/87 4%
Query  1    IDCGHVDSLVRPCLSYVQG-GPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIH 59
            + CG+V S + PC+SY +G G  PS  CC GV++L + ARS +D+Q+AC C+K  A G  
Sbjct  27   VSCGQVSSALSPCISYARGNGASPSAACCSGVRSLASSARSTADKQAACKCIKSAAAG-- 84
Query  60   NLNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
             LN   A  IP KCGV++PY IS ++DCS++
Sbjct  85   -LNAGKAAGIPTKCGVSVPYAISSSVDCSKI 114

Sequence Alignment: 13. Allergen Name: Pru av 3 Sequence ID: Q9M5X8

 Score = 67.3 bits 330,  Expect = 1e-13
 Identities = 40/90 44%, Positives = 66/90 73%, Gaps = 0/90 0%
Query  1    IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN 60
            + CG+V S + PC++YV+GG      CC+G++N++N A++ +DRQ+ACNCLK ++  +  
Sbjct  27   LTCGQVSSNLAPCIAYVRGGGAVPPACCNGIRNINNLAKTTADRQTACNCLKQLSASVPG 86
Query  61   LNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            +N +NA ++P KCGVN+PY IS + +C+ V
Sbjct  87   VNANNAAALPGKCGVNVPYKISPSTNCATV 116

Sequence Alignment: 14. Allergen Name: Pun g 1.0201 Sequence ID: A0A059SSZ0

 Score = 67.3 bits 330,  Expect = 1e-13
 Identities = 45/90 50%, Positives = 62/90 68%, Gaps = 1/90 1%
Query  1    IDCGHVDSLVRPCLSYVQGG-PGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIH 59
            + CG+V S + PC+ Y +G    PS  CC GV++L+N A++  DRQ+ACNCLK IAR I 
Sbjct  29   VTCGQVTSSLTPCIPYARGVVAAPSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSIT 88
Query  60   NLNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
             +N     ++P KCGV++PY IS + DCSRV
Sbjct  89   GINYGRVGALPGKCGVSIPYKISPSTDCSRV 119

Sequence Alignment: 15. Allergen Name: Pha v 3.0101 Sequence ID: ADC80502

 Score = 67.1 bits 329,  Expect = 1e-13
 Identities = 43/89 48%, Positives = 66/89 74%, Gaps = 2/89 2%
Query  1    IDCGHVDSLVRPCLSYVQ-GGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIH 59
            + CG+V S + PC++++Q GG  P+G CC+GV+N+ N ARS +DR+  CNCLK  A  + 
Sbjct  25   MTCGQVQSNLVPCVTFLQNGGFVPAG-CCNGVRNIMNSARSTADRRGICNCLKTAAGAVR 83
Query  60   NLNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
             LN +NA+++P KCGVN+PY IS + +C+ +
Sbjct  84   GLNPNNAQALPGKCGVNIPYKISTSTNCASI 114

Sequence Alignment: 16. Allergen Name: Fra a 3.0101 Sequence ID: Q8VX12

 Score = 66.8 bits 327,  Expect = 1e-13
 Identities = 43/90 47%, Positives = 60/90 66%, Gaps = 0/90 0%
Query  1    IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN 60
            I CG+V S + PCL+YV+ G      CC G++NL+  A++ +DRQ+ACNCLK  A GI  
Sbjct  27   ITCGQVASNISPCLTYVKSGGAVPAACCSGIRNLNGMAKTTADRQAACNCLKQAAGGIKG 86
Query  61   LNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            LN + A  +P KCGV++PY IS   +C+ V
Sbjct  87   LNPNLAAGLPGKCGVSVPYKISTTTNCAAV 116

Sequence Alignment: 17. Allergen Name: Hev b 12 Sequence ID: AAL25839

 Score = 66.4 bits 325,  Expect = 2e-13
 Identities = 42/90 46%, Positives = 61/90 67%, Gaps = 1/90 1%
Query  1    IDCGHVDSLVRPCLSYVQG-GPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIH 59
            I CG+V S + PCLSY++  GP P   CC+GV+ ++N A++ +DR++AC CLK  A  + 
Sbjct  25   ITCGQVQSALVPCLSYLKTTGPTPPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVK 84
Query  60   NLNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
             LN      +P KCGVN+PY ISL+ +C+ V
Sbjct  85   GLNPTTVAGLPGKCGVNIPYKISLSTNCATV 115

Sequence Alignment: 18. Allergen Name: Mal d 3 Sequence ID: Q9M5X7

 Score = 66.0 bits 323,  Expect = 2e-13
 Identities = 41/90 45%, Positives = 61/90 67%, Gaps = 0/90 0%
Query  1    IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN 60
            I CG+V S + PC+ YV+ G      CC+G++ ++  AR+ +DRQ+ACNCLK +A  I  
Sbjct  25   ITCGQVTSSLAPCIGYVRSGGAVPPACCNGIRTINGLARTTADRQTACNCLKNLAGSISG 84
Query  61   LNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            +N +NA  +P KCGVN+PY IS + +C+ V
Sbjct  85   VNPNNAAGLPGKCGVNVPYKISTSTNCATV 114

