The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

IPANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHL
YDPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQCQANARGTRYHVSSYNSLR
YRAGDQEIQAAIMNHGPVVIYIHGTEAHFRNLRKGILRGAGYNDAQIDHAVVLVGWGTQN
GIDYWIVRTSWGTQWGDAGYGFVERHHNSLGINNYPIYASL
Sequence Info Allergen Name Length Opt Bits Score E Value
AAK58415 Blo t 1.0101 221 1566 363.7 2.5e-102
AAQ24541 Blo t 1.0201 333 1033 242.1 1.6e-65
2428875 Der f 1.0102 303 523 125.9 1.4e-30
ABM53753 Tyr p 1.0101 336 518 124.7 3.5e-30
2428875 Der f 1.0105 303 517 124.5 3.6e-30
BAC53948 Der f 1.0101 321 516 124.3 4.5e-30
2428875 Der f 1.0103 303 515 124.1 4.9e-30
ABL84751 Der f 1.0110 321 515 124.0 5.3e-30
ABL84750 Der f 1.0109 321 511 123.1 9.9e-30
ABL84749 Der f 1.0108 321 511 123.1 9.9e-30
2428875 Der f 1.0107 303 510 122.9 1.1e-29
P16311 Der f 1 321 502 121.1 4.1e-29
AAC82352 Eur m 1.0102 321 500 120.6 5.6e-29
2428875 Der f 1.0104 303 499 120.4 6.2e-29
CAA46316 Der f 1 212 496 119.9 6.3e-29
6771329 Der p 1.0122 222 494 119.4 9.2e-29
P25780 Eur m 1.0101 321 492 118.8 2e-28
AAC82351 Eur m 1.0101 321 492 118.8 2e-28
6771329 Der p 1.0123 222 488 118.0 2.4e-28
6771329 Der p 1.0117 222 488 118.0 2.4e-28
6771329 Der p 1.0120 222 487 117.8 2.8e-28
6771329 Der p 1.0118 222 487 117.8 2.8e-28
6771329 Der p 1.0114 222 486 117.6 3.3e-28
ABA39435 Der p 1.0113 302 488 117.9 3.5e-28
CAQ68250 Der p 1.0124 302 487 117.7 4.1e-28
6771329 Der p 1.0121 222 483 116.9 5.2e-28
6771329 Der p 1.0115 222 483 116.9 5.2e-28
P08176 Der p 1 320 485 117.2 6e-28
6771329 Der p 1.0119 222 482 116.7 6.1e-28
6771329 Der p 1.0116 222 479 116.0 9.8e-28
CAA42677 Eur m 1.0101 211 471 114.2 3.3e-27
P00785 Act d 1 380 460 111.5 3.8e-26
AAA32629 Act d 1 380 459 111.2 4.5e-26
AAB09252 Gly m 1 379 449 109.0 2.2e-25
P22895 Gly m 1 379 448 108.7 2.5e-25
P14080 Cari p 2.0101 352 313 78.0 4.3e-16
AAB02650 Car p papain 345 304 75.9 1.7e-15
V5LU01 Amb a 11.0101 386 298 74.5 5.1e-15
BAA21849 Ana c 2 351 296 74.1 6.2e-15
AAA28296 Der p 1 96 242 62.8 4.4e-12
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Blo t 1.0101 Sequence ID: AAK58415

 Score = 363.7 bits 1566,  Expect = 3e-102
 Identities = 221/221 100%, Positives = 221/221 100%, Gaps = 0/221 0%
Query  1    IPANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHL 60
            IPANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHL
Sbjct  1    IPANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHL 60
Query  61   YDPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQCQANARGTRYHVSSYNSLR 120
            YDPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQCQANARGTRYHVSSYNSLR
Sbjct  61   YDPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQCQANARGTRYHVSSYNSLR 120
Query  121  YRAGDQEIQAAIMNHGPVVIYIHGTEAHFRNLRKGILRGAGYNDAQIDHAVVLVGWGTQN 180
            YRAGDQEIQAAIMNHGPVVIYIHGTEAHFRNLRKGILRGAGYNDAQIDHAVVLVGWGTQN
Sbjct  121  YRAGDQEIQAAIMNHGPVVIYIHGTEAHFRNLRKGILRGAGYNDAQIDHAVVLVGWGTQN 180
Query  181  GIDYWIVRTSWGTQWGDAGYGFVERHHNSLGINNYPIYASL 221
            GIDYWIVRTSWGTQWGDAGYGFVERHHNSLGINNYPIYASL
Sbjct  181  GIDYWIVRTSWGTQWGDAGYGFVERHHNSLGINNYPIYASL 221

Sequence Alignment: 2. Allergen Name: Blo t 1.0201 Sequence ID: AAQ24541

 Score = 242.1 bits 1033,  Expect = 2e-65
 Identities = 135/221 61%, Positives = 170/221 76%, Gaps = 0/221 0%
Query  1    IPANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHL 60
            +P NFDWRQK  +  IR QG CGSCWAFAA+ VAE+LY+I+++Q+I LSEQEL+DCTY+ 
Sbjct  113  LPQNFDWRQKARLTRIRQQGSCGSCWAFAAAGVAESLYSIQKQQSIELSEQELVDCTYNR 172
Query  61   YDPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQCQANARGTRYHVSSYNSLR 120
            YD +Y+C+GC SG S EAFKYM + GL+EE +YPY M+   C  +  G RYHVS Y  LR
Sbjct  173  YDSSYQCNGCGSGYSTEAFKYMIRTGLVEEENYPYNMRTQWCNPDVEGQRYHVSGYQQLR 232
Query  121  YRAGDQEIQAAIMNHGPVVIYIHGTEAHFRNLRKGILRGAGYNDAQIDHAVVLVGWGTQN 180
            Y++ D+++   I  HGPVVIY+HG+  +FRNL  G+LRG  YNDA  DHAV+LVGWGT  
Sbjct  233  YQSSDEDVMYTIQQHGPVVIYMHGSNNYFRNLGNGVLRGVAYNDAYTDHAVILVGWGTVQ 292
Query  181  GIDYWIVRTSWGTQWGDAGYGFVERHHNSLGINNYPIYASL 221
            G+DYWI+R SWGT WG+ GYG+VER HNSLGINN+  YA+L
Sbjct  293  GVDYWIIRNSWGTGWGNGGYGYVERGHNSLGINNFVTYATL 333

Sequence Alignment: 3. Allergen Name: Der f 1.0102 Sequence ID: 2428875

 Score = 125.9 bits 523,  Expect = 1e-30
 Identities = 85/203 41%, Positives = 123/203 60%, Gaps = 18/203 8%
Query  1    IPANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHL 60
            +P+ +D R    V PIR QGGCGSCWAF+  +  E+ Y  +R+ ++ LSEQEL+DC  + 
Sbjct  91   VPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQ- 149
Query  61   YDPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQCQANARGTRYHVSSYNSLR 120
                   HGC+    P   +Y++Q G++EE  YPY  +  QC+       Y +S+Y  + 
Sbjct  150  -------HGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCR-RPNSQHYGISNYCQI- 200
Query  121  YRAGDQEIQAAI-MNHGP--VVIYIHGTEA--HFRNLRKGILRGAGYNDAQIDHAVVLVG 175
            Y    ++I+ A+   H    V+I I    A  H+   R  I R  GY      HAV +VG
Sbjct  201  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDG-RTIIQRDNGYQPNY--HAVNIVG 257
Query  176  WGTQNGIDYWIVRTSWGTQWGDAGYGFVERHHNSLGINNYP 216
            +G+  G+DYWIVR SW T WGD+GYG+ +  +N + I  YP
Sbjct  258  YGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYP 298

