The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

IPADKVFLRKQWDVLRLVHRIHQHSIIPEQVTVGDSYDIEANINNYKNPRVVKNFMALYK
KDPVKRGEPFSTYYIKHREQAIMLFELFYYANDYDTFYKTACWARDRVNEGMFLYSFNIA
IMHREDMQDIVVPAFYEIYPFLFVENDVIQKAYDYKMKESGHLNEPHTHVIPVNFTLRNQ
EQLLSYFTEDVFLNAFNTYFRYMYPTWFNYTKYEYDVPRHGEQFYYFNQQMFARYMLERY
SNDMPEIQPFTYTKPFKTPYNPQLRYPNGQEVPARPAYMMPQDFDLMYVSDIKNYEKRVA
DAVDFGYVFCDKMISHSLYNNEKGLEWLGQIVEGNSMHPDFYGHIFHMYRSLLGHITDPF
HKHGVAPSALEHPETSLRDPAFYQIWKRVQHYFNKFQMKQPYYTREELAFDGVKIDNVDV
GKLYTYFEPYEMGLSNAVKVGKLEDVPNVDIRARNYRLNHKPFTYNVEVTSEKDTPVYVR
VFLGPKYNYYGHEYDLNERRNYFVEIDRFPYQLHTGKNTIQRNSHDSSVVAQEQDTYKVL
YKKVNEAYEGKTTYTYEKQDKYCGLPEHLLIPKGKKGGQAFTVYVIVTPYDKAVEKEEHH
FKAYSYCGVGPHDSVYDKKPLGFPFDRPIHSYDFVTPNMFMKDVFIFHKKYEEVEQH
Sequence Info Allergen Name Length Opt Bits Score E Value
D0VNY7 Bla g 3.0101 657 4567 1047.2 0
Q25641 Per a 3.0101 685 2781 640.1 1.5e-184
AAB09632 Per a 3.0201 631 2780 639.8 1.7e-184
AAB62731 Per a 3.0202 470 2009 464.2 9.4e-132
AAB63595 Per a 3.0203 393 1656 383.7 1.3e-107
G1AP69 Pen m 7.0101 683 1168 272.4 7.4e-74
AEB77775 Pen m 7.0102 683 1168 272.4 7.4e-74
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Bla g 3.0101 Sequence ID: D0VNY7