Sequence Alignment: 19. Allergen Name: Art gm 3.0102 Sequence ID: ANC85023

 Score = 65.5 bits 320,  Expect = 3e-13
 Identities = 44/89 49%, Positives = 61/89 68%, Gaps = 2/89 2%
Query  1    IDCGHVDSLVRPCLSYV-QGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIH 59
            + C  V + + PCLS++ QGG  P+  CC GVK L++ A++  DRQ+ACNCLK   +   
Sbjct  27   LTCSDVSNKISPCLSFLKQGGEVPA-DCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNK 85
Query  60   NLNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            +L  DNA  +P KCGVN+PY ISL  DC++V
Sbjct  86   DLKSDNAVVLPSKCGVNIPYKISLETDCNKV 116

Sequence Alignment: 20. Allergen Name: Fra a 3.0102 Sequence ID: Q4PLT9

 Score = 65.2 bits 318,  Expect = 4e-13
 Identities = 41/90 45%, Positives = 59/90 65%, Gaps = 0/90 0%
Query  1    IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN 60
            I CG+V S + PC++YV+ G      CC G++NL+  A++ +DRQ+ CNCLK  A GI  
Sbjct  27   ITCGQVASNISPCVTYVKSGGAVPAPCCSGIRNLNGMAKTTADRQATCNCLKQAAGGIKG 86
Query  61   LNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            LN + A  +P KCGV++PY IS   +C+ V
Sbjct  87   LNPNLAAGLPGKCGVSVPYKISTTTNCAAV 116

Sequence Alignment: 21. Allergen Name: Art ar 3.0102 Sequence ID: ANC85020

 Score = 65.0 bits 317,  Expect = 5e-13
 Identities = 44/89 49%, Positives = 61/89 68%, Gaps = 2/89 2%
Query  1    IDCGHVDSLVRPCLSYV-QGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIH 59
            + C  V + + PCL+Y+ QGG  P+  CC GVK L++ A++  DRQ+ACNCLK   +   
Sbjct  26   LTCSDVSNKITPCLNYLKQGGEVPA-DCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNK 84
Query  60   NLNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            +L  D A S+P KCGVN+PY ISL  DC++V
Sbjct  85   DLKSDFAASLPSKCGVNIPYKISLETDCNKV 115

Sequence Alignment: 22. Allergen Name: Art si 3.0102 Sequence ID: ANC85027

 Score = 65.0 bits 317,  Expect = 5e-13
 Identities = 44/89 49%, Positives = 61/89 68%, Gaps = 2/89 2%
Query  1    IDCGHVDSLVRPCLSYV-QGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIH 59
            + C  V + + PCL+Y+ QGG  P+  CC GVK L++ A++  DRQ+ACNCLK   +   
Sbjct  26   LTCSDVSNKITPCLNYLKQGGEVPA-DCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNK 84
Query  60   NLNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            +L  D A S+P KCGVN+PY ISL  DC++V
Sbjct  85   DLKSDFAASLPSKCGVNIPYKISLETDCNKV 115

Sequence Alignment: 23. Allergen Name: Art v 3.0202 Sequence ID: ACE07187

 Score = 65.0 bits 317,  Expect = 5e-13
 Identities = 44/89 49%, Positives = 61/89 68%, Gaps = 2/89 2%
Query  1    IDCGHVDSLVRPCLSYV-QGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIH 59
            + C  V + + PCL+Y+ QGG  P+  CC GVK L++ A++  DRQ+ACNCLK   +   
Sbjct  26   LTCSDVSNKITPCLNYLKQGGEVPA-DCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNK 84
Query  60   NLNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            +L  D A S+P KCGVN+PY ISL  DC++V
Sbjct  85   DLKSDFAASLPSKCGVNIPYKISLETDCNKV 115

Sequence Alignment: 24. Allergen Name: Ara h 17.0101 Sequence ID: A0A510A9S3

 Score = 64.4 bits 314,  Expect = 6e-13
 Identities = 40/90 44%, Positives = 61/90 67%, Gaps = 1/90 1%
Query  1    IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN 60
            I C  V   + PC+ Y++ G   SG CC G++N++  A++ SDRQ+ CNCLK  A  + +
Sbjct  2    IQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGS 61
Query  61   -LNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
             +N +NA S+P KCGV++PY IS +I+CS +
Sbjct  62   QINPNNAASLPGKCGVSIPYKISTSINCSSI 92

Sequence Alignment: 25. Allergen Name: Art ca 3.0102 Sequence ID: QIN55516

 Score = 64.6 bits 315,  Expect = 6e-13
 Identities = 44/89 49%, Positives = 59/89 66%, Gaps = 2/89 2%
Query  1    IDCGHVDSLVRPCLSYV-QGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIH 59
            + C  V + + PCLS++ QGG  P+  CC GVK L++ A++  DRQ ACNCLK   +   
Sbjct  27   LTCSDVSNKITPCLSFLKQGGEVPA-DCCTGVKGLNDAAKTGPDRQKACNCLKTTFKSNK 85
Query  60   NLNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            +L  DNA  +P KCGVN+PY ISL  DC+ V
Sbjct  86   DLKSDNAVVLPSKCGVNIPYKISLETDCNTV 116