Sequence Alignment: 4. Allergen Name: Tyr p 1.0101 Sequence ID: ABM53753

 Score = 124.7 bits 518,  Expect = 3e-30
 Identities = 98/216 45%, Positives = 138/216 63%, Gaps = 12/216 5%
Query  2    PANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQ-NIILSEQELLDCTYHL 60
            P ++DWR     N I  QG C SCWAFAA++  E  YA ++++ N+ LS QEL+DCT   
Sbjct  108  PKSWDWRNIIAFNSIEQQGRCSSCWAFAAATTVEAAYAHQKNKHNLHLSRQELVDCTNRT 167
Query  61   YDPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQ-CQANA----RG--TRYHV 113
            +D  Y  +GC+ G   EA+KY+   G+ E+  Y Y   +N+ C A+     +G   +Y++
Sbjct  168  FDQHYLNYGCKGGWPTEAYKYIMDHGVYEDKLYHYTETFNEVCYADKVAHDKGHPVKYYI 227
Query  114  SSYNSLRYRAGDQEIQAAIMNHGPVVIYIHGTEAHFRNLRKGILRGAGYNDAQIDHAVVL 173
            S+Y  L Y   D+ I A ++ +GP  + IHGT   FR  + GI+R    N A  +H VV+
Sbjct  228  SNYGRLAYNDTDEAIMAMLVTYGPGTVDIHGTSDTFRFYKGGIMRNVMPNSAYTNHIVVV 287
Query  174  VGWGTQN-GIDYWIVRTSWGTQWGDAGYGFVERHHNSLGINN---YPI 217
            VG+GT + G+DYWI+R SWG  WG+ GYG +ERH N LG NN   YPI
Sbjct  288  VGYGTDSSGVDYWIIRNSWGKTWGEHGYGRLERHPNLLGFNNKYNYPI 335

Sequence Alignment: 5. Allergen Name: Der f 1.0105 Sequence ID: 2428875

 Score = 124.5 bits 517,  Expect = 4e-30
 Identities = 84/203 41%, Positives = 122/203 60%, Gaps = 18/203 8%
Query  1    IPANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHL 60
            +P+ +D R    V PIR QGGCGSCWAF+  +  E+ Y  +R+ ++ LSEQEL+DC  + 
Sbjct  91   VPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQ- 149
Query  61   YDPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQCQANARGTRYHVSSYNSLR 120
                   HGC+    P   +Y++Q G++EE  YPY  +  QC+       Y +S+Y  + 
Sbjct  150  -------HGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCR-RPNSQHYDISNYCQI- 200
Query  121  YRAGDQEIQAAI-MNHGP--VVIYIHGTEA--HFRNLRKGILRGAGYNDAQIDHAVVLVG 175
            Y    ++I+ A+   H    V+I I    A  H+   R  I    GY      HAV +VG
Sbjct  201  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDG-RTIIQHDNGYQPNY--HAVNIVG 257
Query  176  WGTQNGIDYWIVRTSWGTQWGDAGYGFVERHHNSLGINNYP 216
            +G+  G+DYWIVR SW T WGD+GYG+ +  +N + I  YP
Sbjct  258  YGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYP 298

Sequence Alignment: 6. Allergen Name: Der f 1.0101 Sequence ID: BAC53948

 Score = 124.3 bits 516,  Expect = 4e-30
 Identities = 84/203 41%, Positives = 122/203 60%, Gaps = 18/203 8%
Query  1    IPANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHL 60
            +P+ +D R    V PIR QGGCGSCWAF+  +  E+ Y  +R+ ++ LSEQEL+DC  + 
Sbjct  109  VPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQ- 167
Query  61   YDPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQCQANARGTRYHVSSYNSLR 120
                   HGC+    P   +Y++Q G++EE  YPY  +  QC+       Y +S+Y  + 
Sbjct  168  -------HGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCR-RPNSQHYGISNYCQI- 218
Query  121  YRAGDQEIQAAI-MNHGP--VVIYIHGTEA--HFRNLRKGILRGAGYNDAQIDHAVVLVG 175
            Y    ++I+ A+   H    V+I I    A  H+   R  I    GY      HAV +VG
Sbjct  219  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDG-RTIIQHDNGYQPNY--HAVNIVG 275
Query  176  WGTQNGIDYWIVRTSWGTQWGDAGYGFVERHHNSLGINNYP 216
            +G+  G+DYWIVR SW T WGD+GYG+ +  +N + I  YP
Sbjct  276  YGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYP 316

Sequence Alignment: 7. Allergen Name: Der f 1.0103 Sequence ID: 2428875

 Score = 124.1 bits 515,  Expect = 5e-30
 Identities = 84/203 41%, Positives = 122/203 60%, Gaps = 18/203 8%
Query  1    IPANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHL 60
            +P+ +D R    V PIR QGGCGSCWAF+  +  E+ Y  +R+ ++ LSEQEL+DC  + 
Sbjct  91   VPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQ- 149
Query  61   YDPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQCQANARGTRYHVSSYNSLR 120
                   HGC+    P   +Y++Q G++EE  YPY  +  QC+       Y +S+Y  + 
Sbjct  150  -------HGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCR-RPNSQHYGISNYCQI- 200
Query  121  YRAGDQEIQAAI-MNHGP--VVIYIHGTEA--HFRNLRKGILRGAGYNDAQIDHAVVLVG 175
            Y    ++I+ A+   H    V+I I    A  H+   R  I    GY      HAV +VG
Sbjct  201  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYGG-RTIIQHDNGYQPNY--HAVNIVG 257
Query  176  WGTQNGIDYWIVRTSWGTQWGDAGYGFVERHHNSLGINNYP 216
            +G+  G+DYWIVR SW T WGD+GYG+ +  +N + I  YP
Sbjct  258  YGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYP 298

Sequence Alignment: 8. Allergen Name: Der f 1.0110 Sequence ID: ABL84751

 Score = 124.0 bits 515,  Expect = 5e-30
 Identities = 84/203 41%, Positives = 122/203 60%, Gaps = 18/203 8%
Query  1    IPANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHL 60
            +P+ +D R    V PIR QGGCGSCWAF+  +  E+ Y  +R+ ++ LSEQEL+DC  + 
Sbjct  109  VPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQ- 167
Query  61   YDPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQCQANARGTRYHVSSYNSLR 120
                   HGC+    P   +Y++Q G++EE  YPY  +  QC+       Y +S+Y  + 
Sbjct  168  -------HGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCR-RPNSQHYGISNYCQI- 218
Query  121  YRAGDQEIQAAI-MNHGP--VVIYIHGTEA--HFRNLRKGILRGAGYNDAQIDHAVVLVG 175
            Y    ++I+ A+   H    V+I I    A  H+   R  I    GY      HAV +VG
Sbjct  219  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDG-RTIIRHDNGYQPNY--HAVNIVG 275
Query  176  WGTQNGIDYWIVRTSWGTQWGDAGYGFVERHHNSLGINNYP 216
            +G+  G+DYWIVR SW T WGD+GYG+ +  +N + I  YP
Sbjct  276  YGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYP 316

Sequence Alignment: 9. Allergen Name: Der f 1.0109 Sequence ID: ABL84750

 Score = 123.1 bits 511,  Expect = 1e-29
 Identities = 83/203 40%, Positives = 122/203 60%, Gaps = 18/203 8%
Query  1    IPANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHL 60
            +P+ +D R    V PIR QGGCGSCWAF+  +  E+ Y  +R+ ++ LSEQ+L+DC  + 
Sbjct  109  VPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQKLVDCASQ- 167
Query  61   YDPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQCQANARGTRYHVSSYNSLR 120
                   HGC+    P   +Y++Q G++EE  YPY  +  QC+       Y +S+Y  + 
Sbjct  168  -------HGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCR-RPNSQHYGISNYCQI- 218
Query  121  YRAGDQEIQAAI-MNHGP--VVIYIHGTEA--HFRNLRKGILRGAGYNDAQIDHAVVLVG 175
            Y    ++I+ A+   H    V+I I    A  H+   R  I    GY      HAV +VG
Sbjct  219  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDG-RTIIQHDNGYQPNY--HAVNIVG 275
Query  176  WGTQNGIDYWIVRTSWGTQWGDAGYGFVERHHNSLGINNYP 216
            +G+  G+DYWIVR SW T WGD+GYG+ +  +N + I  YP
Sbjct  276  YGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYP 316

