The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG
VNPNNAAALPGKCGVHIPYKISASTNCATVK
Sequence Info Allergen Name Length Opt Bits Score E Value
P81402 Pru p 3 91 638 120.0 9.9e-30
CAB96876 Pru p 3 91 623 117.4 6e-29
P81651 Pru ar 3 91 585 110.8 5.9e-27
P82534 Pru d 3 91 583 110.5 7.5e-27
Q9M5X8 Pru av 3 117 570 108.3 4.3e-26
Q9M5X7 Mal d 3 115 532 101.7 4.2e-24
Q9M5X6 Pyr c 3 115 518 99.3 2.3e-23
XP_019446786 Lup an 3.0101 116 474 91.6 4.6e-21
Q8VX12 Fra a 3.0101 117 472 91.3 5.9e-21
Q4PLT6 Fra a 3.0202 117 471 91.1 6.6e-21
Q0Z8V0 Rub i 3.0101 117 469 90.7 8.4e-21
Q4PLU0 Fra a 3.0201 117 468 90.6 9.5e-21
Q4PLT9 Fra a 3.0102 117 463 89.7 1.7e-20
ADC80503 Pha v 3.0201 118 456 88.5 4.1e-20
ABX56711 Ara h 9.0101 116 453 87.9 5.8e-20
A0A059STC4 Pun g 1.0101 120 451 87.6 7.5e-20
P85894 Mor n 3.0101 91 449 87.1 7.9e-20
ADC80502 Pha v 3.0101 115 436 85.0 4.5e-19
AAL25839 Hev b 12 116 436 85.0 4.5e-19
A0A059ST23 Pun g 1.0301 120 429 83.8 1.1e-18
A0A059SSZ0 Pun g 1.0201 120 428 83.6 1.2e-18
AAK28533 Cor a 8 115 426 83.2 1.5e-18
ABY21307 Pla or 3.0101 118 416 81.5 5.1e-18
W0U0V5 Can s 3.0101 91 412 80.7 6.9e-18
CAL07989 Pla a 3.0101 118 412 80.8 8.2e-18
ABX75045 Ara h 9.0201 92 409 80.2 9.9e-18
P19656-1 Zea m 14.0101 120 410 80.5 1.1e-17
A0AT29 Len c 3.0101 118 407 79.9 1.5e-17
P19656-2 Zea m 14.0102 128 406 79.8 1.8e-17
A0A161AT60 Pis s 3.0101 120 401 78.9 3.1e-17
A0A510A9S3 Ara h 17.0101 93 396 77.9 4.8e-17
ACN11576 Pru du 3.0101 123 396 78.0 5.8e-17
ACV04796 Api g 2 118 380 75.2 3.9e-16
ABU95411 Sin a 3.0101 92 367 72.9 1.6e-15
CAH69206 Tri tu 14.0101 115 361 71.9 3.8e-15
ANC85023 Art gm 3.0102 117 357 71.2 6.2e-15
ANC85022 Art gm 3.0101 117 357 71.2 6.2e-15
QIN55516 Art ca 3.0102 117 356 71.1 7e-15
ANC85020 Art ar 3.0102 116 354 70.7 8.9e-15
ANC85027 Art si 3.0102 116 354 70.7 8.9e-15
ACE07187 Art v 3.0202 116 354 70.7 8.9e-15
ANC85018 Art an 3.0102 117 352 70.4 1.1e-14
AAB42069 Lyc e 3 114 350 70.0 1.4e-14
P93224 Sola l 3.0101 114 350 70.0 1.4e-14
ANC85017 Art an 3.0101 117 345 69.1 2.7e-14
ANC85021 Art ca 3.0101 117 345 69.1 2.7e-14
EU564845 Art v 3.0201 114 339 68.1 5.4e-14
ANC85019 Art ar 3.0101 116 339 68.1 5.4e-14
ANC85024 Art la 3.0101 116 339 68.1 5.4e-14
ANC85026 Art si 3.0101 116 336 67.6 7.8e-14
AAA32970 Hor v 1 117 336 67.6 7.8e-14
ANC85025 Art la 3.0102 115 335 67.4 8.8e-14
EU564847 Art v 3.0301 117 335 67.4 8.9e-14
CAA42832 Hor v 1 134 333 67.1 1.2e-13
19846220 Tri a 14.0101 90 330 66.4 1.3e-13
NP_001316123 Sola l 7.0101 115 313 63.6 1.2e-12
P82007 Hel a 3.0101 116 291 59.7 1.8e-11
O04004 Amb a 6 118 217 46.9 1.4e-07
Q40905 Par j 1 138 202 44.3 9.3e-07
O04403 Par j 2 133 201 44.1 1e-06
P43217 Par j 1 139 201 44.2 1e-06
CAI94601 Par j 1.0103 139 197 43.5 1.7e-06
P55958 Par j 2 133 195 43.1 2.1e-06
O04404 Par j 1 176 187 41.8 6.7e-06
CAA54587 Par j 1.0101 133 178 40.1 1.6e-05
P0C088 Art v 3.0101 37 144 33.7 0.0004
P80274 Vit v 1 37 135 32.1 0.0012
10998016 Cas s 8 36 132 31.6 0.0017
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pru p 3 Sequence ID: P81402