Sequence Alignment: 26. Allergen Name: Rub i 3.0101 Sequence ID: Q0Z8V0

 Score = 64.6 bits 315,  Expect = 6e-13
 Identities = 42/90 46%, Positives = 59/90 65%, Gaps = 0/90 0%
Query  1    IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN 60
            I CG+V   V PC++YV+ G      CC+GV+NL++QA++ +DRQ  CNCLK  A  I  
Sbjct  27   ITCGQVTQNVAPCFNYVKNGGAVPAACCNGVRNLNSQAKTTADRQQTCNCLKNAAGSIPG 86
Query  61   LNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            LN   A  +P KCGV++PY IS + +C+ V
Sbjct  87   LNPSLAAGLPGKCGVSVPYKISTSTNCATV 116

Sequence Alignment: 27. Allergen Name: Pla or 3.0101 Sequence ID: ABY21307

 Score = 64.6 bits 315,  Expect = 6e-13
 Identities = 44/90 48%, Positives = 59/90 65%, Gaps = 0/90 0%
Query  1    IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN 60
            I CG V + + PCL+Y++ G   +  CC+GVK L+N A++  DRQ+AC CLK  +  I  
Sbjct  28   ITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNNDAKTTPDRQAACGCLKTASTSISG 87
Query  61   LNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            +   NA S+  KCGVNLPY IS  IDCS+V
Sbjct  88   IQLGNAASLAGKCGVNLPYKISPTIDCSKV 117

Sequence Alignment: 28. Allergen Name: Pyr c 3 Sequence ID: Q9M5X6

 Score = 63.9 bits 311,  Expect = 1e-12
 Identities = 39/90 43%, Positives = 60/90 66%, Gaps = 0/90 0%
Query  1    IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN 60
            I C +V + + PC++YV+ G      CC+G+K ++  A++  DRQ+ACNCLK +A  +  
Sbjct  25   ITCSQVSANLAPCINYVRSGGAVPPACCNGIKTINGLAKTTPDRQAACNCLKNLAGSVSG 84
Query  61   LNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            +N  NA S+P KCGVN+PY IS + +C+ V
Sbjct  85   VNPGNAESLPGKCGVNVPYKISTSTNCATV 114

Sequence Alignment: 29. Allergen Name: Art gm 3.0101 Sequence ID: ANC85022

 Score = 63.9 bits 311,  Expect = 1e-12
 Identities = 42/89 47%, Positives = 60/89 67%, Gaps = 2/89 2%
Query  1    IDCGHVDSLVRPCLSYV-QGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIH 59
            + C  V + + PC S++ QGG  P+  CC GVK L++ A++  DRQ+ACNCLK   +   
Sbjct  27   LTCSDVSNKISPCTSFLKQGGEVPA-DCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNK 85
Query  60   NLNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            ++  DNA  +P KCGVN+PY ISL  DC++V
Sbjct  86   DFKSDNAAVLPSKCGVNIPYKISLETDCNKV 116

Sequence Alignment: 30. Allergen Name: Pla a 3.0101 Sequence ID: CAL07989

 Score = 63.9 bits 311,  Expect = 1e-12
 Identities = 43/90 47%, Positives = 59/90 65%, Gaps = 0/90 0%
Query  1    IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN 60
            I CG V + + PCL++++ G   +  CC+GVK L+N A++  DRQ+AC CLK  +  I  
Sbjct  28   ITCGTVVTRLTPCLTFLRSGGAVAPACCNGVKALNNDAKTTPDRQAACGCLKTASTSISG 87
Query  61   LNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            +   NA S+  KCGVNLPY IS  IDCS+V
Sbjct  88   IQLGNAASLAGKCGVNLPYKISPTIDCSKV 117

Sequence Alignment: 31. Allergen Name: Ara h 9.0101 Sequence ID: ABX56711

 Score = 63.7 bits 310,  Expect = 1e-12
 Identities = 38/90 42%, Positives = 59/90 65%, Gaps = 0/90 0%
Query  1    IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN 60
            I CG+V+S + PC+ ++  G  P   CC GV+ L    R+ +DRQ+ACNCLK  A  +  
Sbjct  25   ISCGQVNSALAPCIPFLTKGGAPPPACCSGVRGLLGALRTTADRQAACNCLKAAAGSLRG 84
Query  61   LNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            LN+ NA ++P +CGV++PY IS + +C+ +
Sbjct  85   LNQGNAAALPGRCGVSIPYKISTSTNCATI 114

Sequence Alignment: 32. Allergen Name: Fra a 3.0202 Sequence ID: Q4PLT6

 Score = 63.7 bits 310,  Expect = 1e-12
 Identities = 39/90 43%, Positives = 61/90 67%, Gaps = 0/90 0%
Query  1    IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN 60
            I CG+V S + PC++YV+ G      CC+G+++L++ A++ +DRQ+ CNCLK  +  I  
Sbjct  27   ITCGQVASSISPCVNYVKSGGAVPAACCNGIRSLNSAAKTTADRQTTCNCLKQASGAIKG 86
Query  61   LNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            LN + A  +P KCGVN+PY IS + +C+ V
Sbjct  87   LNPNLAAGLPGKCGVNVPYKISTSTNCAAV 116