Sequence Alignment: 10. Allergen Name: Der f 1.0108 Sequence ID: ABL84749

 Score = 123.1 bits 511,  Expect = 1e-29
 Identities = 83/203 40%, Positives = 121/203 59%, Gaps = 18/203 8%
Query  1    IPANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHL 60
            +P+ +D R      PIR QGGCGSCWAF+  +  E+ Y  +R+ ++ LSEQEL+DC  + 
Sbjct  109  VPSELDLRSLRTATPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQ- 167
Query  61   YDPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQCQANARGTRYHVSSYNSLR 120
                   HGC+    P   +Y++Q G++EE  YPY  +  QC+       Y +S+Y  + 
Sbjct  168  -------HGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCR-RPNSQHYGISNYCQI- 218
Query  121  YRAGDQEIQAAI-MNHGP--VVIYIHGTEA--HFRNLRKGILRGAGYNDAQIDHAVVLVG 175
            Y    ++I+ A+   H    V+I I    A  H+   R  I    GY      HAV +VG
Sbjct  219  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDG-RTIIQHDNGYQPNY--HAVNIVG 275
Query  176  WGTQNGIDYWIVRTSWGTQWGDAGYGFVERHHNSLGINNYP 216
            +G+  G+DYWIVR SW T WGD+GYG+ +  +N + I  YP
Sbjct  276  YGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYP 316

Sequence Alignment: 11. Allergen Name: Der f 1.0107 Sequence ID: 2428875

 Score = 122.9 bits 510,  Expect = 1e-29
 Identities = 83/203 40%, Positives = 122/203 60%, Gaps = 18/203 8%
Query  1    IPANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHL 60
            +P+ +D R    V PIR QGGCGSCWAF+  +  E+ Y  +R+ ++ LSEQEL+DC  + 
Sbjct  91   VPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQ- 149
Query  61   YDPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQCQANARGTRYHVSSYNSLR 120
                   HGC+    P   +Y++Q G++EE  YPY  +  +C+       Y +S+Y  + 
Sbjct  150  -------HGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQRCR-RPNSQHYGISNYCQI- 200
Query  121  YRAGDQEIQAAI-MNHGP--VVIYIHGTEA--HFRNLRKGILRGAGYNDAQIDHAVVLVG 175
            Y    ++I+ A+   H    V+I I    A  H+   R  I    GY      HAV +VG
Sbjct  201  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDG-RTIIQHDNGYQPNY--HAVNIVG 257
Query  176  WGTQNGIDYWIVRTSWGTQWGDAGYGFVERHHNSLGINNYP 216
            +G+  G+DYWIVR SW T WGD+GYG+ +  +N + I  YP
Sbjct  258  YGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYP 298

Sequence Alignment: 12. Allergen Name: Der f 1 Sequence ID: P16311

 Score = 121.1 bits 502,  Expect = 4e-29
 Identities = 83/203 40%, Positives = 121/203 59%, Gaps = 18/203 8%
Query  1    IPANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHL 60
            +P+ +D R    V PIR QGGCGSCWAF+  +  E+ Y  +R+ ++ LSEQEL+DC  + 
Sbjct  109  VPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQ- 167
Query  61   YDPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQCQANARGTRYHVSSYNSLR 120
                   HGC+    P   +Y++Q G++EE  YPY  +  +C+       Y +S+Y  + 
Sbjct  168  -------HGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQRCR-RPNSQHYGISNYCQI- 218
Query  121  YRAGDQEIQAAI-MNHGP--VVIYIHGTEA--HFRNLRKGILRGAGYNDAQIDHAVVLVG 175
            Y    ++I+ A+   H    V+I I    A  H+   R  I    GY      HAV +VG
Sbjct  219  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDG-RTIIQHDNGYQPNY--HAVNIVG 275
Query  176  WGTQNGIDYWIVRTSWGTQWGDAGYGFVERHHNSLGINNYP 216
            +G+  G DYWIVR SW T WGD+GYG+ +  +N + I  YP
Sbjct  276  YGSTQGDDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYP 316

Sequence Alignment: 13. Allergen Name: Eur m 1.0102 Sequence ID: AAC82352

 Score = 120.6 bits 500,  Expect = 6e-29
 Identities = 80/204 39%, Positives = 121/204 59%, Gaps = 16/204 7%
Query  1    IPANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHL 60
            +P+ +D R    V PIRNQGGCGSCWAF+  +  E+ Y  +R+ ++ L+EQEL+DC  + 
Sbjct  109  LPSELDLRSLRTVTPIRNQGGCGSCWAFSGVASTESAYLAYRNMSLDLAEQELVDCASQ- 167
Query  61   YDPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQCQ-ANARGTRYHVSSYNSL 119
                   +GC+    P   +Y++Q G+++E +YPY  +   C+  NA+  RY + +Y  +
Sbjct  168  -------NGCHGDTIPRGIEYIQQNGVVQEHYYPYVAREQSCHRPNAQ--RYGLKNYCQI 218
Query  120  RYRAGDQEIQAAIMNHGPVVIYIHGTEAH-FRNL--RKGILRGAGYNDAQIDHAVVLVGW 176
                 ++  QA    H  V + I   + + FR+   R  +    GY      HAV +VG+
Sbjct  219  SPPDSNKIRQALTQTHTAVAVIIGIKDLNAFRHYDGRTIMQHDNGYQPNY--HAVNIVGY 276
Query  177  GTQNGIDYWIVRTSWGTQWGDAGYGFVERHHNSLGINNYP 216
            G   G+DYWIVR SW T WGD GYG+   + N + I  YP
Sbjct  277  GNTQGVDYWIVRNSWDTTWGDNGYGYFAANINLMMIEQYP 316

Sequence Alignment: 14. Allergen Name: Der f 1.0104 Sequence ID: 2428875

 Score = 120.4 bits 499,  Expect = 6e-29
 Identities = 83/203 40%, Positives = 121/203 59%, Gaps = 18/203 8%
Query  1    IPANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHL 60
            +P+ +D R    V PIR QGGCGSCWAF+  +  E+ Y  +R+ ++ LSEQEL+DC  + 
Sbjct  91   VPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQ- 149
Query  61   YDPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQCQANARGTRYHVSSYNSLR 120
                   HG +    P   +Y++Q G++EE  YPY  +  QC+       Y +S+Y  + 
Sbjct  150  -------HGRHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCR-RPNSQHYGISNYCQI- 200
Query  121  YRAGDQEIQAAI-MNHGP--VVIYIHGTEA--HFRNLRKGILRGAGYNDAQIDHAVVLVG 175
            Y    ++I+ A+   H    V+I I    A  H+   R  I    GY      HAV +VG
Sbjct  201  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDG-RTIIQHDNGYQPNY--HAVNIVG 257
Query  176  WGTQNGIDYWIVRTSWGTQWGDAGYGFVERHHNSLGINNYP 216
            +G+  G+DYWIVR SW T WGD+GYG+ +  +N + I  YP
Sbjct  258  YGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLMMIEQYP 298