 Score = 120.0 bits 638,  Expect = 1e-29
 Identities = 91/91 100%, Positives = 91/91 100%, Gaps = 0/91 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG
Sbjct  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91
            VNPNNAAALPGKCGVHIPYKISASTNCATVK
Sbjct  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91

Sequence Alignment: 2. Allergen Name: Pru p 3 Sequence ID: CAB96876

 Score = 117.4 bits 623,  Expect = 6e-29
 Identities = 89/91 97%, Positives = 90/91 98%, Gaps = 0/91 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            ITCGQVSS+LAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG
Sbjct  1    ITCGQVSSSLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91
            VNPNNAAALPGKCGV IPYKISASTNCATVK
Sbjct  61   VNPNNAAALPGKCGVSIPYKISASTNCATVK 91

Sequence Alignment: 3. Allergen Name: Pru ar 3 Sequence ID: P81651

 Score = 110.8 bits 585,  Expect = 6e-27
 Identities = 83/91 91%, Positives = 87/91 95%, Gaps = 0/91 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            ITCGQVSS+LAPCI YVRGGGAVPPACCNGIRNVNNLARTTPDR+ ACNCLKQLS S+ G
Sbjct  1    ITCGQVSSSLAPCIGYVRGGGAVPPACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISG 60
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91
            VNPNNAAALPGKCGV+IPYKISASTNCATVK
Sbjct  61   VNPNNAAALPGKCGVNIPYKISASTNCATVK 91

Sequence Alignment: 4. Allergen Name: Pru d 3 Sequence ID: P82534

 Score = 110.5 bits 583,  Expect = 8e-27
 Identities = 82/91 90%, Positives = 87/91 95%, Gaps = 0/91 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            ITCGQVSS LAPCI YV+GGGAVPPACCNGIRNVNNLARTT DR+AACNCLKQLS S+PG
Sbjct  1    ITCGQVSSNLAPCINYVKGGGAVPPACCNGIRNVNNLARTTADRRAACNCLKQLSGSIPG 60
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91
            VNPNNAAALPGKCGV++PYKISASTNCATVK
Sbjct  61   VNPNNAAALPGKCGVNVPYKISASTNCATVK 91

Sequence Alignment: 5. Allergen Name: Pru av 3 Sequence ID: Q9M5X8

 Score = 108.3 bits 570,  Expect = 4e-26
 Identities = 80/91 87%, Positives = 85/91 93%, Gaps = 0/91 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            +TCGQVSS LAPCI YVRGGGAVPPACCNGIRN+NNLA+TT DRQ ACNCLKQLSASVPG
Sbjct  27   LTCGQVSSNLAPCIAYVRGGGAVPPACCNGIRNINNLAKTTADRQTACNCLKQLSASVPG 86
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91
            VN NNAAALPGKCGV++PYKIS STNCATVK
Sbjct  87   VNANNAAALPGKCGVNVPYKISPSTNCATVK 117

