The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

IQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKI
IAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDE
ALEKFDKALKALPMHIRLSFNPTQLEEQCHI
Sequence Info Allergen Name Length Opt Bits Score E Value
AAA30411 Bos d 5 151 993 233.6 1.8e-63
CAA32835 Bos d 5 178 984 231.4 9.6e-63
P02754 Bos d 5 178 979 230.3 2.1e-62
AAS77253 Fel d 4 186 196 51.8 1.2e-08
XP_855342 Can f 6.0101 190 185 49.2 7e-08
S0BDX9 Cav p 6.0101 181 184 49.0 7.7e-08
Q95182 Equ c 1 187 161 43.8 3e-06
O18874 Can f 2 180 160 43.6 3.4e-06
P02761 Rat n 1 181 156 42.7 6.4e-06
ADK56160 Fel d 7.0101 180 151 41.5 1.4e-05
AAA39768 Mus m 1.0102 180 146 40.4 3.1e-05
P02762 Mus m 1 180 144 39.9 4.2e-05
O18873 Can f 1 174 140 39.0 7.6e-05
U6C8D6 Ory c 4.0101 172 125 35.6 0.0008
AAA30413 Bos d 5 14 87 29.8 0.0038
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Bos d 5 Sequence ID: AAA30411

 Score = 233.6 bits 993,  Expect = 2e-63
 Identities = 151/151 100%, Positives = 151/151 100%, Gaps = 0/151 0%
Query  1    IQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKI 60
            IQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKI
Sbjct  1    IQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKI 60
Query  61   IAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDE 120
            IAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDE
Sbjct  61   IAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDE 120
Query  121  ALEKFDKALKALPMHIRLSFNPTQLEEQCHI 151
            ALEKFDKALKALPMHIRLSFNPTQLEEQCHI
Sbjct  121  ALEKFDKALKALPMHIRLSFNPTQLEEQCHI 151

Sequence Alignment: 2. Allergen Name: Bos d 5 Sequence ID: CAA32835

 Score = 231.4 bits 984,  Expect = 1e-62
 Identities = 150/151 99%, Positives = 150/151 99%, Gaps = 0/151 0%
Query  1    IQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKI 60
            IQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKI
Sbjct  28   IQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKI 87
Query  61   IAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDE 120
            IAEKTKIPAVFKIDALNENKVLVLDTDYKKYLL CMENSAEPEQSLVCQCLVRTPEVDDE
Sbjct  88   IAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLVCMENSAEPEQSLVCQCLVRTPEVDDE 147
Query  121  ALEKFDKALKALPMHIRLSFNPTQLEEQCHI 151
            ALEKFDKALKALPMHIRLSFNPTQLEEQCHI
Sbjct  148  ALEKFDKALKALPMHIRLSFNPTQLEEQCHI 178

Sequence Alignment: 3. Allergen Name: Bos d 5 Sequence ID: P02754

 Score = 230.3 bits 979,  Expect = 2e-62
 Identities = 149/151 98%, Positives = 149/151 98%, Gaps = 0/151 0%
Query  1    IQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKI 60
            IQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWEN ECAQKKI
Sbjct  28   IQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKI 87
Query  61   IAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDE 120
            IAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSL CQCLVRTPEVDDE
Sbjct  88   IAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDE 147
Query  121  ALEKFDKALKALPMHIRLSFNPTQLEEQCHI 151
            ALEKFDKALKALPMHIRLSFNPTQLEEQCHI
Sbjct  148  ALEKFDKALKALPMHIRLSFNPTQLEEQCHI 178

Sequence Alignment: 4. Allergen Name: Fel d 4 Sequence ID: AAS77253

 Score = 51.8 bits 196,  Expect = 1e-08
 Identities = 36/125 28%, Positives = 68/125 54%, Gaps = 2/125 1%
Query  1    IQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKI 60
            I K++G WYS+ +A SD+     ++  +RV+VE +K      L  +++  EN +C +  +
Sbjct  28   ISKISGEWYSILLA-SDVKEKIEENGSMRVFVEHIKALDNSSLSFVFHTKENGKCTEIFL 86
Query  61   IAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDE 120
            +A+KTK   V+ +     N   +++T Y +Y+L+ + N  +     + +   R P+V  +
Sbjct  87   VADKTK-DGVYTVVYDGYNVFSIVETVYDEYILLHLLNFDKTRPFQLVEFYAREPDVSQK 145
Query  121  ALEKFDK 127
              EKF K
Sbjct  146  LKEKFVK 152