Sequence Alignment: 15. Allergen Name: Der f 1 Sequence ID: CAA46316

 Score = 119.9 bits 496,  Expect = 6e-29
 Identities = 81/195 41%, Positives = 119/195 61%, Gaps = 18/195 9%
Query  1    IPANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHL 60
            +P+ +D R    V PIR QGGCGSCWAF+  +  E+ Y  +R+ ++ LSEQEL+DC  + 
Sbjct  12   VPSELDLRSLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQELVDCASQ- 70
Query  61   YDPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQCQANARGTRYHVSSYNSLR 120
                   HGC+    P   +Y++Q G++EE  YPY  +  QC+       Y +S+Y  + 
Sbjct  71   -------HGCHGDTIPRGIEYIQQNGVVEERSYPYVAREQQCR-RPNSQHYGISNYCQI- 121
Query  121  YRAGDQEIQAAI-MNHGP--VVIYIHGTEA--HFRNLRKGILRGAGYNDAQIDHAVVLVG 175
            Y    ++I+ A+   H    V+I I    A  H+ + R  I    GY      HAV +VG
Sbjct  122  YPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHY-DGRTIIQHDNGYQPNY--HAVNIVG 178
Query  176  WGTQNGIDYWIVRTSWGTQWGDAGYGFVERHHN 208
            +G+  G+DYWIVR SW T WGD+GYG+ +  +N
Sbjct  179  YGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNN 211

Sequence Alignment: 16. Allergen Name: Der p 1.0122 Sequence ID: 6771329

 Score = 119.4 bits 494,  Expect = 9e-29
 Identities = 83/202 41%, Positives = 121/202 59%, Gaps = 18/202 8%
Query  2    PANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHLY 61
            PA  D RQ   V PIR QGGCGSCWAF+  +  E+ Y  +R+Q++ L+EQEL+DC  +  
Sbjct  11   PAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQ-- 68
Query  62   DPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQCQ-ANARGTRYHVSSYNSLR 120
                  HGC+    P   +Y+++ G+++ES+Y Y  +   C+  NA+  R+  S+Y  + 
Sbjct  69   ------HGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQ--RFGTSNYCQIY 120
Query  121  YRAGDQEIQAAIMNHGP--VVIYIHGTEAHFRNL--RKGILRGAGYNDAQIDHAVVLVGW 176
                ++  +A    H    V+I I   +A FR+   R  I R  GY      HAV +VG+
Sbjct  121  PPNANKIREALAQTHSAIAVIIGIKDLDA-FRHYDGRTIIQRDNGYQPNY--HAVNIVGY 177
Query  177  GTQNGIDYWIVRTSWGTQWGDAGYGFVERHHNSLGINNYP 216
                G+DYWIVR SW T WGD GYG+   + + + I  YP
Sbjct  178  SNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYP 217

Sequence Alignment: 17. Allergen Name: Eur m 1.0101 Sequence ID: P25780

 Score = 118.8 bits 492,  Expect = 2e-28
 Identities = 80/209 38%, Positives = 121/209 57%, Gaps = 16/209 7%
Query  1    IPANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHL 60
            +P+ +D R    V PIR QGGCGSCWAF+  +  E+ Y  +R+ ++ L+EQEL+DC  + 
Sbjct  109  LPSELDLRSLRTVTPIRMQGGCGSCWAFSGVASTESAYLAYRNMSLDLAEQELVDCASQ- 167
Query  61   YDPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQCQ-ANARGTRYHVSSYNSL 119
                   +GC+    P   +Y++Q G+++E +YPY  +   C+  NA+  RY + +Y  +
Sbjct  168  -------NGCHGDTIPRGIEYIQQNGVVQEHYYPYVAREQSCHRPNAQ--RYGLKNYCQI 218
Query  120  RYRAGDQEIQAAIMNHGPVVIYIHGTEAH-FRNL--RKGILRGAGYNDAQIDHAVVLVGW 176
                 ++  QA    H  V + I   + + FR+   R  +    GY      HAV +VG+
Sbjct  219  SPPDSNKIRQALTQTHTAVAVIIGIKDLNAFRHYDGRTIMQHDNGYQPNY--HAVNIVGY 276
Query  177  GTQNGIDYWIVRTSWGTQWGDAGYGFVERHHNSLGINNYPIYASL 221
            G   G+DYWIVR SW T WGD GYG+   + N + I  YP    L
Sbjct  277  GNTQGVDYWIVRNSWDTTWGDNGYGYFAANINLMMIEQYPYVVML 321

Sequence Alignment: 18. Allergen Name: Eur m 1.0101 Sequence ID: AAC82351

 Score = 118.8 bits 492,  Expect = 2e-28
 Identities = 80/209 38%, Positives = 121/209 57%, Gaps = 16/209 7%
Query  1    IPANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHL 60
            +P+ +D R    V PIR QGGCGSCWAF+  +  E+ Y  +R+ ++ L+EQEL+DC  + 
Sbjct  109  LPSELDLRSLRTVTPIRMQGGCGSCWAFSGVASTESAYLAYRNMSLDLAEQELVDCASQ- 167
Query  61   YDPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQCQ-ANARGTRYHVSSYNSL 119
                   +GC+    P   +Y++Q G+++E +YPY  +   C+  NA+  RY + +Y  +
Sbjct  168  -------NGCHGDTIPRGIEYIQQNGVVQEHYYPYVAREQSCHRPNAQ--RYGLKNYCQI 218
Query  120  RYRAGDQEIQAAIMNHGPVVIYIHGTEAH-FRNL--RKGILRGAGYNDAQIDHAVVLVGW 176
                 ++  QA    H  V + I   + + FR+   R  +    GY      HAV +VG+
Sbjct  219  SPPDSNKIRQALTQTHTAVAVIIGIKDLNAFRHYDGRTIMQHDNGYQPNY--HAVNIVGY 276
Query  177  GTQNGIDYWIVRTSWGTQWGDAGYGFVERHHNSLGINNYPIYASL 221
            G   G+DYWIVR SW T WGD GYG+   + N + I  YP    L
Sbjct  277  GNTQGVDYWIVRNSWDTTWGDNGYGYFAANINLMMIEQYPYVVML 321

Sequence Alignment: 19. Allergen Name: Der p 1.0123 Sequence ID: 6771329

 Score = 118.0 bits 488,  Expect = 2e-28
 Identities = 83/202 41%, Positives = 122/202 60%, Gaps = 18/202 8%
Query  2    PANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHLY 61
            PA  D RQ   V PIR QGGCGSCWAF+  +  E+ Y  +R+Q++ L+EQEL+DC  +  
Sbjct  11   PAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQ-- 68
Query  62   DPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQCQ-ANARGTRYHVSSYNSLR 120
                  HGC+    P   +Y+++ G+++ES+Y Y  +   C+  NA+  R+ +S+Y  + 
Sbjct  69   ------HGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQ--RFGISNYCQIY 120
Query  121  YRAGDQEIQAAIMNHGP--VVIYIHGTEAHFRNL--RKGILRGAGYNDAQIDHAVVLVGW 176
                ++  +A    H    V+I I   +A FR+   R  I R  GY      HAV +VG+
Sbjct  121  PPNANKIREALAQTHSAIAVIIGIKDLDA-FRHYDGRTIIQRDNGYQPNY--HAVNIVGY 177
Query  177  GTQNGIDYWIVRTSWGTQWGDAGYGFVERHHNSLGINNYP 216
                G+DYWIVR SW T WGD GYG+   + + + I  YP
Sbjct  178  SNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEGYP 217