Sequence Alignment: 6. Allergen Name: Mal d 3 Sequence ID: Q9M5X7

 Score = 101.7 bits 532,  Expect = 4e-24
 Identities = 73/91 80%, Positives = 80/91 87%, Gaps = 0/91 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            ITCGQV+S+LAPCI YVR GGAVPPACCNGIR +N LARTT DRQ ACNCLK L+ S+ G
Sbjct  25   ITCGQVTSSLAPCIGYVRSGGAVPPACCNGIRTINGLARTTADRQTACNCLKNLAGSISG 84
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91
            VNPNNAA LPGKCGV++PYKIS STNCATVK
Sbjct  85   VNPNNAAGLPGKCGVNVPYKISTSTNCATVK 115

Sequence Alignment: 7. Allergen Name: Pyr c 3 Sequence ID: Q9M5X6

 Score = 99.3 bits 518,  Expect = 2e-23
 Identities = 71/91 78%, Positives = 79/91 86%, Gaps = 0/91 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            ITC QVS+ LAPCI YVR GGAVPPACCNGI+ +N LA+TTPDRQAACNCLK L+ SV G
Sbjct  25   ITCSQVSANLAPCINYVRSGGAVPPACCNGIKTINGLAKTTPDRQAACNCLKNLAGSVSG 84
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91
            VNP NA +LPGKCGV++PYKIS STNCATVK
Sbjct  85   VNPGNAESLPGKCGVNVPYKISTSTNCATVK 115

Sequence Alignment: 8. Allergen Name: Lup an 3.0101 Sequence ID: XP_019446786

 Score = 91.6 bits 474,  Expect = 5e-21
 Identities = 62/91 68%, Positives = 78/91 85%, Gaps = 0/91 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            ITCGQV++ LA C+ Y+R GGAVP  CCNGI+N+ NLA+TTPDR+ ACNCLK  +A+ PG
Sbjct  26   ITCGQVTANLAQCLNYLRSGGAVPAPCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPG 85
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91
            +NP+NA +LPGKCGV+IPYKIS STNCA++K
Sbjct  86   LNPSNAGSLPGKCGVNIPYKISTSTNCASIK 116

Sequence Alignment: 9. Allergen Name: Fra a 3.0101 Sequence ID: Q8VX12

 Score = 91.3 bits 472,  Expect = 6e-21
 Identities = 62/91 68%, Positives = 76/91 83%, Gaps = 0/91 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            ITCGQV+S ++PC+ YV+ GGAVP ACC+GIRN+N +A+TT DRQAACNCLKQ +  + G
Sbjct  27   ITCGQVASNISPCLTYVKSGGAVPAACCSGIRNLNGMAKTTADRQAACNCLKQAAGGIKG 86
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91
            +NPN AA LPGKCGV +PYKIS +TNCA VK
Sbjct  87   LNPNLAAGLPGKCGVSVPYKISTTTNCAAVK 117

Sequence Alignment: 10. Allergen Name: Fra a 3.0202 Sequence ID: Q4PLT6

 Score = 91.1 bits 471,  Expect = 7e-21
 Identities = 62/91 68%, Positives = 77/91 84%, Gaps = 0/91 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            ITCGQV+S+++PC+ YV+ GGAVP ACCNGIR++N+ A+TT DRQ  CNCLKQ S ++ G
Sbjct  27   ITCGQVASSISPCVNYVKSGGAVPAACCNGIRSLNSAAKTTADRQTTCNCLKQASGAIKG 86
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91
            +NPN AA LPGKCGV++PYKIS STNCA VK
Sbjct  87   LNPNLAAGLPGKCGVNVPYKISTSTNCAAVK 117