Sequence Alignment: 33. Allergen Name: Can s 3.0101 Sequence ID: W0U0V5

 Score = 63.4 bits 308,  Expect = 1e-12
 Identities = 44/89 49%, Positives = 61/89 68%, Gaps = 2/89 2%
Query  1    IDCGHVDSLVRPCLSYVQ-GGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIH 59
            I CG+V S + PCLSY++ GG  P G CC+ +K+L   A++ +DRQ+AC CLK  A  I 
Sbjct  1    ITCGQVASSLAPCLSYLKVGGAVPDG-CCNDIKSLSGAAKTPADRQAACKCLKSAASSIK 59
Query  60   NLNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
             +N + A  +P KCGV++PY IS + DCS V
Sbjct  60   GVNFNLASGLPGKCGVSIPYKISPSTDCSSV 90

Sequence Alignment: 34. Allergen Name: Art ca 3.0101 Sequence ID: ANC85021

 Score = 63.6 bits 309,  Expect = 1e-12
 Identities = 40/90 44%, Positives = 58/90 64%, Gaps = 0/90 0%
Query  1    IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN 60
            + C  V + + PC S+++ G   S  CC GVK L++ A++  DRQ+ACNCLK   +   +
Sbjct  27   LTCSDVSNKILPCTSFLKQGGEVSADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKD 86
Query  61   LNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            +  DNA  +P KCGVN+PY ISL  DC++V
Sbjct  87   FKSDNAVVLPSKCGVNIPYKISLETDCNKV 116

Sequence Alignment: 35. Allergen Name: Art an 3.0101 Sequence ID: ANC85017

 Score = 63.6 bits 309,  Expect = 1e-12
 Identities = 40/90 44%, Positives = 58/90 64%, Gaps = 0/90 0%
Query  1    IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN 60
            + C  V + + PC S+++ G   S  CC GVK L++ A++  DRQ+ACNCLK   +   +
Sbjct  27   LTCSDVSNKILPCTSFLKQGGEVSADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKD 86
Query  61   LNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            +  DNA  +P KCGVN+PY ISL  DC++V
Sbjct  87   FKSDNAVVLPSKCGVNIPYKISLETDCNKV 116

Sequence Alignment: 36. Allergen Name: Mor n 3.0101 Sequence ID: P85894

 Score = 63.2 bits 307,  Expect = 1e-12
 Identities = 41/90 45%, Positives = 60/90 66%, Gaps = 0/90 0%
Query  1    IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN 60
            I CG+V S + PC++Y++ G      CC+GV++L+N A++ +DRQ+ACNCLK     I  
Sbjct  1    ITCGQVSSSLAPCINYLRAGGVVPANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKG 60
Query  61   LNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            LN + A  +P KCGV++PY IS + DC  V
Sbjct  61   LNLNLAAGLPGKCGVSVPYKISPSTDCKSV 90

Sequence Alignment: 37. Allergen Name: Art v 3.0201 Sequence ID: EU564845

 Score = 63.4 bits 308,  Expect = 1e-12
 Identities = 43/89 48%, Positives = 60/89 67%, Gaps = 2/89 2%
Query  1    IDCGHVDSLVRPCLSYV-QGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIH 59
            + C  V + +  CLSY+ QGG  P+  CC GVK L++ A++  DRQ+ACNCLK   +   
Sbjct  24   LKCSDVSNKISACLSYLKQGGEVPA-DCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNK 82
Query  60   NLNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            ++  D A S+P KCGVN+PY ISL  DC++V
Sbjct  83   DFKSDFAASLPSKCGVNIPYKISLETDCNKV 113

Sequence Alignment: 38. Allergen Name: Art la 3.0101 Sequence ID: ANC85024

 Score = 63.4 bits 308,  Expect = 1e-12
 Identities = 43/89 48%, Positives = 60/89 67%, Gaps = 2/89 2%
Query  1    IDCGHVDSLVRPCLSYV-QGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIH 59
            + C  V + +  CLSY+ QGG  P+  CC GVK L++ A++  DRQ+ACNCLK   +   
Sbjct  26   LKCSDVSNKISACLSYLKQGGEVPA-DCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNK 84
Query  60   NLNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            ++  D A S+P KCGVN+PY ISL  DC++V
Sbjct  85   DFKSDFAASLPSKCGVNIPYKISLETDCNKV 115

Sequence Alignment: 39. Allergen Name: Art ar 3.0101 Sequence ID: ANC85019

 Score = 63.4 bits 308,  Expect = 1e-12
 Identities = 43/89 48%, Positives = 60/89 67%, Gaps = 2/89 2%
Query  1    IDCGHVDSLVRPCLSYV-QGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIH 59
            + C  V + +  CLSY+ QGG  P+  CC GVK L++ A++  DRQ+ACNCLK   +   
Sbjct  26   LKCSDVSNKISACLSYLKQGGEVPA-DCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNK 84
Query  60   NLNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            ++  D A S+P KCGVN+PY ISL  DC++V
Sbjct  85   DFKSDFAASLPSKCGVNIPYKISLETDCNKV 115