Sequence Alignment: 20. Allergen Name: Der p 1.0117 Sequence ID: 6771329

 Score = 118.0 bits 488,  Expect = 2e-28
 Identities = 83/202 41%, Positives = 122/202 60%, Gaps = 18/202 8%
Query  2    PANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHLY 61
            PA  D RQ   V PIR QGGCGSCWAF+  +  E+ Y  +R+Q++ L+EQEL+DC  +  
Sbjct  11   PAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQ-- 68
Query  62   DPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQCQ-ANARGTRYHVSSYNSLR 120
                  HGC+    P   +Y+++ G+++ES+Y Y  +   C+  NA+  R+ +S+Y  + 
Sbjct  69   ------HGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQ--RFGISNYCQIY 120
Query  121  YRAGDQEIQAAIMNHGP--VVIYIHGTEAHFRNL--RKGILRGAGYNDAQIDHAVVLVGW 176
                ++  +A    H    V+I I   +A FR+   R  I R  GY      HAV +VG+
Sbjct  121  PPNANKIREALTQTHSAIAVIIGIKDLDA-FRHYDGRTIIQRDNGYQPNY--HAVNIVGY 177
Query  177  GTQNGIDYWIVRTSWGTQWGDAGYGFVERHHNSLGINNYP 216
                G+DYWIVR SW T WGD GYG+   + + + I  YP
Sbjct  178  SNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYP 217

Sequence Alignment: 21. Allergen Name: Der p 1.0120 Sequence ID: 6771329

 Score = 117.8 bits 487,  Expect = 3e-28
 Identities = 83/202 41%, Positives = 122/202 60%, Gaps = 18/202 8%
Query  2    PANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHLY 61
            PA  D RQ   V PIR QGGCGSCWAF+  +  E+ Y  +R+Q++ L+EQEL+DC  +  
Sbjct  11   PAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQ-- 68
Query  62   DPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQCQ-ANARGTRYHVSSYNSLR 120
                  HGC+    P   +Y+++ G+++ES+Y Y  +   C+  NA+  R+ +S+Y  + 
Sbjct  69   ------HGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQ--RFGISNYCQIY 120
Query  121  YRAGDQEIQAAIMNHGP--VVIYIHGTEAHFRNL--RKGILRGAGYNDAQIDHAVVLVGW 176
                ++  +A    H    V+I I   +A FR+   R  I R  GY      HAV +VG+
Sbjct  121  PPNANKIREALAQTHSAIAVIIGIKDLDA-FRHYDGRTIIRRDNGYQPNY--HAVNIVGY 177
Query  177  GTQNGIDYWIVRTSWGTQWGDAGYGFVERHHNSLGINNYP 216
                G+DYWIVR SW T WGD GYG+   + + + I  YP
Sbjct  178  SNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYP 217

Sequence Alignment: 22. Allergen Name: Der p 1.0118 Sequence ID: 6771329

 Score = 117.8 bits 487,  Expect = 3e-28
 Identities = 83/202 41%, Positives = 122/202 60%, Gaps = 18/202 8%
Query  2    PANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHLY 61
            PA  D RQ   V PIR QGGCGSCWAF+  +  E+ Y  +R+Q++ L+EQEL+DC  +  
Sbjct  11   PAEIDLRQIRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQ-- 68
Query  62   DPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQCQ-ANARGTRYHVSSYNSLR 120
                  HGC+    P   +Y+++ G+++ES+Y Y  +   C+  NA+  R+ +S+Y  + 
Sbjct  69   ------HGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQ--RFGISNYCQIY 120
Query  121  YRAGDQEIQAAIMNHGP--VVIYIHGTEAHFRNL--RKGILRGAGYNDAQIDHAVVLVGW 176
                ++  +A    H    V+I I   +A FR+   R  I R  GY      HAV +VG+
Sbjct  121  PPNANKIREALAQTHSAIAVIIGIKDLDA-FRHYDGRTIIQRDNGYQPNY--HAVNIVGY 177
Query  177  GTQNGIDYWIVRTSWGTQWGDAGYGFVERHHNSLGINNYP 216
                G+DYWIVR SW T WGD GYG+   + + + I  YP
Sbjct  178  SNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYP 217

Sequence Alignment: 23. Allergen Name: Der p 1.0114 Sequence ID: 6771329

 Score = 117.6 bits 486,  Expect = 3e-28
 Identities = 83/202 41%, Positives = 121/202 59%, Gaps = 18/202 8%
Query  2    PANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHLY 61
            PA  D RQ   V PIR QGGCGSCWAF+  +  E+ Y  +R+Q++ L+EQEL+DC  +  
Sbjct  11   PAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQ-- 68
Query  62   DPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQCQ-ANARGTRYHVSSYNSLR 120
                  HGC+    P    Y+++ G+++ES+Y Y  +   C+  NA+  R+ +S+Y  + 
Sbjct  69   ------HGCHGDTIPRGIAYIQHNGVVQESYYRYVAREQSCRRPNAQ--RFGISNYCQIY 120
Query  121  YRAGDQEIQAAIMNHGP--VVIYIHGTEAHFRNL--RKGILRGAGYNDAQIDHAVVLVGW 176
                ++  +A    H    V+I I   +A FR+   R  I R  GY      HAV +VG+
Sbjct  121  PPNANKIREALAQTHSAIAVIIGIKDLDA-FRHYDGRTIIQRDNGYQPNY--HAVNIVGY 177
Query  177  GTQNGIDYWIVRTSWGTQWGDAGYGFVERHHNSLGINNYP 216
                G+DYWIVR SW T WGD GYG+   + + + I  YP
Sbjct  178  SNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYP 217

Sequence Alignment: 24. Allergen Name: Der p 1.0113 Sequence ID: ABA39435

 Score = 117.9 bits 488,  Expect = 3e-28
 Identities = 83/202 41%, Positives = 122/202 60%, Gaps = 18/202 8%
Query  2    PANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHLY 61
            PA  D RQ   V PIR QGGCGSCWAF+  +  E+ Y  +R+Q++ L+EQEL+DC  +  
Sbjct  91   PAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQ-- 148
Query  62   DPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQCQ-ANARGTRYHVSSYNSLR 120
                  HGC+    P   +Y+++ G+++ES+Y Y  +   C+  NA+  R+ +S+Y  + 
Sbjct  149  ------HGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQ--RFGISNYCQIY 200
Query  121  YRAGDQEIQAAIMNHGP--VVIYIHGTEAHFRNL--RKGILRGAGYNDAQIDHAVVLVGW 176
                ++  +A    H    V+I I   +A FR+   R  I R  GY      HAV +VG+
Sbjct  201  PPNANKIREALAQTHSAIAVIIGIKDLDA-FRHYDGRTIIQRDNGYQPNY--HAVNIVGY 257
Query  177  GTQNGIDYWIVRTSWGTQWGDAGYGFVERHHNSLGINNYP 216
                G+DYWIVR SW T WGD GYG+   + + + I  YP
Sbjct  258  SNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYP 297

Sequence Alignment: 25. Allergen Name: Der p 1.0124 Sequence ID: CAQ68250

 Score = 117.7 bits 487,  Expect = 4e-28
 Identities = 83/202 41%, Positives = 121/202 59%, Gaps = 18/202 8%
Query  2    PANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHLY 61
            PA  D RQ   V PIR QGGCGSCWAF+  +  E+ Y  +R+Q++ L+EQEL+DC  +  
Sbjct  91   PAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQ-- 148
Query  62   DPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQCQ-ANARGTRYHVSSYNSLR 120
                  HGC     P   +Y+++ G+++ES+Y Y  +   C+  NA+  R+ +S+Y  + 
Sbjct  149  ------HGCNGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQ--RFGISNYCQIY 200
Query  121  YRAGDQEIQAAIMNHGP--VVIYIHGTEAHFRNL--RKGILRGAGYNDAQIDHAVVLVGW 176
                ++  +A    H    V+I I   +A FR+   R  I R  GY      HAV +VG+
Sbjct  201  PPNANKIREALAQTHSAIAVIIGIKDLDA-FRHYDGRTIIQRDNGYQPNY--HAVNIVGY 257
Query  177  GTQNGIDYWIVRTSWGTQWGDAGYGFVERHHNSLGINNYP 216
                G+DYWIVR SW T WGD GYG+   + + + I  YP
Sbjct  258  SNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYP 297