Sequence Alignment: 11. Allergen Name: Rub i 3.0101 Sequence ID: Q0Z8V0

 Score = 90.7 bits 469,  Expect = 8e-21
 Identities = 62/91 68%, Positives = 74/91 81%, Gaps = 0/91 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            ITCGQV+  +APC  YV+ GGAVP ACCNG+RN+N+ A+TT DRQ  CNCLK  + S+PG
Sbjct  27   ITCGQVTQNVAPCFNYVKNGGAVPAACCNGVRNLNSQAKTTADRQQTCNCLKNAAGSIPG 86
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91
            +NP+ AA LPGKCGV +PYKIS STNCATVK
Sbjct  87   LNPSLAAGLPGKCGVSVPYKISTSTNCATVK 117

Sequence Alignment: 12. Allergen Name: Fra a 3.0201 Sequence ID: Q4PLU0

 Score = 90.6 bits 468,  Expect = 1e-20
 Identities = 62/91 68%, Positives = 77/91 84%, Gaps = 0/91 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            ITCGQV+S+++PC+ YV+ GGAVP ACCNGIR++N+ A+TT DRQA CNCLKQ S ++ G
Sbjct  27   ITCGQVASSISPCVNYVKSGGAVPAACCNGIRSLNSAAKTTADRQATCNCLKQASGAIKG 86
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91
            +NP+ AA LPGKCGV +PYKIS STNCA VK
Sbjct  87   LNPSLAAGLPGKCGVSVPYKISTSTNCAAVK 117

Sequence Alignment: 13. Allergen Name: Fra a 3.0102 Sequence ID: Q4PLT9

 Score = 89.7 bits 463,  Expect = 2e-20
 Identities = 60/91 65%, Positives = 74/91 81%, Gaps = 0/91 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            ITCGQV+S ++PC+ YV+ GGAVP  CC+GIRN+N +A+TT DRQA CNCLKQ +  + G
Sbjct  27   ITCGQVASNISPCVTYVKSGGAVPAPCCSGIRNLNGMAKTTADRQATCNCLKQAAGGIKG 86
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91
            +NPN AA LPGKCGV +PYKIS +TNCA VK
Sbjct  87   LNPNLAAGLPGKCGVSVPYKISTTTNCAAVK 117

Sequence Alignment: 14. Allergen Name: Pha v 3.0201 Sequence ID: ADC80503

 Score = 88.5 bits 456,  Expect = 4e-20
 Identities = 59/91 64%, Positives = 74/91 81%, Gaps = 0/91 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            I+CGQV+S+LA CIP++  GG VP +CC+G+R++N  A+TTPDRQA CNCLK  + ++PG
Sbjct  27   ISCGQVTSSLASCIPFLTKGGPVPASCCSGVRSLNAAAKTTPDRQAVCNCLKSAAGAIPG 86
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91
             N NNA  LPGKCGV IPYKIS STNCAT+K
Sbjct  87   FNANNAGILPGKCGVSIPYKISTSTNCATIK 117

Sequence Alignment: 15. Allergen Name: Ara h 9.0101 Sequence ID: ABX56711

 Score = 87.9 bits 453,  Expect = 6e-20
 Identities = 62/91 68%, Positives = 74/91 81%, Gaps = 0/91 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            I+CGQV+SALAPCIP++  GGA PPACC+G+R +    RTT DRQAACNCLK  + S+ G
Sbjct  25   ISCGQVNSALAPCIPFLTKGGAPPPACCSGVRGLLGALRTTADRQAACNCLKAAAGSLRG 84
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91
            +N  NAAALPG+CGV IPYKIS STNCAT+K
Sbjct  85   LNQGNAAALPGRCGVSIPYKISTSTNCATIK 115