Sequence Alignment: 40. Allergen Name: Api g 2 Sequence ID: ACV04796

 Score = 63.4 bits 308,  Expect = 1e-12
 Identities = 40/90 44%, Positives = 59/90 65%, Gaps = 0/90 0%
Query  1    IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN 60
            + CG+V   +  CL Y++GG  PS  CC GVK L++ A++ +DR+ AC CLK +A  +  
Sbjct  28   LTCGQVTGKLGGCLGYLKGGGYPSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKG 87
Query  61   LNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            +N   A ++P KCG+ +PY IS + DCSRV
Sbjct  88   INYGAASALPGKCGIRIPYPISPSTDCSRV 117

Sequence Alignment: 41. Allergen Name: Lup an 3.0101 Sequence ID: XP_019446786

 Score = 63.2 bits 307,  Expect = 2e-12
 Identities = 40/90 44%, Positives = 59/90 65%, Gaps = 0/90 0%
Query  1    IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN 60
            I CG+V + +  CL+Y++ G      CC+G+KN+ N A++  DR++ACNCLK  A     
Sbjct  26   ITCGQVTANLAQCLNYLRSGGAVPAPCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPG 85
Query  61   LNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            LN  NA S+P KCGVN+PY IS + +C+ +
Sbjct  86   LNPSNAGSLPGKCGVNIPYKISTSTNCASI 115

Sequence Alignment: 42. Allergen Name: Art an 3.0102 Sequence ID: ANC85018

 Score = 63.2 bits 307,  Expect = 2e-12
 Identities = 42/89 47%, Positives = 60/89 67%, Gaps = 2/89 2%
Query  1    IDCGHVDSLVRPCLSYVQ-GGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIH 59
            + C  V   + PC S+++ GG  P   CC GVK L++ A++  DRQ+ACNCLK   +  +
Sbjct  27   LTCNDVTKKISPCTSFLEKGGEVPV-DCCTGVKGLNDAAKTTPDRQAACNCLKTSFKSSN 85
Query  60   NLNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            N+ E+NA  +P KCGVN+PY ISL  DC++V
Sbjct  86   NFKEENAAVLPSKCGVNIPYKISLETDCNKV 116

Sequence Alignment: 43. Allergen Name: Art la 3.0102 Sequence ID: ANC85025

 Score = 62.5 bits 303,  Expect = 3e-12
 Identities = 41/89 46%, Positives = 59/89 66%, Gaps = 2/89 2%
Query  1    IDCGHVDSLVRPCLSYVQ-GGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIH 59
            + C  V + + PCLSY++ GG  P+  CC GVK L++  ++  DRQ+ACNCLK   +   
Sbjct  25   LTCSDVSTKISPCLSYLKKGGEVPA-DCCTGVKGLNDATKTTPDRQTACNCLKASFKSNK 83
Query  60   NLNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            +L  D A  +P KCG+NLPY +SL  DC++V
Sbjct  84   DLKSDFAVPLPSKCGLNLPYKLSLETDCNKV 114

Sequence Alignment: 44. Allergen Name: Art v 3.0301 Sequence ID: EU564847

 Score = 62.5 bits 303,  Expect = 3e-12
 Identities = 41/89 46%, Positives = 59/89 66%, Gaps = 2/89 2%
Query  1    IDCGHVDSLVRPCLSYVQ-GGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIH 59
            + C  V + + PCLSY++ GG  P+  CC GVK L++  ++  DRQ+ACNCLK   +   
Sbjct  27   LTCSDVSTKISPCLSYLKKGGEVPA-DCCTGVKGLNDATKTTPDRQTACNCLKASFKSNK 85
Query  60   NLNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            +L  D A  +P KCG+NLPY +SL  DC++V
Sbjct  86   DLKSDFAVPLPSKCGLNLPYKLSLETDCNKV 116

Sequence Alignment: 45. Allergen Name: Lyc e 3 Sequence ID: AAB42069

 Score = 62.1 bits 301,  Expect = 3e-12
 Identities = 42/89 47%, Positives = 55/89 61%, Gaps = 1/89 1%
Query  1    IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN 60
            + CG V S + PCL Y++G  GP G CC GVK L   A++  DR++AC CLK  A  I  
Sbjct  25   LSCGEVTSGLAPCLPYLEGR-GPLGGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKG 83
Query  61   LNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            ++   A  +P  CGVN+PY IS + DCS V
Sbjct  84   IDTGKAAGLPGVCGVNIPYKISPSTDCSTV 113

Sequence Alignment: 46. Allergen Name: Sola l 3.0101 Sequence ID: P93224

 Score = 62.1 bits 301,  Expect = 3e-12
 Identities = 42/89 47%, Positives = 55/89 61%, Gaps = 1/89 1%
Query  1    IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN 60
            + CG V S + PCL Y++G  GP G CC GVK L   A++  DR++AC CLK  A  I  
Sbjct  25   LSCGEVTSGLAPCLPYLEGR-GPLGGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKG 83
Query  61   LNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            ++   A  +P  CGVN+PY IS + DCS V
Sbjct  84   IDTGKAAGLPGVCGVNIPYKISPSTDCSTV 113