Sequence Alignment: 26. Allergen Name: Der p 1.0121 Sequence ID: 6771329

 Score = 116.9 bits 483,  Expect = 5e-28
 Identities = 85/201 42%, Positives = 123/201 61%, Gaps = 20/201 9%
Query  2    PANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHLY 61
            PA  D RQ   V PIR QGGCGSCWAF+  +  E+ Y  +R Q++ L+EQEL+DC  +  
Sbjct  11   PAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRSQSLDLAEQELVDCASQ-- 68
Query  62   DPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQCQ-ANARGTRYHVSSYNSLR 120
                  HGC+    P   +Y+++ G+++ES+Y Y  +   C+  NA+  R+ +S+Y  + 
Sbjct  69   ------HGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQ--RFGISNYCQI- 119
Query  121  YRAGDQEIQAAI-MNHGP--VVIYIHGTEAHFRNL--RKGILRGAGYNDAQIDHAVVLVG 175
            Y     +I+ A+   H    V+I I   +A FR+   R  I R  GY      HAV +VG
Sbjct  120  YPPNVNKIREALAQTHSAIAVIIGIKDLDA-FRHYDGRTIIQRDNGYQPNY--HAVNIVG 176
Query  176  WGTQNGIDYWIVRTSWGTQWGDAGYGFVERHHNSLGINNYP 216
            +    G+DYWIVR SW T WGD GYG+   + + + I  YP
Sbjct  177  YSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEGYP 217

Sequence Alignment: 27. Allergen Name: Der p 1.0115 Sequence ID: 6771329

 Score = 116.9 bits 483,  Expect = 5e-28
 Identities = 81/203 39%, Positives = 119/203 58%, Gaps = 16/203 7%
Query  2    PANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHLY 61
            PA  D RQ   V PIR QGGCGSCWAF+  +  E+ Y  +R+Q++ L+EQEL+DC  +  
Sbjct  11   PAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQ-- 68
Query  62   DPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQCQANARGTRYHVSSYNSLRY 121
                  HGC+    P   +Y+++ G+++ES+Y Y  +   C+      R+ +S+Y  +  
Sbjct  69   ------HGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCR-RPNTQRFGISNYCQIYP 121
Query  122  RAGDQEIQAAIMNHGP--VVIYIHGTEAHFRNL--RKGILRGAGYNDAQIDHAVVLVGWG 177
               ++  +A    H    V+I I   +A FR+   R  I R  GY      HAV +VG+ 
Sbjct  122  PNANKIREALAQTHSAIAVIIGIKDLDA-FRHYDGRTIIQRDNGYQPNY--HAVNIVGYS 178
Query  178  TQNGIDYWIVRTSWGTQWGDAGYGFVERHHNSLGINNYP 216
               G+DYWIVR SW T WGD GYG+   + + + I  YP
Sbjct  179  NAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYP 217

Sequence Alignment: 28. Allergen Name: Der p 1 Sequence ID: P08176

 Score = 117.2 bits 485,  Expect = 6e-28
 Identities = 85/201 42%, Positives = 124/201 61%, Gaps = 20/201 9%
Query  2    PANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHLY 61
            PA  D RQ   V PIR QGGCGSCWAF+  +  E+ Y  +R+Q++ L+EQEL+DC  +  
Sbjct  109  PAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQ-- 166
Query  62   DPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQCQ-ANARGTRYHVSSYNSLR 120
                  HGC+    P   +Y+++ G+++ES+Y Y  +   C+  NA+  R+ +S+Y  + 
Sbjct  167  ------HGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQ--RFGISNYCQI- 217
Query  121  YRAGDQEIQAAI-MNHGP--VVIYIHGTEAHFRNL--RKGILRGAGYNDAQIDHAVVLVG 175
            Y     +I+ A+   H    V+I I   +A FR+   R  I R  GY      HAV +VG
Sbjct  218  YPPNVNKIREALAQTHSAIAVIIGIKDLDA-FRHYDGRTIIQRDNGYQPNY--HAVNIVG 274
Query  176  WGTQNGIDYWIVRTSWGTQWGDAGYGFVERHHNSLGINNYP 216
            +    G+DYWIVR SW T WGD GYG+   + + + I  YP
Sbjct  275  YSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYP 315

Sequence Alignment: 29. Allergen Name: Der p 1.0119 Sequence ID: 6771329

 Score = 116.7 bits 482,  Expect = 6e-28
 Identities = 85/201 42%, Positives = 123/201 61%, Gaps = 20/201 9%
Query  2    PANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHLY 61
            PA  D RQ   V PIR QGGCGSCWAF+  +  E+ Y  +R+Q++ L+EQEL+DC  +  
Sbjct  11   PAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQ-- 68
Query  62   DPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQCQ-ANARGTRYHVSSYNSLR 120
                  HGC+    P    Y+++ G+++ES+Y Y  +   C+  NA+  R+ +S+Y  + 
Sbjct  69   ------HGCHGDTIPRGIGYIQHNGVVQESYYRYVAREQSCRRPNAQ--RFGISNYCQI- 119
Query  121  YRAGDQEIQAAI-MNHGP--VVIYIHGTEAHFRNL--RKGILRGAGYNDAQIDHAVVLVG 175
            Y     +I+ A+   H    V+I I   +A FR+   R  I R  GY      HAV +VG
Sbjct  120  YPPNVNKIREALAQTHSAIAVIIGIKDLDA-FRHYDGRTIIQRDNGYQPNY--HAVNIVG 176
Query  176  WGTQNGIDYWIVRTSWGTQWGDAGYGFVERHHNSLGINNYP 216
            +    G+DYWIVR SW T WGD GYG+   + + + I  YP
Sbjct  177  YSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYP 217

Sequence Alignment: 30. Allergen Name: Der p 1.0116 Sequence ID: 6771329

 Score = 116.0 bits 479,  Expect = 1e-27
 Identities = 82/202 40%, Positives = 122/202 60%, Gaps = 18/202 8%
Query  2    PANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHLY 61
            PA  D RQ   V PIR QGGCGSCWAF+  +  E+ Y  +R+Q++ L+EQEL+DC  +  
Sbjct  11   PAEIDLRQLRTVTPIRMQGGCGSCWAFSGVAATESAYLAYRNQSLDLAEQELVDCASQ-- 68
Query  62   DPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQCQ-ANARGTRYHVSSYNSLR 120
                  HGC+    P   +Y+++ G+++ES+Y Y  +   C+  NA+  R+ +S+Y  + 
Sbjct  69   ------HGCHGDTIPRGIEYIQHNGVVQESYYRYVAREQSCRRPNAQ--RFGISNYCQIY 120
Query  121  YRAGDQEIQAAIMNHGP--VVIYIHGTEAHFRNL--RKGILRGAGYNDAQIDHAVVLVGW 176
                ++  +A    H    V+I I   +A FR+   R  I R  GY      +AV +VG+
Sbjct  121  PPNANKIREALAQTHSAIAVIIGIKDLDA-FRHYDGRTIIQRDNGYQPNY--YAVNIVGY 177
Query  177  GTQNGIDYWIVRTSWGTQWGDAGYGFVERHHNSLGINNYP 216
                G+DYWIVR SW T WGD GYG+   + + + I  YP
Sbjct  178  SNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYP 217