 Score = 1047.2 bits 4567,  Expect = 0
 Identities = 657/657 100%, Positives = 657/657 100%, Gaps = 0/657 0%
Query  1    IPADKVFLRKQWDVLRLVHRIHQHSIIPEQVTVGDSYDIEANINNYKNPRVVKNFMALYK 60
            IPADKVFLRKQWDVLRLVHRIHQHSIIPEQVTVGDSYDIEANINNYKNPRVVKNFMALYK
Sbjct  1    IPADKVFLRKQWDVLRLVHRIHQHSIIPEQVTVGDSYDIEANINNYKNPRVVKNFMALYK 60
Query  61   KDPVKRGEPFSTYYIKHREQAIMLFELFYYANDYDTFYKTACWARDRVNEGMFLYSFNIA 120
            KDPVKRGEPFSTYYIKHREQAIMLFELFYYANDYDTFYKTACWARDRVNEGMFLYSFNIA
Sbjct  61   KDPVKRGEPFSTYYIKHREQAIMLFELFYYANDYDTFYKTACWARDRVNEGMFLYSFNIA 120
Query  121  IMHREDMQDIVVPAFYEIYPFLFVENDVIQKAYDYKMKESGHLNEPHTHVIPVNFTLRNQ 180
            IMHREDMQDIVVPAFYEIYPFLFVENDVIQKAYDYKMKESGHLNEPHTHVIPVNFTLRNQ
Sbjct  121  IMHREDMQDIVVPAFYEIYPFLFVENDVIQKAYDYKMKESGHLNEPHTHVIPVNFTLRNQ 180
Query  181  EQLLSYFTEDVFLNAFNTYFRYMYPTWFNYTKYEYDVPRHGEQFYYFNQQMFARYMLERY 240
            EQLLSYFTEDVFLNAFNTYFRYMYPTWFNYTKYEYDVPRHGEQFYYFNQQMFARYMLERY
Sbjct  181  EQLLSYFTEDVFLNAFNTYFRYMYPTWFNYTKYEYDVPRHGEQFYYFNQQMFARYMLERY 240
Query  241  SNDMPEIQPFTYTKPFKTPYNPQLRYPNGQEVPARPAYMMPQDFDLMYVSDIKNYEKRVA 300
            SNDMPEIQPFTYTKPFKTPYNPQLRYPNGQEVPARPAYMMPQDFDLMYVSDIKNYEKRVA
Sbjct  241  SNDMPEIQPFTYTKPFKTPYNPQLRYPNGQEVPARPAYMMPQDFDLMYVSDIKNYEKRVA 300
Query  301  DAVDFGYVFCDKMISHSLYNNEKGLEWLGQIVEGNSMHPDFYGHIFHMYRSLLGHITDPF 360
            DAVDFGYVFCDKMISHSLYNNEKGLEWLGQIVEGNSMHPDFYGHIFHMYRSLLGHITDPF
Sbjct  301  DAVDFGYVFCDKMISHSLYNNEKGLEWLGQIVEGNSMHPDFYGHIFHMYRSLLGHITDPF 360
Query  361  HKHGVAPSALEHPETSLRDPAFYQIWKRVQHYFNKFQMKQPYYTREELAFDGVKIDNVDV 420
            HKHGVAPSALEHPETSLRDPAFYQIWKRVQHYFNKFQMKQPYYTREELAFDGVKIDNVDV
Sbjct  361  HKHGVAPSALEHPETSLRDPAFYQIWKRVQHYFNKFQMKQPYYTREELAFDGVKIDNVDV 420
Query  421  GKLYTYFEPYEMGLSNAVKVGKLEDVPNVDIRARNYRLNHKPFTYNVEVTSEKDTPVYVR 480
            GKLYTYFEPYEMGLSNAVKVGKLEDVPNVDIRARNYRLNHKPFTYNVEVTSEKDTPVYVR
Sbjct  421  GKLYTYFEPYEMGLSNAVKVGKLEDVPNVDIRARNYRLNHKPFTYNVEVTSEKDTPVYVR 480
Query  481  VFLGPKYNYYGHEYDLNERRNYFVEIDRFPYQLHTGKNTIQRNSHDSSVVAQEQDTYKVL 540
            VFLGPKYNYYGHEYDLNERRNYFVEIDRFPYQLHTGKNTIQRNSHDSSVVAQEQDTYKVL
Sbjct  481  VFLGPKYNYYGHEYDLNERRNYFVEIDRFPYQLHTGKNTIQRNSHDSSVVAQEQDTYKVL 540
Query  541  YKKVNEAYEGKTTYTYEKQDKYCGLPEHLLIPKGKKGGQAFTVYVIVTPYDKAVEKEEHH 600
            YKKVNEAYEGKTTYTYEKQDKYCGLPEHLLIPKGKKGGQAFTVYVIVTPYDKAVEKEEHH
Sbjct  541  YKKVNEAYEGKTTYTYEKQDKYCGLPEHLLIPKGKKGGQAFTVYVIVTPYDKAVEKEEHH 600
Query  601  FKAYSYCGVGPHDSVYDKKPLGFPFDRPIHSYDFVTPNMFMKDVFIFHKKYEEVEQH 657
            FKAYSYCGVGPHDSVYDKKPLGFPFDRPIHSYDFVTPNMFMKDVFIFHKKYEEVEQH
Sbjct  601  FKAYSYCGVGPHDSVYDKKPLGFPFDRPIHSYDFVTPNMFMKDVFIFHKKYEEVEQH 657