Sequence Alignment: 47. Allergen Name: Fra a 3.0201 Sequence ID: Q4PLU0

 Score = 62.1 bits 301,  Expect = 3e-12
 Identities = 38/90 42%, Positives = 60/90 66%, Gaps = 0/90 0%
Query  1    IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN 60
            I CG+V S + PC++YV+ G      CC+G+++L++ A++ +DRQ+ CNCLK  +  I  
Sbjct  27   ITCGQVASSISPCVNYVKSGGAVPAACCNGIRSLNSAAKTTADRQATCNCLKQASGAIKG 86
Query  61   LNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            LN   A  +P KCGV++PY IS + +C+ V
Sbjct  87   LNPSLAAGLPGKCGVSVPYKISTSTNCAAV 116

Sequence Alignment: 48. Allergen Name: Cor a 8 Sequence ID: AAK28533

 Score = 61.1 bits 295,  Expect = 7e-12
 Identities = 39/90 43%, Positives = 59/90 65%, Gaps = 0/90 0%
Query  1    IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN 60
            + C ++   + PC+ Y++ G      CC GV+ +++ +R+ SDRQSACNCLK  A+GI  
Sbjct  25   LTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVNDASRTTSDRQSACNCLKDTAKGIAG 84
Query  61   LNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            LN + A  +P KCGVN+PY IS + +C+ V
Sbjct  85   LNPNLAAGLPGKCGVNIPYKISPSTNCNNV 114

Sequence Alignment: 49. Allergen Name: Sin a 3.0101 Sequence ID: ABU95411

 Score = 60.5 bits 292,  Expect = 8e-12
 Identities = 42/89 47%, Positives = 56/89 62%, Gaps = 2/89 2%
Query  1    IDCGHVDSLVRPCLSYV-QGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIH 59
            + CG V+S +  C+ Y+ Q  P P G CC GV NL+N AR+  DRQ AC CL G A    
Sbjct  2    LSCGTVNSNLAACIGYLTQNAPLPKG-CCTGVTNLNNMARTTPDRQQACRCLVGAANSFP 60
Query  60   NLNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            +LN   A ++P  CGVN+PY IS + +C+ V
Sbjct  61   SLNAARAAALPKACGVNIPYKISKSTNCNSV 91

Sequence Alignment: 50. Allergen Name: Pis s 3.0101 Sequence ID: A0A161AT60

 Score = 60.7 bits 293,  Expect = 9e-12
 Identities = 41/90 45%, Positives = 57/90 63%, Gaps = 2/90 2%
Query  1    IDCGHVDSLVRPCLSYVQG--GPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGI 58
            + CG V + + PC++Y+Q      P   CC GVK L   A +  DRQ+ACNCLK  A  I
Sbjct  27   LSCGTVSADMAPCVTYLQAPNNASPPPPCCAGVKKLLAAATTTPDRQAACNCLKSAAGSI 86
Query  59   HNLNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
              LN +NA ++P KCGV++PY IS + +C+ V
Sbjct  87   PKLNTNNAAALPGKCGVSIPYKISTSTNCNTV 118

Sequence Alignment: 51. Allergen Name: Pun g 1.0101 Sequence ID: A0A059STC4

 Score = 60.7 bits 293,  Expect = 9e-12
 Identities = 41/89 46%, Positives = 55/89 61%, Gaps = 3/89 3%
Query  1    IDCGHVDSLVRPCLSYVQ--GGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGI 58
            + CG+V S + PC+ Y +  GG  P   CC G+K L   AR+  DRQ+ C CLK  +  I
Sbjct  29   VTCGQVASSLAPCIPYARSAGGAVPPA-CCSGIKTLDGMARTTPDRQATCKCLKSASTSI 87
Query  59   HNLNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
              +N     S+P KCGVN+PY IS + DC+RV
Sbjct  88   SGINYGLVASLPAKCGVNIPYKISPSTDCARV 119

Sequence Alignment: 52. Allergen Name: Sola l 7.0101 Sequence ID: NP_001316123

 Score = 60.6 bits 292,  Expect = 1e-11
 Identities = 36/90 40%, Positives = 56/90 62%, Gaps = 0/90 0%
Query  1    IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN 60
            I CG+VD+ + PC+ ++  G  P   CC GV+ L+   +S  DR++ACNC+K  A    N
Sbjct  25   ITCGQVDANLAPCVPFLTQGGEPGAACCSGVRTLNGNTQSSDDRRTACNCVKAAANRYPN 84
Query  61   LNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            L +D A+S+P KCG++L   IS  ++C  +
Sbjct  85   LKDDAAQSLPSKCGISLTVPISRTVNCDTI 114

Sequence Alignment: 53. Allergen Name: Art si 3.0101 Sequence ID: ANC85026

 Score = 60.6 bits 292,  Expect = 1e-11
 Identities = 39/89 43%, Positives = 58/89 65%, Gaps = 2/89 2%
Query  1    IDCGHVDSLVRPCLSYV-QGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIH 59
            + C  V + + PCL+Y+ QGG  P+  CC GVK L++ A++  DRQ+AC CLK   +   
Sbjct  26   LTCSDVSNKISPCLNYLKQGGEVPAN-CCAGVKGLNDAAKTTPDRQTACTCLKNSFKTNK 84
Query  60   NLNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            +L  D A  +P KCGV +PY +S+  DC++V
Sbjct  85   DLKSDYAVPLPSKCGVTIPYKLSMETDCNKV 115