Sequence Alignment: 16. Allergen Name: Pun g 1.0101 Sequence ID: A0A059STC4

 Score = 87.6 bits 451,  Expect = 8e-20
 Identities = 61/91 67%, Positives = 74/91 81%, Gaps = 1/91 1%
Query  1    ITCGQVSSALAPCIPYVRG-GGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVP 59
            +TCGQV+S+LAPCIPY R  GGAVPPACC+GI+ ++ +ARTTPDRQA C CLK  S S+ 
Sbjct  29   VTCGQVASSLAPCIPYARSAGGAVPPACCSGIKTLDGMARTTPDRQATCKCLKSASTSIS 88
Query  60   GVNPNNAAALPGKCGVHIPYKISASTNCATVK 91
            G+N    A+LP KCGV+IPYKIS ST+CA VK
Sbjct  89   GINYGLVASLPAKCGVNIPYKISPSTDCARVK 120

Sequence Alignment: 17. Allergen Name: Mor n 3.0101 Sequence ID: P85894

 Score = 87.1 bits 449,  Expect = 8e-20
 Identities = 62/91 68%, Positives = 73/91 80%, Gaps = 0/91 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            ITCGQVSS+LAPCI Y+R GG VP  CCNG+R++NN A+TT DRQAACNCLK    S+ G
Sbjct  1    ITCGQVSSSLAPCINYLRAGGVVPANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKG 60
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91
            +N N AA LPGKCGV +PYKIS ST+C +VK
Sbjct  61   LNLNLAAGLPGKCGVSVPYKISPSTDCKSVK 91

Sequence Alignment: 18. Allergen Name: Pha v 3.0101 Sequence ID: ADC80502

 Score = 85.0 bits 436,  Expect = 4e-19
 Identities = 56/90 62%, Positives = 71/90 78%, Gaps = 0/90 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            +TCGQV S L PC+ +++ GG VP  CCNG+RN+ N AR+T DR+  CNCLK  + +V G
Sbjct  25   MTCGQVQSNLVPCVTFLQNGGFVPAGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRG 84
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATV 90
            +NPNNA ALPGKCGV+IPYKIS STNCA++
Sbjct  85   LNPNNAQALPGKCGVNIPYKISTSTNCASI 114

Sequence Alignment: 19. Allergen Name: Hev b 12 Sequence ID: AAL25839

 Score = 85.0 bits 436,  Expect = 4e-19
 Identities = 60/91 65%, Positives = 70/91 76%, Gaps = 1/91 1%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPA-CCNGIRNVNNLARTTPDRQAACNCLKQLSASVP 59
            ITCGQV SAL PC+ Y++  G  PPA CCNG+R +NN A+TT DR+ AC CLK  + SV 
Sbjct  25   ITCGQVQSALVPCLSYLKTTGPTPPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVK 84
Query  60   GVNPNNAAALPGKCGVHIPYKISASTNCATVK 91
            G+NP   A LPGKCGV+IPYKIS STNCATVK
Sbjct  85   GLNPTTVAGLPGKCGVNIPYKISLSTNCATVK 116

Sequence Alignment: 20. Allergen Name: Pun g 1.0301 Sequence ID: A0A059ST23

 Score = 83.8 bits 429,  Expect = 1e-18
 Identities = 62/91 68%, Positives = 72/91 79%, Gaps = 2/91 2%
Query  1    ITCGQVSSALAPCIPYVRGGGA--VPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASV 58
            ITCGQVSS+LA CI Y RG GA  VP ACCNGIR++N+ A+TTPDRQAAC CLK L++S+
Sbjct  28   ITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKTTPDRQAACRCLKSLASSI 87
Query  59   PGVNPNNAAALPGKCGVHIPYKISASTNCATVK 91
             G+N    A  PGKCGV IPYKI+ STNC  VK
Sbjct  88   SGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120