Sequence Alignment: 2. Allergen Name: Per a 3.0101 Sequence ID: Q25641

 Score = 640.1 bits 2781,  Expect = 2e-184
 Identities = 396/649 61%, Positives = 500/649 77%, Gaps = 7/649 1%
Query  3    ADKVFLRKQWDVLRLVHRIHQHSIIPEQVTVGDSYDIEANINNYKNPRVVKNFMALYKKD 62
            ADK FL KQ DVLRL HR+HQH+I+ +QV VG     +        P        L +  
Sbjct  28   ADKQFLAKQRDVLRLFHRVHQHNILNDQVEVGIPMTSKQTSATTVPPSGEAVHGVLQEGH 87
Query  63   PVKRGEPFSTYYIKHREQAIMLFELFYYANDYDTFYKTACWARDRVNEGMFLYSFNIAIM 122
               RGEPFS  Y KHREQAIML++L+Y+ANDYDTFYKTACWARDRVNEGMF+YSF+IA+ 
Sbjct  88   ARPRGEPFSVNYEKHREQAIMLYDLLYFANDYDTFYKTACWARDRVNEGMFMYSFSIAVF 147
Query  123  HREDMQDIVVPAFYEIYPFLFVENDVIQKAYDYKMKESGHLNEPHTHVIPVNFTLRNQEQ 182
            HR+DMQ +++P  YE+YP+LFV++DVI+ A  Y MK +G   E H+HVIPVNFTLR Q++
Sbjct  148  HRDDMQGVMLPPPYEVYPYLFVDHDVIHMAQKYWMKNAGS-GEHHSHVIPVNFTLRTQDH 206
Query  183  LLSYFTEDVFLNAFNTYFRYMYPTWFNYTKYEYDVPRHGEQFYYFNQQMFARYMLERYSN 242
            LL+YFT DV LNAFNTY+RY YP+W+N T Y +++ R GEQFYY  +Q++ARY LER SN
Sbjct  207  LLAYFTSDVNLNAFNTYYRYYYPSWYNTTLYGHNIDRRGEQFYYTYKQIYARYFLERLSN 266
Query  243  DMPEIQPFTYTKPFKTPYNPQLRYPNGQEVPARPAYMMPQDFDLMYVSDIKNYEKRVADA 302
            D+P++ PF Y+KP K+ YNP LRY NG+E+P RP+ M   +FDL Y++DIKNYEKRV DA
Sbjct  267  DLPDVYPFYYSKPVKSAYNPNLRYHNGEEMPVRPSNMYVTNFDLYYIADIKNYEKRVEDA 326
Query  303  VDFGYVFCDKMISHSLYNNEKGLEWLGQIVEGNSMHPDFY--GHIFHMYRSLLGHITDPF 360
            +DFGY F + M  HSLY++  G+E+L  ++EGN   P+FY  G I+HMY S++GHI DP+
Sbjct  327  IDFGYAFDEHMKPHSLYHDVHGMEYLADMIEGNMDSPNFYFYGSIYHMYHSMIGHIVDPY 386
Query  361  HKHGVAPSALEHPETSLRDPAFYQIWKRVQHYFNKFQMKQPYYTREELAFDGVKIDNVDV 420
            HK G+APS LEHPET LRDP FYQ+WKRV H F K++ + P YT +ELAF+GVK++NVDV
Sbjct  387  HKMGLAPS-LEHPETVLRDPVFYQLWKRVDHLFQKYKNRLPRYTHDELAFEGVKVENVDV 445
Query  421  GKLYTYFEPYEMGLSNAVKVGKLEDVPNVDIRARNYRLNHKPFTYNVEVTSEKDTPVYVR 480
            GKLYTYFE Y+M L  AV V  ++ + NVD++    RLNHKPFTYN+EV+S+K   VYV 
Sbjct  446  GKLYTYFEQYDMSLDMAVYVNNVDQISNVDVQL-AVRLNHKPFTYNIEVSSDKAQDVYVA 504
Query  481  VFLGPKYNYYGHEYDLNERRNYFVEIDRFPYQLHTGKNTIQRNSHDSSVVAQEQDTYKVL 540
            VFLGPKY+Y G EYDLN+RR+YFVE+DRFPY++  GK  I+RNSHDS+++A E+D+Y+ +
Sbjct  505  VFLGPKYDYLGREYDLNDRRHYFVEMDRFPYHVGAGKTVIERNSHDSNIIAPERDSYRTF 564
Query  541  YKKVNEAYEGKTTYTYEKQDKYCGLPEHLLIPKGKKGGQAFTVYVIVTPYDKAVEK--EE 598
            YKKV EAYEGK+ Y  +K   YCG PE+LLIPKGKKGGQA+T YVIVTPY K  E   E 
Sbjct  565  YKKVQEAYEGKSQYYVDKGHNYCGYPENLLIPKGKKGGQAYTFYVIVTPYVKQDEHDFEP 624
Query  599  HHFKAYSYCGVGPHDSVYDKKPLGFPFDRPIHSYDFVTPNMFMKDVFIFHKKYEEV 654
            +++KA+SYCGVG      D KPLG+PFDR I+S DF TPNM+ KDV IFHKKY+EV
Sbjct  625  YNYKAFSYCGVGSERKYPDNKPLGYPFDRKIYSNDFYTPNMYFKDVIIFHKKYDEV 680