Sequence Alignment: 31. Allergen Name: Eur m 1.0101 Sequence ID: CAA42677

 Score = 114.2 bits 471,  Expect = 3e-27
 Identities = 75/190 39%, Positives = 114/190 60%, Gaps = 16/190 8%
Query  1    IPANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHL 60
            +P+ +D R    V PIR QGGCGSCWAF+  +  E+ Y  +R+ ++ L+EQEL+DC  + 
Sbjct  11   LPSELDLRSLRTVTPIRMQGGCGSCWAFSGVASTESAYLAYRNMSLDLAEQELVDCASQ- 69
Query  61   YDPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQCQ-ANARGTRYHVSSYNSL 119
                   +GC+    P   +Y++Q G+++E +YPY  +   C+  NA+  RY + +Y  +
Sbjct  70   -------NGCHGDTIPRGIEYIQQNGVVQEHYYPYVAREQSCHRPNAQ--RYGLKNYCQI 120
Query  120  RYRAGDQEIQAAIMNHGPVVIYIHGTEAH-FRNL--RKGILRGAGYNDAQIDHAVVLVGW 176
                 ++  QA    H  V + I   + + FR+   R  +    GY      HAV +VG+
Sbjct  121  SPPDSNKIRQALTQTHTAVAVIIGIKDLNAFRHYDGRTIMQHDNGYQPNY--HAVNIVGY 178
Query  177  GTQNGIDYWIVRTSWGTQWGDAGYGF 202
            G   G+DYWIVR SW T WGD GYG+
Sbjct  179  GNTQGVDYWIVRNSWDTTWGDNGYGY 204

Sequence Alignment: 32. Allergen Name: Act d 1 Sequence ID: P00785

 Score = 111.5 bits 460,  Expect = 4e-26
 Identities = 76/209 36%, Positives = 116/209 55%, Gaps = 14/209 6%
Query  1    IPANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHL 60
            +P+  DWR    V  I++QG CG CWAF+A +  E +  I     I LSEQEL+DC    
Sbjct  127  LPSYVDWRSAGAVVDIKSQGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGR-- 184
Query  61   YDPTYKCHGCQSGMSPEAFKYMKQKGLLE-ESHYPYKMKLNQCQANARGTRY-HVSSYNS 118
               T    GC  G   + F+++   G +  E +YPY  +  +C  + +  +Y  + +Y +
Sbjct  185  ---TQNTRGCNGGYITDGFQFIINNGGINTEENYPYTAQDGECNLDLQNEKYVTIDTYEN 241
Query  119  LRYRAGDQEIQAAIMNHGPVVIYIHGTEAHFRNLRKGILRGAGYNDAQIDHAVVLVGWGT 178
            + Y   +  +Q A+  + PV + +      F++   GI+ G       IDHAV +VG+GT
Sbjct  242  VPYN-NEWALQTAV-TYQPVSVALDAAGDAFKHYSSGIFTGP--CGTAIDHAVTIVGYGT 297
Query  179  QNGIDYWIVRTSWGTQWGDAGYGFVERH---HNSLGINNYPIY 218
            + GIDYWIV+ SW T WG+ GY  + R+     + GI   P Y
Sbjct  298  EGGIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPSY 340

Sequence Alignment: 33. Allergen Name: Act d 1 Sequence ID: AAA32629

 Score = 111.2 bits 459,  Expect = 4e-26
 Identities = 76/209 36%, Positives = 114/209 54%, Gaps = 14/209 6%
Query  1    IPANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHL 60
            +P+  DWR    V  I++QG CG CWAF+A +  E +  I     I LSEQEL+DC    
Sbjct  127  LPSYVDWRSAGAVVDIKSQGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGR-- 184
Query  61   YDPTYKCHGCQSGMSPEAFKYMKQKGLLE-ESHYPYKMKLNQCQANARGTRY-HVSSYNS 118
               T    GC  G   + F+++   G +  E +YPY  +  +C    +  +Y  + +Y +
Sbjct  185  ---TQNTRGCNGGYITDGFQFIINNGGINTEENYPYTAQDGECNVELQNEKYVTIDTYEN 241
Query  119  LRYRAGDQEIQAAIMNHGPVVIYIHGTEAHFRNLRKGILRGAGYNDAQIDHAVVLVGWGT 178
            + Y   +  +Q A+  + PV + +      F+    GI+ G       IDHAV +VG+GT
Sbjct  242  VPYN-NEWALQTAV-TYQPVSVALDAAGDAFKQYSSGIFTGP--CGTAIDHAVTIVGYGT 297
Query  179  QNGIDYWIVRTSWGTQWGDAGYGFVERH---HNSLGINNYPIY 218
            + GIDYWIV+ SW T WG+ GY  + R+     + GI   P Y
Sbjct  298  EGGIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPSY 340

Sequence Alignment: 34. Allergen Name: Gly m 1 Sequence ID: AAB09252

 Score = 109.0 bits 449,  Expect = 2e-25
 Identities = 72/210 34%, Positives = 123/210 58%, Gaps = 17/210 8%
Query  2    PANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHLY 61
            PA++DWR+K  +  ++ QGGCG  WAF+A+   E  +AI     + LSEQEL+DC     
Sbjct  136  PASWDWRKKGVITQVKYQGGCGRGWAFSATGAIEAAHAIATGDLVSLSEQELVDCVE--- 192
Query  62   DPTYKCHGCQSGMSPEAFKY-MKQKGLLEESHYPYKMKLNQCQANARGTRYHVSSYNSLR 120
                +  G  +G   ++F++ +++ G+  +  YPY+ K  +C+AN    +  +  Y +L 
Sbjct  193  ----ESEGSYNGWQYQSFEWVLEHGGIATDDDYPYRAKEGRCKANKIQDKVTIDGYETLI 248
Query  121  Y--RAGDQEIQAAIMN---HGPVVIYIHGTEAHFRNLRKGILRGAGYNDAQ-IDHAVVLV 174
                + + E + A ++     P+ + I   + H+     GI  G        I+H V+LV
Sbjct  249  MSDESTESETEQAFLSAILEQPISVSIDAKDFHLYT--GGIYDGENCTSPYGINHFVLLV 306
Query  175  GWGTQNGIDYWIVRTSWGTQWGDAGYGFVERHH-NSLGINNYPIYAS 220
            G+G+ +G+DYWI + SWG  WG+ GY +++R+  N LG+     +AS
Sbjct  307  GYGSADGVDYWIAKNSWGEDWGEDGYIWIQRNTGNLLGVCGMNYFAS 353

Sequence Alignment: 35. Allergen Name: Gly m 1 Sequence ID: P22895

 Score = 108.7 bits 448,  Expect = 3e-25
 Identities = 72/210 34%, Positives = 123/210 58%, Gaps = 17/210 8%
Query  2    PANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHLY 61
            PA++DWR+K  +  ++ QGGCG  WAF+A+   E  +AI     + LSEQEL+DC     
Sbjct  136  PASWDWRKKGVITQVKYQGGCGRGWAFSATGAIEAAHAIATGDLVSLSEQELVDCVE--- 192
Query  62   DPTYKCHGCQSGMSPEAFKY-MKQKGLLEESHYPYKMKLNQCQANARGTRYHVSSYNSLR 120
                +  G  +G   ++F++ +++ G+  +  YPY+ K  +C+AN    +  +  Y +L 
Sbjct  193  ----ESEGSYNGWQYQSFEWVLEHGGIATDDDYPYRAKEGRCKANKIQDKVTIDGYETLI 248
Query  121  Y--RAGDQEIQAAIMN---HGPVVIYIHGTEAHFRNLRKGILRGAGYNDAQ-IDHAVVLV 174
                + + E + A ++     P+ + I   + H+     GI  G        I+H V+LV
Sbjct  249  MSDESTESETEQAFLSAILEQPISVSIDAKDFHLYT--GGIYDGENCTSPYGINHFVLLV 306
Query  175  GWGTQNGIDYWIVRTSWGTQWGDAGYGFVERHH-NSLGINNYPIYAS 220
            G+G+ +G+DYWI + SWG  WG+ GY +++R+  N LG+     +AS
Sbjct  307  GYGSADGVDYWIAKNSWGFDWGEDGYIWIQRNTGNLLGVCGMNYFAS 353