Sequence Alignment: 5. Allergen Name: Can f 6.0101 Sequence ID: XP_855342

 Score = 49.2 bits 185,  Expect = 7e-08
 Identities = 34/147 23%, Positives = 77/147 52%, Gaps = 2/147 1%
Query  1    IQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKI 60
            I K++G WYS+ +A SDI     ++  +RV+V++++      L   ++   N +C +  +
Sbjct  29   ISKISGDWYSILLA-SDIKEKIEENGSMRVFVKDIEVLSNSSLIFTMHTKVNGKCTKISL 87
Query  61   IAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDE 120
            I  KT+    + +     N   +++T Y+ Y++F + N  + ++  + +   R P+V  +
Sbjct  88   ICNKTEKDGEYDVVHDGYNLFRIIETAYEDYIIFHLNNVNQEQEFQLMELYGRKPDVSPK 147
Query  121  ALEKFDKALKALPMHIRLSFNPTQLEEQC 149
              EKF +  + + +     ++ TQ++ +C
Sbjct  148  VKEKFVRYCQGMEIPKENILDLTQVD-RC 175

Sequence Alignment: 6. Allergen Name: Cav p 6.0101 Sequence ID: S0BDX9

 Score = 49.0 bits 184,  Expect = 8e-08
 Identities = 37/122 30%, Positives = 62/122 50%, Gaps = 4/122 3%
Query  2    QKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKII 61
            +K++G WY++   ASD      +   +RV+VE ++P  +  L   +   EN EC Q  +I
Sbjct  30   EKISGNWYTVK-EASDKRETIEEGGSMRVFVESIEPVKDSALSFKFWAHENGECKQISLI 88
Query  62   AEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMEN-SAEPEQSLVCQCLVRTPEVDDE 120
              +     V+ ++    N   V +TDYK Y +F + N  AE    L+ +   R P+V  E
Sbjct  89   CNRVA-EGVYAVEYDGYNVFRVAETDYKNYAIFQLRNFKAEGSFQLL-ELYGREPDVSGE 146
Query  121  ALEKFD 126
               +F+
Sbjct  147  IKTRFE 152

Sequence Alignment: 7. Allergen Name: Equ c 1 Sequence ID: Q95182

 Score = 43.8 bits 161,  Expect = 3e-06
 Identities = 33/127 25%, Positives = 64/127 50%, Gaps = 5/127 3%
Query  1    IQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKI 60
            I K++G WYS+ +A SD+     ++  +RV+V+ ++      L    Q   N EC +  +
Sbjct  30   ISKISGEWYSIFLA-SDVKEKIEENGSMRVFVDVIRALDNSSLYAEYQTKVNGECTEFPM 88
Query  61   IAEKTKIPAVFKI--DALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVD 118
            + +KT+   V+ +  D  N  ++  ++ D    L +   +   P Q  + +   R P+V 
Sbjct  89   VFDKTEEDGVYSLNYDGYNVFRISEFENDEHIILYLVNFDKDRPFQ--LFEFYAREPDVS 146
Query  119  DEALEKFDKALK 130
             E  E+F K ++
Sbjct  147  PEIKEEFVKIVQ 158

Sequence Alignment: 8. Allergen Name: Can f 2 Sequence ID: O18874

 Score = 43.6 bits 160,  Expect = 3e-06
 Identities = 30/133 22%, Positives = 68/133 51%, Gaps = 2/133 1%
Query  1    IQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKI 60
            +++++G W+S+A+A++   L+      +RV++  +    +G+L   +   ++ +C +  +
Sbjct  30   LEELSGRWHSVALASNKSDLIKPWGH-FRVFIHSMS-AKDGNLHGDILIPQDGQCEKVSL 87
Query  61   IAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDE 120
             A KT     F ++    N + + + D K YL++ M N    + SLV + +VR      +
Sbjct  88   TAFKTATSNKFDLEYWGHNDLYLAEVDPKSYLILYMINQYNDDTSLVAHLMVRDLSRQQD 147
Query  121  ALEKFDKALKALPMH 135
             L  F+   + + +H
Sbjct  148  FLPAFESVCEDIGLH 162

Sequence Alignment: 9. Allergen Name: Rat n 1 Sequence ID: P02761

 Score = 42.7 bits 156,  Expect = 6e-06
 Identities = 32/129 24%, Positives = 66/129 51%, Gaps = 2/129 1%
Query  1    IQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKI 60
            + K+ G W+S+ +A++    ++ ++  +RV+++ +    E  L   ++  EN EC +  +
Sbjct  31   VAKLNGDWFSIVVASNKREKIE-ENGSMRVFMQHIDVL-ENSLGFKFRIKENGECRELYL 88
Query  61   IAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDE 120
            +A KT     + ++    N   +L TDY +Y++F + N    E   +     RT ++  +
Sbjct  89   VAYKTPEDGEYFVEYDGGNTFTILKTDYDRYVMFHLINFKNGETFQLMVLYGRTKDLSSD 148
Query  121  ALEKFDKALKA 131
              EKF K  +A
Sbjct  149  IKEKFAKLCEA 159