Sequence Alignment: 3. Allergen Name: Per a 3.0201 Sequence ID: AAB09632

 Score = 639.8 bits 2780,  Expect = 2e-184
 Identities = 392/620 63%, Positives = 492/620 79%, Gaps = 7/620 1%
Query  33   VGDSYDIEANINNYKNPRVVKNFMALYKKDPVKRGEPFSTYYIKHREQAIMLFELFYYAN 92
            +GD YDIEANI +YK P VVKNF++ YKK  + RGEPFS YY KHREQAI LFELF+ AN
Sbjct  2    IGDHYDIEANIGHYKYPHVVKNFISYYKKGLLPRGEPFSVYYEKHREQAIKLFELFFAAN 61
Query  93   DYDTFYKTACWARDRVNEGMFLYSFNIAIMHREDMQDIVVPAFYEIYPFLFVENDVIQKA 152
            DYDTFYKTACWARDRVNEGMF+Y++ +A  HRED +D+V+P  YE+ P+LFVE+DVIQ+A
Sbjct  62   DYDTFYKTACWARDRVNEGMFMYALTVAAFHREDTKDLVLPPPYEVNPYLFVEDDVIQQA 121
Query  153  YDYKMKESGHLNEPHT-HVIPVNFTLRNQEQLLSYFTEDVFLNAFNTYFRYMYPTWFNYT 211
            Y Y  KESG   + H  HVIPVNFT R+QE L++YF EDV LNAFN YFRY+YP+WFN T
Sbjct  122  YKYWTKESG--TDKHVEHVIPVNFTARSQEDLVAYFREDVDLNAFNMYFRYIYPSWFNTT 179
Query  212  KYEYDVPRHGEQFYYFNQQMFARYMLERYSNDMPEIQPFTYTKPFKTPYNPQLRYPNGQE 271
             Y     R GEQFYY  +Q++ARY LER SN +P+++PF Y+KP+KT YNP+LRY NG+E
Sbjct  180  LYGKSFDRRGEQFYYTYHQIYARYFLERLSNSLPDVKPFQYSKPLKTGYNPHLRYHNGEE 239
Query  272  VPARPAYMMPQDFDLMYVSDIKNYEKRVADAVDFGYVFCDKMISHSLYNNEKGLEWLGQI 331
            +PARP+ M P +FDL YVSDIKNYE+RV  A+DFGY F +    +SLY+++ G+++LGQ+
Sbjct  240  MPARPSNMYPTNFDLFYVSDIKNYERRVEKAIDFGYAFDEHRTPYSLYHDQHGMDYLGQM 299
Query  332  VEG--NSMHPDFYGHIFHMYRSLLGHITDPFHKHGVAPSALEHPETSLRDPAFYQIWKRV 389
            +EG  NS H  FYG +FH YR L+GH+ DP+HK+G+APSALEHP+T+LRDPAFYQ+WKR+
Sbjct  300  IEGTRNSPHQYFYGSVFHFYRLLVGHVVDPYHKNGLAPSALEHPQTALRDPAFYQLWKRI 359
Query  390  QHYFNKFQMKQPYYTREELAFDGVKIDNVDVGKLYTYFEPYEMGLSNAVKVGKLEDVPNV 449
             H   K++ + P YT +EL+F GVKI+NVDVGKLYTYFE +E  L NA+ +GKLED    
Sbjct  360  DHIVQKYKNRLPRYTYDELSFPGVKIENVDVGKLYTYFEHFEHSLGNAMYLGKLEDYMKA 419
Query  450  DIRARNYRLNHKPFTYNVEVTSEKDTPVYVRVFLGPKYNYYGHEYDLNERRNYFVEIDRF 509
             IRAR+YRLNHKPFTYN+EV+S+K   VYVR+FLGPKY+  GHE +L+ERR+YFVE+DRF
Sbjct  420  SIRARHYRLNHKPFTYNIEVSSDKAQDVYVRIFLGPKYDSLGHECELDERRHYFVEMDRF 479
Query  510  PYQLHTGKNTIQRNSHDSSVVAQEQDTYKVLYKKVNEAYEGKTTYTYEKQDKYCGLPEHL 569
             +++  GK  I+R SHDSS+++  +D+Y+ L+KKV++A + K  Y  +K  KYCG PE+L
Sbjct  480  VHKVEAGKTVIERKSHDSSIISDSHDSYRNLFKKVSDALQEKDQYYIDKSHKYCGYPENL 539
Query  570  LIPKGKKGGQAFTVYVIVTPYDKAVEK--EEHHFKAYSYCGVGPHDSVYDKKPLGFPFDR 627
            L+PKGKKGGQ FT YVIVTPY K  E   E +H+KA+SYCGVG      D KPLGFPFDR
Sbjct  540  LLPKGKKGGQTFTFYVIVTPYVKQDEHDFEPYHYKAFSYCGVGHGRKYPDDKPLGFPFDR 599
Query  628  PIHSYDFVTPNMFMKDVFIFHKKYEEV 654
             IH YDF TPNM+ KDV IFHKKY+EV
Sbjct  600  KIHDYDFYTPNMYFKDVVIFHKKYDEV 626