Sequence Alignment: 21. Allergen Name: Pun g 1.0201 Sequence ID: A0A059SSZ0

 Score = 83.6 bits 428,  Expect = 1e-18
 Identities = 58/91 63%, Positives = 72/91 79%, Gaps = 1/91 1%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPA-CCNGIRNVNNLARTTPDRQAACNCLKQLSASVP 59
            +TCGQV+S+L PCIPY RG  A P A CC+G+R++NN A+TTPDRQ ACNCLK ++ S+ 
Sbjct  29   VTCGQVTSSLTPCIPYARGVVAAPSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSIT 88
Query  60   GVNPNNAAALPGKCGVHIPYKISASTNCATVK 91
            G+N     ALPGKCGV IPYKIS ST+C+ VK
Sbjct  89   GINYGRVGALPGKCGVSIPYKISPSTDCSRVK 120

Sequence Alignment: 22. Allergen Name: Cor a 8 Sequence ID: AAK28533

 Score = 83.2 bits 426,  Expect = 1e-18
 Identities = 54/91 59%, Positives = 69/91 75%, Gaps = 0/91 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            +TC Q+   L PC+ Y++ GG +PP+CC G+R VN+ +RTT DRQ+ACNCLK  +  + G
Sbjct  25   LTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVNDASRTTSDRQSACNCLKDTAKGIAG 84
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91
            +NPN AA LPGKCGV+IPYKIS STNC  VK
Sbjct  85   LNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115

Sequence Alignment: 23. Allergen Name: Pla or 3.0101 Sequence ID: ABY21307

 Score = 81.5 bits 416,  Expect = 5e-18
 Identities = 55/91 60%, Positives = 70/91 76%, Gaps = 0/91 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            ITCG V + L PC+ Y+R GGAV PACCNG++ +NN A+TTPDRQAAC CLK  S S+ G
Sbjct  28   ITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNNDAKTTPDRQAACGCLKTASTSISG 87
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91
            +   NAA+L GKCGV++PYKIS + +C+ VK
Sbjct  88   IQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118

Sequence Alignment: 24. Allergen Name: Can s 3.0101 Sequence ID: W0U0V5

 Score = 80.7 bits 412,  Expect = 7e-18
 Identities = 56/91 61%, Positives = 73/91 80%, Gaps = 0/91 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            ITCGQV+S+LAPC+ Y++ GGAVP  CCN I++++  A+T  DRQAAC CLK  ++S+ G
Sbjct  1    ITCGQVASSLAPCLSYLKVGGAVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKG 60
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91
            VN N A+ LPGKCGV IPYKIS ST+C++VK
Sbjct  61   VNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91

Sequence Alignment: 25. Allergen Name: Pla a 3.0101 Sequence ID: CAL07989

 Score = 80.8 bits 412,  Expect = 8e-18
 Identities = 54/91 59%, Positives = 70/91 76%, Gaps = 0/91 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            ITCG V + L PC+ ++R GGAV PACCNG++ +NN A+TTPDRQAAC CLK  S S+ G
Sbjct  28   ITCGTVVTRLTPCLTFLRSGGAVAPACCNGVKALNNDAKTTPDRQAACGCLKTASTSISG 87
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91
            +   NAA+L GKCGV++PYKIS + +C+ VK
Sbjct  88   IQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118

Sequence Alignment: 26. Allergen Name: Ara h 9.0201 Sequence ID: ABX75045

 Score = 80.2 bits 409,  Expect = 1e-17
 Identities = 56/91 61%, Positives = 70/91 76%, Gaps = 0/91 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            ++CGQV+SALAPCI ++  GG     CC+G+R +   A+TT DRQAACNCLK  + S+ G
Sbjct  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91
            +N  NAAALPG+CGV IPYKIS STNCAT+K
Sbjct  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIK 91

Sequence Alignment: 27. Allergen Name: Zea m 14.0101 Sequence ID: P19656-1

 Score = 80.5 bits 410,  Expect = 1e-17
 Identities = 57/90 63%, Positives = 72/90 80%, Gaps = 1/90 1%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPA-CCNGIRNVNNLARTTPDRQAACNCLKQLSASVP 59
            I+CGQV+SA+APCI Y RG G+ P A CC+G+R++NN ARTT DR+AACNCLK  +A V 
Sbjct  29   ISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVS 88
Query  60   GVNPNNAAALPGKCGVHIPYKISASTNCATV 90
            G+N  NAA++P KCGV IPY IS ST+C+ V
Sbjct  89   GLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119