Sequence Alignment: 10. Allergen Name: Fel d 7.0101 Sequence ID: ADK56160

 Score = 41.5 bits 151,  Expect = 1e-05
 Identities = 39/139 28%, Positives = 69/139 49%, Gaps = 8/139 5%
Query  4    VAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKIIAE 63
            ++G WY  AM     +   +   P  V    L     G+L+       N +C + ++I E
Sbjct  31   MSGKWYLKAMITDRET---SWKKPELVTPMTLTVLEGGNLKAETTLLTNGQCKEVELILE 87
Query  64   KTKIPAVFKIDALNENKVLVLD-TDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDEAL 122
            KT  P   K       +V+ ++ T+ K + +F  E   + EQ+ + + + R PE ++EAL
Sbjct  88   KTSEPK--KYTTYGGKRVVYIEPTEVKDHYIFYCEGEMQGEQARMAKLVGRDPESNEEAL 145
Query  123  EKFDKALKALPMHIRLSFNPTQLEEQC 149
            E F + L+A   +  + F+P Q  + C
Sbjct  146  ENFREFLRAKGFNQEI-FSPKQ-SDTC 170

Sequence Alignment: 11. Allergen Name: Mus m 1.0102 Sequence ID: AAA39768

 Score = 40.4 bits 146,  Expect = 3e-05
 Identities = 27/125 21%, Positives = 64/125 51%, Gaps = 2/125 1%
Query  1    IQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKI 60
            ++K+ G W+++ +A SD       +  +R+++E++    E  L + ++   ++EC++  +
Sbjct  30   VEKINGEWHTIILA-SDKREKIEDNGNFRLFLEQIH-VLEKSLVLKFHTVRDEECSELSM 87
Query  61   IAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDE 120
            +A+KT+    + +     N   +  TDY  +L+  + N  + E   +     R P++  +
Sbjct  88   VADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSD 147
Query  121  ALEKFDK 127
              E+F K
Sbjct  148  IKERFAK 154

Sequence Alignment: 12. Allergen Name: Mus m 1 Sequence ID: P02762

 Score = 39.9 bits 144,  Expect = 4e-05
 Identities = 26/123 21%, Positives = 63/123 51%, Gaps = 2/123 1%
Query  1    IQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKI 60
            ++K+ G W+++ +A SD       +  +R+++E++    E  L + ++   ++EC++  +
Sbjct  30   VEKINGEWHTIILA-SDKREKIEDNGNFRLFLEQIHVL-ENSLVLKFHTVRDEECSELSM 87
Query  61   IAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDE 120
            +A+KT+    + +     N   +  TDY  +L+  + N  + E   +     R P++  +
Sbjct  88   VADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSD 147
Query  121  ALEKF 125
              E+F
Sbjct  148  IKERF 152

Sequence Alignment: 13. Allergen Name: Can f 1 Sequence ID: O18873

 Score = 39.0 bits 140,  Expect = 8e-05
 Identities = 37/121 30%, Positives = 53/121 43%, Gaps = 9/121 7%
Query  4    VAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKIIAE 63
            V+G WY  AM A      +    P  V    LK    G+LE  +    N +C    ++  
Sbjct  31   VSGKWYLKAMTADQ----EVPEKPDSVTPMILKAQKGGNLEAKITMLTNGQCQNITVVLH 86
Query  64   KTKIPAVFKIDALNENKVLVLDTD--YKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDEA 121
            KT  P   K  A    +V+ +        Y+L+C E      Q  + + L R PE   EA
Sbjct  87   KTSEPG--KYTAYEGQRVVFIQPSPVRDHYILYC-EGELHGRQIRMAKLLGRDPEQSQEA 143
Query  122  LEKFDKALKA 131
            LE F +  +A
Sbjct  144  LEDFREFSRA 153

Sequence Alignment: 14. Allergen Name: Ory c 4.0101 Sequence ID: U6C8D6

 Score = 35.6 bits 125,  Expect = 0.0008
 Identities = 28/124 22%, Positives = 57/124 45%, Gaps = 1/124 0%
Query  1    IQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKI 60
            + +++G WYS+ +A SD      ++  +RV+VE +       L   ++   N +C +  +
Sbjct  17   VSQISGEWYSVLLA-SDHREKIEENGSMRVFVEYIHVWKNSSLSFKFHTPVNGKCTELFL 75
Query  61   IAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDE 120
              + T+   V+ ++    N   +LD     Y++F + N    E   + +   R  +V  +
Sbjct  76   TCDPTEDNHVYTVEYDGHNVFSILDMVPDDYIIFHLINHNNGESFQLMELYGRGLDVRSD 135
Query  121  ALEKF 125
              EKF
Sbjct  136  IREKF 140

Sequence Alignment: 15. Allergen Name: Bos d 5 Sequence ID: AAA30413

 Score = 29.8 bits 87,  Expect = 0.004
 Identities = 12/14 85%, Positives = 13/14 92%, Gaps = 0/14 0%
Query  98   NSAEPEQSLVCQCL 111
            NSAEP QSLVC+CL
Sbjct  1    NSAEPXQSLVCECL 14

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.