Sequence Alignment: 4. Allergen Name: Per a 3.0202 Sequence ID: AAB62731

 Score = 464.2 bits 2009,  Expect = 9e-132
 Identities = 282/461 61%, Positives = 359/461 77%, Gaps = 5/461 1%
Query  193  LNAFNTYFRYMYPTWFNYTKYEYDVPRHGEQFYYFNQQMFARYMLERYSNDMPEIQPFTY 252
            LNAFN YFRY+YPTWFN T Y     R GEQFYY  +Q++ARY LER SN +P+++PF Y
Sbjct  1    LNAFNMYFRYIYPTWFNTTLYGKTFDRRGEQFYYTYHQIYARYFLERLSNSLPDVKPFQY 60
Query  253  TKPFKTPYNPQLRYPNGQEVPARPAYMMPQDFDLMYVSDIKNYEKRVADAVDFGYVFCDK 312
            +KP+KT YNP+LRY NG+E+PARP+ M P + DL YVSDIKNYE RV  A+DF   F + 
Sbjct  61   SKPLKTGYNPHLRYQNGEEMPARPSNMYPTNIDLFYVSDIKNYESRVEKAIDFD-AFDEH 119
Query  313  MISHSLYNNEKGLEWLGQIVEGNSMHPD--FYGHIFHMYRSLLGHITDPFHKHGVAPSAL 370
               +SLY+++ G+++LGQ++EG S  P   FYG IFH YR L+GH+ DP+HK+G+APSAL
Sbjct  120  RTPYSLYHDQHGMDYLGQMIEGTSNSPYQYFYGSIFHFYRLLVGHVVDPYHKNGLAPSAL 179
Query  371  EHPETSLRDPAFYQIWKRVQHYFNKFQMKQPYYTREELAFDGVKIDNVDVGKLYTYFEPY 430
            EH +T+LRDPAFYQ+WKR+ H   K++ + P YT +EL+F GVKI+NVDVGKLYTYFE +
Sbjct  180  EHHQTALRDPAFYQLWKRIDHIVQKYKNRLPRYTYDELSFPGVKIENVDVGKLYTYFEHF 239
Query  431  EMGLSNAVKVGKLEDVPNVDIRARNYRLNHKPFTYNVEVTSEKDTPVYVRVFLGPKYNYY 490
            E  L NA+ +GKLEDV   +IRAR+YRLNHKPFTYN+EV+S+K   VYVR+FLGPKY+  
Sbjct  240  EHSLGNAMYLGKLEDVLKANIRARHYRLNHKPFTYNIEVSSDKAQDVYVRIFLGPKYDSL 299
Query  491  GHEYDLNERRNYFVEIDRFPYQLHTGKNTIQRNSHDSSVVAQEQDTYKVLYKKVNEAYEG 550
            GHE +L+ERR+YFVE+DRF +++  GK  I+R SHDSS+++  +D+Y+ L+KKV++A EG
Sbjct  300  GHECELDERRHYFVEMDRFVHKVEAGKTVIERKSHDSSIISDSHDSYRNLFKKVSDALEG 359
Query  551  KTTYTYEKQDKYCGLPEHLLIPKGKKGGQAFTVYVIVTPYDKAVEK--EEHHFKAYSYCG 608
            K  Y  +   KYCG PE+LL+PKGKKGGQ FT YVIVTPY K  E   E +H+KA++YCG
Sbjct  360  KDQYYIDNSHKYCGYPENLLLPKGKKGGQTFTFYVIVTPYVKQDEHDLESYHYKAFTYCG 419
Query  609  VGPHDSVYDKKPLGFPFDRPIHSYDFVTPNMFMKDVFIFHKKYEEV 654
            VG      D KPLGFPFDR IH YDF TPNM+ KDV IFHKKY+EV
Sbjct  420  VGHGRKYPDDKPLGFPFDRKIHDYDFYTPNMYFKDVVIFHKKYDEV 465