Sequence Alignment: 36. Allergen Name: Cari p 2.0101 Sequence ID: P14080

 Score = 78.0 bits 313,  Expect = 4e-16
 Identities = 70/199 35%, Positives = 113/199 56%, Gaps = 13/199 6%
Query  2    PANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHLY 61
            P + DWR K  V P++NQG CGSCWAF+  +  E +  I     + LSEQEL+DC  H Y
Sbjct  136  PQSIDWRAKGAVTPVKNQGACGSCWAFSTIATVEGINKIVTGNLLELSEQELVDCDKHSY 195
Query  62   DPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQCQANAR-GTRYHVSSYNSLR 120
                   GC+ G    +++Y+   G+     YPY+ K  +C+A  + G +  ++ Y  + 
Sbjct  196  -------GCKGGYQTTSLQYVANNGVHTSKVYPYQAKQYKCRATDKPGPKVKITGYKRVP 248
Query  121  YRAGDQEIQAAIMNHGPVVIYIHGTEAHFRNLRKGILRGAGYNDAQIDHAVVLVGWGTQN 180
                +     A+ N+ P+ + +      F+  + G++ G      ++DHAV  VG+GT +
Sbjct  249  SNC-ETSFLGALANQ-PLSVLVEAGGKPFQLYKSGVFDGP--CGTKLDHAVTAVGYGTSD 304
Query  181  GIDYWIVRTSWGTQWGDAGYGFVERHH-NSLG 211
            G +Y I++ SWG  WG+ GY  ++R+  NS G
Sbjct  305  GKNYIIIKNSWGPNWGEKGYMRLKRQSGNSQG 336

Sequence Alignment: 37. Allergen Name: Car p papain Sequence ID: AAB02650

 Score = 75.9 bits 304,  Expect = 2e-15
 Identities = 74/196 37%, Positives = 109/196 55%, Gaps = 19/196 9%
Query  1    IPANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHL 60
            IP   DWRQK  V P++NQG CGSCWAF+A    E +  I        SEQELLDC    
Sbjct  134  IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRS 193
Query  61   YDPTYKCHGCQSGMSPEAFKYMKQKGLLEESHYPYKMKLNQCQANARGTRYHVSSYNSLR 120
            Y       GC  G    A++ + Q G+   + YPY+     C++  +G   + +  + +R
Sbjct  194  Y-------GCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGP--YAAKTDGVR 244
Query  121  YRAGDQE--IQAAIMNHGPVVIYIHGTEAHFRNLRKGILRGAGYNDAQIDHAVVLVGWGT 178
                  E  +  +I N+ PV + +      F+  R GI+ G   N  ++DHAV  VG+G 
Sbjct  245  QVQPYNEGALLYSIANQ-PVSVVLEAAGKDFQLYRGGIFVGPCGN--KVDHAVAAVGYGP 301
Query  179  QNGIDYWIVRTSWGTQWGDAGYGFVERHH-NSLGI 212
                +Y +++ SWGT WG+ GY  ++R   NS G+
Sbjct  302  ----NYILIKNSWGTGWGENGYIRIKRGTGNSYGV 332

Sequence Alignment: 38. Allergen Name: Amb a 11.0101 Sequence ID: V5LU01

 Score = 74.5 bits 298,  Expect = 5e-15
 Identities = 73/209 34%, Positives = 113/209 54%, Gaps = 15/209 7%
Query  1    IPANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHL 60
            IP   DWR+K  V  ++ QGGCGSCWAFAA    E + AI   + + +SEQ+L+DC    
Sbjct  131  IPDKVDWREKNAVTDVKGQGGCGSCWAFAAVVALEGINAIRTGKLVKFSEQQLVDC---- 186
Query  61   YDPTYKCHGCQSGMSPEAFKY-MKQKGLLEESHYPYKMKLNQCQANARGTRYHVSSYNSL 119
             D T    GC  G+   AF Y +K+ G+  E+ YPY  K   C    +     V   +  
Sbjct  187  -DMTNA--GCDGGLMEPAFTYVIKHGGIAPEASYPYVGKRETCD---KAKIKDVLKIDGR 240
Query  120  RYRAG-DQEIQAAIMNHGPVVIYIHGTEAHFRNLRKGILRGAGYNDAQIDHAVVLVGWG- 177
            +   G D+E     + H PV   I+ +   ++   +G+  G      + +H V +VG+G 
Sbjct  241  QNVPGLDEEALRKAVAHQPVATGIQLSGHGLQFYSEGVYTGD--CGTEPNHGVGIVGYGE 298
Query  178  TQNGIDYWIVRTSWGTQWGDAGYGFVERHHNSLGINNYPIYASL 221
             + GI +W V+ SWG  WG+ GY  ++R     G+    +++S+
Sbjct  299  NEKGIKFWTVKNSWGPTWGEKGYIHLQRGARKEGLCGVAMHSSF 342

Sequence Alignment: 39. Allergen Name: Ana c 2 Sequence ID: BAA21849

 Score = 74.1 bits 296,  Expect = 6e-15
 Identities = 73/208 35%, Positives = 121/208 58%, Gaps = 19/208 9%
Query  1    IPANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHL 60
            +P + DWR    VN ++NQ  CGSCW+FAA +  E +Y I     + LSEQE+LDC    
Sbjct  123  VPQSIDWRDYGAVNEVKNQNPCGSCWSFAAIATVEGIYKIKTGYLVSLSEQEVLDCAVS- 181
Query  61   YDPTYKCHGCQSGMSPEAFKYM-KQKGLLEESHYPYKMKLNQCQANARGTRYHVSSYNSL 119
                   +GC+ G   +A+ ++    G+  E +YPY      C AN+     +++ Y+ +
Sbjct  182  -------YGCKGGWVNKAYDFIISNNGVTTEENYPYLAYQGTCNANSFPNSAYITGYSYV 234
Query  120  RYRAGDQEIQAAIMNHGPVVIYIHGTEAHFRNLRKGILRGAGYNDAQIDHAVVLVGWGTQ 179
            R R  ++ +  A+ N+ P+   I  +E +F+    G++ G       ++HA+ ++G+G  
Sbjct  235  R-RNDERSMMYAVSNQ-PIAALIDASE-NFQYYNGGVFSGP--CGTSLNHAITIIGYGQD 289
Query  180  N-GIDYWIVRTSWGTQWGDAGYGFVERHHNS----LGINNYPIYASL 221
            + G  YWIVR SWG+ WG+ GY  + R  +S     GI   P++ +L
Sbjct  290  SSGTKYWIVRNSWGSSWGEGGYVRMARGVSSSSGVCGIAMAPLFPTL 336

Sequence Alignment: 40. Allergen Name: Der p 1 Sequence ID: AAA28296

 Score = 62.8 bits 242,  Expect = 4e-12
 Identities = 34/63 53%, Positives = 44/63 69%, Gaps = 5/63 7%
Query  2    PANFDWRQKTHVNPIRNQGGCGSCWAFAASSVAETLYAIHRHQNIILSEQELLDCTYHLY 61
            PA  D RQ   V PIR QGGCGSCWAF+  +  E+ Y  HR+Q++ L+EQEL+DC  +  
Sbjct  29   PAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAHRNQSLDLAEQELVDCASQ-- 86
Query  62   DPTYKCHG 69
               + CHG
Sbjct  87   ---HGCHG 91

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.