Sequence Alignment: 54. Allergen Name: Pha v 3.0201 Sequence ID: ADC80503

 Score = 60.6 bits 292,  Expect = 1e-11
 Identities = 39/89 43%, Positives = 61/89 68%, Gaps = 2/89 2%
Query  1    IDCGHVDSLVRPCLSYV-QGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIH 59
            I CG+V S +  C+ ++ +GGP P+  CC GV++L+  A++  DRQ+ CNCLK  A  I 
Sbjct  27   ISCGQVTSSLASCIPFLTKGGPVPAS-CCSGVRSLNAAAKTTPDRQAVCNCLKSAAGAIP 85
Query  60   NLNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
             +N +NA  +P KCGV++PY IS + +C+ +
Sbjct  86   GFNANNAGILPGKCGVSIPYKISTSTNCATI 116

Sequence Alignment: 55. Allergen Name: Pru du 3.0101 Sequence ID: ACN11576

 Score = 60.0 bits 289,  Expect = 2e-11
 Identities = 40/90 44%, Positives = 58/90 64%, Gaps = 2/90 2%
Query  1    IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIH- 59
            + CG+V + + PC++YV  G   +  CC GV++L++ A++ +DRQS CNCLK    GI  
Sbjct  31   VSCGQVVNNLTPCINYVANGGALNPSCCTGVRSLYSLAQTTADRQSICNCLKQAVNGIPY 90
Query  60   -NLNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
             N N   A  +P KCGVN+PY IS + DC  +
Sbjct  91   TNANAGLAAGLPGKCGVNIPYKISPSTDCKTI 122

Sequence Alignment: 56. Allergen Name: Pun g 1.0301 Sequence ID: A0A059ST23

 Score = 58.1 bits 278,  Expect = 6e-11
 Identities = 38/90 42%, Positives = 58/90 64%, Gaps = 2/90 2%
Query  1    IDCGHVDSLVRPCLSYVQG-GPGPSGQ-CCDGVKNLHNQARSQSDRQSACNCLKGIARGI 58
            I CG+V S +  C+ Y +G G GP  Q CC+G+++L++ A++  DRQ+AC CLK +A  I
Sbjct  28   ITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKTTPDRQAACRCLKSLASSI 87
Query  59   HNLNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
              +N       P KCGV++PY I+ + +C  V
Sbjct  88   SGINYGLVAGAPGKCGVSIPYKIAPSTNCDNV 119

Sequence Alignment: 57. Allergen Name: Hel a 3.0101 Sequence ID: P82007

 Score = 52.4 bits 246,  Expect = 3e-09
 Identities = 33/89 37%, Positives = 51/89 57%, Gaps = 1/89 1%
Query  1    IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN 60
            I C  V   + PCL Y++ G  P+  CC G K L    R+Q+DR++AC C K  A  +  
Sbjct  27   ITCNDVTGNLTPCLPYLRSGGKPTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK- 85
Query  61   LNEDNARSIPPKCGVNLPYTISLNIDCSRV 90
            +  D A S+P KCG++    I+ N++C+ +
Sbjct  86   VRPDMASSLPGKCGISTSIPINPNVNCNTI 115

Sequence Alignment: 58. Allergen Name: Par j 2 Sequence ID: O04403

 Score = 49.0 bits 227,  Expect = 3e-08
 Identities = 30/87 34%, Positives = 48/87 55%, Gaps = 4/87 4%
Query  3    CGHVDSLVRPCLSYVQGGPG-PSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNL 61
            CG V   + PCL +V+G    PS  CC G K L  + ++   ++ AC C+    +GI  +
Sbjct  35   CGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGI 94
Query  62   NEDNARSIPPKCGVN--LPYTISLNIDCSRV 90
              +    +P KCG+   LP  I+ + DCS++
Sbjct  95   KNELVAEVPKKCGITTTLP-PITADFDCSKI 124

Sequence Alignment: 59. Allergen Name: Par j 2 Sequence ID: P55958

 Score = 47.1 bits 216,  Expect = 1e-07
 Identities = 29/87 33%, Positives = 48/87 55%, Gaps = 4/87 4%
Query  3    CGHVDSLVRPCLSYVQGGPG-PSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNL 61
            CG V   + PCL +V+G    PS +CC G K L  + ++   ++ AC C+    +GI  +
Sbjct  35   CGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGI 94
Query  62   NEDNARSIPPKCGVN--LPYTISLNIDCSRV 90
              +    +P KC +   LP  I+ + DCS++
Sbjct  95   KNELVAEVPKKCDIKTTLP-PITADFDCSKI 124