Sequence Alignment: 5. Allergen Name: Per a 3.0203 Sequence ID: AAB63595

 Score = 383.7 bits 1656,  Expect = 1e-107
 Identities = 233/386 60%, Positives = 298/386 77%, Gaps = 4/386 1%
Query  271  EVPARPAYMMPQDFDLMYVSDIKNYEKRVADAVDFGYVFCDKMISHSLYNNEKGLEWLGQ 330
            E+PARP+ M P + DL YVSDIKNYE RV  A+DFGY F +    +SLY+++ G+++LGQ
Sbjct  1    EMPARPSNMYPTNIDLFYVSDIKNYESRVEKAIDFGYAFDEHRTPYSLYHDQHGMDYLGQ 60
Query  331  IVEGNSMHPD--FYGHIFHMYRSLLGHITDPFHKHGVAPSALEHPETSLRDPAFYQIWKR 388
            ++EG S  P   FYG IFH YR L+GH+ DP+HK+G+APSALEH +T+LRDPAFYQ+WKR
Sbjct  61   MIEGTSNSPYQYFYGSIFHFYRLLVGHVVDPYHKNGLAPSALEHHQTALRDPAFYQLWKR 120
Query  389  VQHYFNKFQMKQPYYTREELAFDGVKIDNVDVGKLYTYFEPYEMGLSNAVKVGKLEDVPN 448
            + H   K++ + P YT +EL+F GVKI+NVDVGKLYTYFE +E  L NA+ +GKLED+  
Sbjct  121  IDHIVQKYKNRLPRYTYDELSFPGVKIENVDVGKLYTYFEHFEHSLGNAMYIGKLEDLLK 180
Query  449  VDIRARNYRLNHKPFTYNVEVTSEKDTPVYVRVFLGPKYNYYGHEYDLNERRNYFVEIDR 508
             +IRA +YRLNHKPFTYN+EV+S+K   VYVR+FLGPKY+  GHE +L+ERR+YFVE+DR
Sbjct  181  ANIRASHYRLNHKPFTYNIEVSSDKAQDVYVRIFLGPKYDSLGHECELDERRHYFVEMDR 240
Query  509  FPYQLHTGKNTIQRNSHDSSVVAQEQDTYKVLYKKVNEAYEGKTTYTYEKQDKYCGLPEH 568
            F +++  GK  I+R SHDSS+++  +D+Y+ LYKKV +A E K  Y  +K  KYC  PE+
Sbjct  241  FVHKVEAGKTVIERKSHDSSIISDSHDSYRNLYKKVADALEEKDQYYIDKSHKYCNYPEN 300
Query  569  LLIPKGKKGGQAFTVYVIVTPYDKAVEK--EEHHFKAYSYCGVGPHDSVYDKKPLGFPFD 626
            LL+PKGKKGGQ FT YVIVTPY K  +   E +H+KA+SYCGVG      D KPLGFPFD
Sbjct  301  LLLPKGKKGGQTFTFYVIVTPYVKQEQHDFEPYHYKAFSYCGVGHGRKYPDDKPLGFPFD 360
Query  627  RPIHSYDFVTPNMFMKDVFIFHKKYEEVEQ 656
            R IH YDF TPNM+ KDV IFHKKY+EV +
Sbjct  361  RKIHDYDFYTPNMYFKDVVIFHKKYDEVHE 390