Sequence Alignment: 28. Allergen Name: Len c 3.0101 Sequence ID: A0AT29

 Score = 79.9 bits 407,  Expect = 2e-17
 Identities = 55/91 60%, Positives = 68/91 74%, Gaps = 0/91 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            I+CG V+S L+PC+ Y+ GG    P CC G++ +   A TTPDRQAACNCLK  + S+  
Sbjct  27   ISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITK 86
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91
            +N NNAAALPGKCGV+IPYKIS +TNC TVK
Sbjct  87   LNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117

Sequence Alignment: 29. Allergen Name: Zea m 14.0102 Sequence ID: P19656-2

 Score = 79.8 bits 406,  Expect = 2e-17
 Identities = 56/88 63%, Positives = 71/88 80%, Gaps = 1/88 1%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPA-CCNGIRNVNNLARTTPDRQAACNCLKQLSASVP 59
            I+CGQV+SA+APCI Y RG G+ P A CC+G+R++NN ARTT DR+AACNCLK  +A V 
Sbjct  29   ISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVS 88
Query  60   GVNPNNAAALPGKCGVHIPYKISASTNCA 88
            G+N  NAA++P KCGV IPY IS ST+C+
Sbjct  89   GLNAGNAASIPSKCGVSIPYTISTSTDCS 117

Sequence Alignment: 30. Allergen Name: Pis s 3.0101 Sequence ID: A0A161AT60

 Score = 78.9 bits 401,  Expect = 3e-17
 Identities = 54/91 59%, Positives = 69/91 75%, Gaps = 2/91 2%
Query  1    ITCGQVSSALAPCIPYVRG--GGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASV 58
            ++CG VS+ +APC+ Y++     + PP CC G++ +   A TTPDRQAACNCLK  + S+
Sbjct  27   LSCGTVSADMAPCVTYLQAPNNASPPPPCCAGVKKLLAAATTTPDRQAACNCLKSAAGSI 86
Query  59   PGVNPNNAAALPGKCGVHIPYKISASTNCATVK 91
            P +N NNAAALPGKCGV IPYKIS STNC TV+
Sbjct  87   PKLNTNNAAALPGKCGVSIPYKISTSTNCNTVR 119

Sequence Alignment: 31. Allergen Name: Ara h 17.0101 Sequence ID: A0A510A9S3

 Score = 77.9 bits 396,  Expect = 5e-17
 Identities = 53/91 58%, Positives = 69/91 75%, Gaps = 1/91 1%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            I C  V+ ++APC  Y++ GG V   CC+GI+N+N  A+TT DRQA CNCLK  +AS+  
Sbjct  2    IQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGS 61
Query  61   -VNPNNAAALPGKCGVHIPYKISASTNCATVK 91
             +NPNNAA+LPGKCGV IPYKIS S NC+++K
Sbjct  62   QINPNNAASLPGKCGVSIPYKISTSINCSSIK 93

Sequence Alignment: 32. Allergen Name: Pru du 3.0101 Sequence ID: ACN11576

 Score = 78.0 bits 396,  Expect = 6e-17
 Identities = 54/91 59%, Positives = 69/91 75%, Gaps = 2/91 2%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            ++CGQV + L PCI YV  GGA+ P+CC G+R++ +LA+TT DRQ+ CNCLKQ    +P 
Sbjct  31   VSCGQVVNNLTPCINYVANGGALNPSCCTGVRSLYSLAQTTADRQSICNCLKQAVNGIPY 90
Query  61   VNPNN--AAALPGKCGVHIPYKISASTNCATVK 91
             N N   AA LPGKCGV+IPYKIS ST+C T+K
Sbjct  91   TNANAGLAAGLPGKCGVNIPYKISPSTDCKTIK 123