Sequence Alignment: 60. Allergen Name: Amb a 6 Sequence ID: O04004

 Score = 45.8 bits 209,  Expect = 3e-07
 Identities = 29/86 33%, Positives = 50/86 58%, Gaps = 3/86 3%
Query  3    CGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLN 62
            C  V +++ PC  ++ G   PS  CC GV NL+N  ++++DR + CNC+K + + I   +
Sbjct  30   CDTVQNILAPCAGFLTGQE-PSKACCTGVNNLNNSRKTKADRVAVCNCIKELTKSI-AYD 87
Query  63   EDNARSIPPKCGVNLPY-TISLNIDCSRV 90
                  +  KCGV   +  +  N+DCS++
Sbjct  88   PKRMPLLSTKCGVKPDFPAVDKNLDCSKL 116

Sequence Alignment: 61. Allergen Name: Par j 1 Sequence ID: Q40905

 Score = 43.9 bits 198,  Expect = 1e-06
 Identities = 29/84 34%, Positives = 44/84 52%, Gaps = 5/84 5%
Query  3    CGHVDSLVRPCLSYVQGGPG-PSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNL 61
            CG V   + PCL +VQG    PS  CC G K L  + ++   R  AC C++   +   ++
Sbjct  40   CGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDI 99
Query  62   NEDNARSIPPKCGV---NLPYTISLNIDC 87
            +      +P  CG+    LP  I +N+DC
Sbjct  100  DGKLVSEVPKHCGIVDSKLP-PIDVNMDC 127

Sequence Alignment: 62. Allergen Name: Par j 1 Sequence ID: P43217

 Score = 43.7 bits 197,  Expect = 1e-06
 Identities = 29/87 33%, Positives = 45/87 51%, Gaps = 5/87 5%
Query  3    CGHVDSLVRPCLSYVQGGPG-PSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNL 61
            CG +   + PCL +VQG    PS  CC G K L  + ++   R  AC C++   +   ++
Sbjct  4    CGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDI 63
Query  62   NEDNARSIPPKCGV---NLPYTISLNIDCSRV 90
            +      +P  CG+    LP  I +N+DC  V
Sbjct  64   DGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94

Sequence Alignment: 63. Allergen Name: Par j 1 Sequence ID: O04404

 Score = 43.4 bits 195,  Expect = 2e-06
 Identities = 29/84 34%, Positives = 44/84 52%, Gaps = 5/84 5%
Query  3    CGHVDSLVRPCLSYVQGGPG-PSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNL 61
            CG V   + PCL +VQG    PS  CC G K L  + ++   R  AC C++   +   ++
Sbjct  41   CGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSDI 100
Query  62   NEDNARSIPPKCGV---NLPYTISLNIDC 87
            +      +P  CG+    LP  I +N+DC
Sbjct  101  DGKLVSEVPKHCGIVDSKLP-PIDVNMDC 128

Sequence Alignment: 64. Allergen Name: Par j 1.0103 Sequence ID: CAI94601

 Score = 43.0 bits 193,  Expect = 2e-06
 Identities = 28/84 33%, Positives = 44/84 52%, Gaps = 5/84 5%
Query  3    CGHVDSLVRPCLSYVQGGPG-PSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNL 61
            CG +   + PCL +VQG    PS  CC G K L  + ++   R  AC C++   +   ++
Sbjct  4    CGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDI 63
Query  62   NEDNARSIPPKCGV---NLPYTISLNIDC 87
            +      +P  CG+    LP  I +N+DC
Sbjct  64   DGKLVSEVPKHCGIVDSKLP-PIDVNMDC 91

Sequence Alignment: 65. Allergen Name: Par j 1.0101 Sequence ID: CAA54587

 Score = 41.6 bits 185,  Expect = 6e-06
 Identities = 27/78 34%, Positives = 41/78 52%, Gaps = 5/78 6%
Query  12   PCLSYVQGGPG-PSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIP 70
            PCL +VQG    PS  CC G K L  + ++   R  AC C++   +   +++      +P
Sbjct  7    PCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVP 66
Query  71   PKCGV---NLPYTISLNIDCSRV 90
              CG+    LP  I +N+DC  V
Sbjct  67   KHCGIVDSKLP-PIDVNMDCKTV 88

Sequence Alignment: 66. Allergen Name: Cas s 8 Sequence ID: 10998016

 Score = 29.6 bits 118,  Expect = 0.007
 Identities = 16/32 50%, Positives = 21/32 65%, Gaps = 2/32 6%
Query  1    IDCGHVDSLVRPCLSYVQ--GGPGPSGQCCDGVK 32
            I C +V   + PCL+Y++  GG  P G CC GVK
Sbjct  2    ITCTQVSKSLMPCLTYLKSNGGSPPPGTCCQGVK 35

Sequence Alignment: 67. Allergen Name: Art v 3.0101 Sequence ID: P0C088

 Score = 29.4 bits 117,  Expect = 0.008
 Identities = 17/35 48%, Positives = 24/35 68%, Gaps = 2/35 5%
Query  1    IDCGHVDSLVRPCLSYV-QGGPGPSGQCCDGVKNLHN 36
            + C  V + + PCLSY+ QGG  P+  CC GVK L++
Sbjct  2    LTCSDVSNKISPCLSYLKQGGEVPA-DCCAGVKGLND 37

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.