Sequence Alignment: 6. Allergen Name: Pen m 7.0101 Sequence ID: G1AP69

 Score = 272.4 bits 1168,  Expect = 7e-74
 Identities = 208/627 33%, Positives = 357/627 56%, Gaps = 32/627 5%
Query  9    RKQWDVLRLVHRIHQHSIIPEQVTVGDSYDIEANINNYKNP-RVVKNFMALYKKDPV-KR 66
            +KQ DV  L+H+I+            DS+D EAN+++Y +  + V+ +M   K + + ++
Sbjct  37   QKQHDVNFLLHKIYGDIRDSNLKGKADSFDPEANLSHYSDGGKAVQKLMRDLKDNRLLQQ 96
Query  67   GEPFSTYYIKHREQAIMLFELFYYANDYDTFYKTACWARDRVNEGMFLYSFNIAIMHRED 126
               FS +  ++RE+A+MLF+++ +  D+DTF   A + R  +NEG F+Y++ +A++H   
Sbjct  97   RHWFSLFNPRQREEALMLFDVLIHCKDWDTFVSNAAYFRQIMNEGEFVYALYVAVIHSPL 156
Query  127  MQDIVVPAFYEIYPFLFVENDVIQKAYDYKM-KESGHLNEPHTHVIPVNFTLRNQEQLLS 185
             + +V+P +YE+ P LF  ++VI+ AY  K  ++ G +    T       T +N EQ ++
Sbjct  157  SEHVVLPPLYEVTPHLFTNSEVIEAAYRAKQTQKPGKFKSSFTG------TKKNPEQRVA 210
Query  186  YFTEDVFLNAFNTYFRYMYPTWFNYTKYEYDVPRHGEQFYYFNQQMFARYMLERYSNDMP 245
            YF ED+ +N  +  +   +P W++  KY + + R GE F++ ++Q+  R+  ER SN + 
Sbjct  211  YFGEDIGMNTHHVTWHMEFPFWWD-DKYSHHLDRKGENFFWVHHQLTVRFDAERLSNYLD 269
Query  246  EIQPFTYTKPFKTPYNPQLRYPNGQEVPARPAYMMPQDFD-LMYVSDIKNYEKRVADAVD 304
             +  + + KP    + P+  Y  G + P+RP  +  +D D +  + D+   E R+ DA+ 
Sbjct  270  PVDELHWEKPIVQGFAPHTTYKYGGQFPSRPDNVDFEDVDGVARIRDLLIVESRIRDAIA 329
Query  305  FGYVFCDKMISHSLYNNEKGLEWLGQIVEGNSMHPD--FYGHIFHMYRSLLGHITDPFHK 362
             GY+  D+  +H    NE+G++ LG ++E +   P+  +YG + +    +LG  +DP  K
Sbjct  330  HGYIV-DRAGNHIDIMNERGIDVLGDVIESSLYSPNVQYYGALHNTAHIVLGRQSDPHGK 388
Query  363  HGVAPSALEHPETSLRDPAFYQIWKRVQHYFNKFQMKQPYYTREELAFDGVKIDNVDV-G 421
            + + P  LEH ET+ RDP+F+++ K + + F + +   P YT EEL F GV +DNV + G
Sbjct  389  YDLPPGVLEHFETATRDPSFFRLHKYMDNIFKEHKDSLPPYTVEELTFAGVSVDNVAIEG 448
Query  422  KLYTYFEPYEMGLSNAVKVGKLEDVPNVDIRARNYRLNHKPFTYNVEVTSEKDTPVY--V 479
            +L T+FE +E  L NAV     E +P+V+I     RLNHK F   ++V++ K   V   V
Sbjct  449  ELETFFEDFEYNLINAVD--DTEQIPDVEISTYVPRLNHKDFKIKIDVSNNKGQEVLATV 506
Query  480  RVFLGPKYNYYGHEYDLNERRNYFVEIDRFPYQLHTGKNTIQRNSHDSSVVAQEQDTYKV 539
            R+F  P  +  G E+ ++E R   +E+D+F  +L  G +  +R S +S+V   +  ++  
Sbjct  507  RIFAWPHLDNNGIEFTFDEGRWNAIELDKFWVKLPAGTHHFERKSSESAVTVPDVPSFAT 566
Query  540  LYKKVNEAYEGKTTYTYEKQDKYCGLPEHLLIPKGKKGGQAFTVYVIVTP--YDKAVE-- 595
            L++K  EA  G  +   + +    G+P  +L+PKG + G  F + V VT    D AV+  
Sbjct  567  LFEKTKEALAGADSGLTDFESA-TGIPNRFLLPKGNEQGLEFDLVVAVTDGAADAAVDGL 625
Query  596  KEEHHFKAYSYCGVGPHDSVYDKKPLGFPFDRPIHSYDFVT--PNMFMKDVFIF-HKKY 651
             E   F  Y     G H    D +P G+P+DR +         PN     V +F H +Y
Sbjct  626  HENTEFNHY-----GSHGKYPDNRPHGYPLDRKVPDERVFEDLPNFGHIQVKVFNHGEY 679

Sequence Alignment: 7. Allergen Name: Pen m 7.0102 Sequence ID: AEB77775

 Score = 272.4 bits 1168,  Expect = 7e-74
 Identities = 208/627 33%, Positives = 357/627 56%, Gaps = 32/627 5%
Query  9    RKQWDVLRLVHRIHQHSIIPEQVTVGDSYDIEANINNYKNP-RVVKNFMALYKKDPV-KR 66
            +KQ DV  L+H+I+            DS+D EAN+++Y +  + V+ +M   K + + ++
Sbjct  37   QKQHDVNFLLHKIYGDIRDSNLKGKADSFDPEANLSHYSDGGKAVQKLMRDLKDNRLLQQ 96
Query  67   GEPFSTYYIKHREQAIMLFELFYYANDYDTFYKTACWARDRVNEGMFLYSFNIAIMHRED 126
               FS +  ++RE+A+MLF+++ +  D+DTF   A + R  +NEG F+Y++ +A++H   
Sbjct  97   RHWFSLFNPRQREEALMLFDVLIHCKDWDTFVSNAAYFRQIMNEGEFVYALYVAVIHSPL 156
Query  127  MQDIVVPAFYEIYPFLFVENDVIQKAYDYKM-KESGHLNEPHTHVIPVNFTLRNQEQLLS 185
             + +V+P +YE+ P LF  ++VI+ AY  K  ++ G +    T       T +N EQ ++
Sbjct  157  SEHVVLPPLYEVTPHLFTNSEVIEAAYRAKQTQKPGKFKSSFTG------TKKNPEQRVA 210
Query  186  YFTEDVFLNAFNTYFRYMYPTWFNYTKYEYDVPRHGEQFYYFNQQMFARYMLERYSNDMP 245
            YF ED+ +N  +  +   +P W++  KY + + R GE F++ ++Q+  R+  ER SN + 
Sbjct  211  YFGEDIGMNTHHVTWHMEFPFWWD-DKYSHHLDRKGENFFWVHHQLTVRFDAERLSNYLD 269
Query  246  EIQPFTYTKPFKTPYNPQLRYPNGQEVPARPAYMMPQDFD-LMYVSDIKNYEKRVADAVD 304
             +  + + KP    + P+  Y  G + P+RP  +  +D D +  + D+   E R+ DA+ 
Sbjct  270  PVDELHWEKPIVQGFAPHTTYKYGGQFPSRPDNVDFEDVDGVARIRDLLIVESRIRDAIA 329
Query  305  FGYVFCDKMISHSLYNNEKGLEWLGQIVEGNSMHPD--FYGHIFHMYRSLLGHITDPFHK 362
             GY+  D+  +H    NE+G++ LG ++E +   P+  +YG + +    +LG  +DP  K
Sbjct  330  HGYIV-DRAGNHIDIMNERGIDVLGDVIESSLYSPNVQYYGALHNTAHIVLGRQSDPHGK 388
Query  363  HGVAPSALEHPETSLRDPAFYQIWKRVQHYFNKFQMKQPYYTREELAFDGVKIDNVDV-G 421
            + + P  LEH ET+ RDP+F+++ K + + F + +   P YT EEL F GV +DNV + G
Sbjct  389  YDLPPGVLEHFETATRDPSFFRLHKYMDNIFKEHKDSLPPYTVEELTFAGVSVDNVAIEG 448
Query  422  KLYTYFEPYEMGLSNAVKVGKLEDVPNVDIRARNYRLNHKPFTYNVEVTSEKDTPVY--V 479
            +L T+FE +E  L NAV     E +P+V+I     RLNHK F   ++V++ K   V   V
Sbjct  449  ELETFFEDFEYNLINAVD--DTEQIPDVEISTYVPRLNHKDFKIKIDVSNNKGQEVLATV 506
Query  480  RVFLGPKYNYYGHEYDLNERRNYFVEIDRFPYQLHTGKNTIQRNSHDSSVVAQEQDTYKV 539
            R+F  P  +  G E+ ++E R   +E+D+F  +L  G +  +R S +S+V   +  ++  
Sbjct  507  RIFAWPHLDNNGIEFTFDEGRWNAIELDKFWVKLPAGTHHFERKSSESAVTVPDVPSFAT 566
Query  540  LYKKVNEAYEGKTTYTYEKQDKYCGLPEHLLIPKGKKGGQAFTVYVIVTP--YDKAVE-- 595
            L++K  EA  G  +   + +    G+P  +L+PKG + G  F + V VT    D AV+  
Sbjct  567  LFEKTKEALAGADSGLTDFESA-TGIPNRFLLPKGNEQGLEFDLVVAVTDGAADAAVDGL 625
Query  596  KEEHHFKAYSYCGVGPHDSVYDKKPLGFPFDRPIHSYDFVT--PNMFMKDVFIF-HKKY 651
             E   F  Y     G H    D +P G+P+DR +         PN     V +F H +Y
Sbjct  626  HENTEFNHY-----GSHGKYPDNRPHGYPLDRKVPDERVFEDLPNFGHIQVKVFNHGEY 679

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.