Sequence Alignment: 33. Allergen Name: Api g 2 Sequence ID: ACV04796

 Score = 75.2 bits 380,  Expect = 4e-16
 Identities = 49/90 54%, Positives = 66/90 73%, Gaps = 0/90 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            +TCGQV+  L  C+ Y++GGG   PACC G++ +N+LA+T  DR+ AC CLK L+ SV G
Sbjct  28   LTCGQVTGKLGGCLGYLKGGGYPSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKG 87
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATV 90
            +N   A+ALPGKCG+ IPY IS ST+C+ V
Sbjct  88   INYGAASALPGKCGIRIPYPISPSTDCSRV 117

Sequence Alignment: 34. Allergen Name: Sin a 3.0101 Sequence ID: ABU95411

 Score = 72.9 bits 367,  Expect = 2e-15
 Identities = 50/91 54%, Positives = 63/91 69%, Gaps = 0/91 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            ++CG V+S LA CI Y+     +P  CC G+ N+NN+ARTTPDRQ AC CL   + S P 
Sbjct  2    LSCGTVNSNLAACIGYLTQNAPLPKGCCTGVTNLNNMARTTPDRQQACRCLVGAANSFPS 61
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91
            +N   AAALP  CGV+IPYKIS STNC +V+
Sbjct  62   LNAARAAALPKACGVNIPYKISKSTNCNSVR 92

Sequence Alignment: 35. Allergen Name: Tri tu 14.0101 Sequence ID: CAH69206

 Score = 71.9 bits 361,  Expect = 4e-15
 Identities = 48/88 54%, Positives = 68/88 77%, Gaps = 4/88 4%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPA-CCNGIRNVNNLARTTPDRQAACNCLKQLSASVP 59
            ++CGQVSSAL+PCI Y RG GA P A CC+G+R++ + AR+T D+QAAC C+K  +A   
Sbjct  27   VSCGQVSSALSPCISYARGNGASPSAACCSGVRSLASSARSTADKQAACKCIKSAAA--- 83
Query  60   GVNPNNAAALPGKCGVHIPYKISASTNCATVK 91
            G+N   AA +P KCGV +PY IS+S +C+ ++
Sbjct  84   GLNAGKAAGIPTKCGVSVPYAISSSVDCSKIR 115

Sequence Alignment: 36. Allergen Name: Art gm 3.0102 Sequence ID: ANC85023

 Score = 71.2 bits 357,  Expect = 6e-15
 Identities = 46/91 50%, Positives = 63/91 69%, Gaps = 0/91 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            +TC  VS+ ++PC+ +++ GG VP  CC G++ +N+ A+TTPDRQ ACNCLK    S   
Sbjct  27   LTCSDVSNKISPCLSFLKQGGEVPADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKD 86
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91
            +  +NA  LP KCGV+IPYKIS  T+C  VK
Sbjct  87   LKSDNAVVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 37. Allergen Name: Art gm 3.0101 Sequence ID: ANC85022

 Score = 71.2 bits 357,  Expect = 6e-15
 Identities = 47/91 51%, Positives = 62/91 68%, Gaps = 0/91 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            +TC  VS+ ++PC  +++ GG VP  CC G++ +N+ A+TTPDRQ ACNCLK    S   
Sbjct  27   LTCSDVSNKISPCTSFLKQGGEVPADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKD 86
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91
               +NAA LP KCGV+IPYKIS  T+C  VK
Sbjct  87   FKSDNAAVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 38. Allergen Name: Art ca 3.0102 Sequence ID: QIN55516

 Score = 71.1 bits 356,  Expect = 7e-15
 Identities = 46/91 50%, Positives = 62/91 68%, Gaps = 0/91 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            +TC  VS+ + PC+ +++ GG VP  CC G++ +N+ A+T PDRQ ACNCLK    S   
Sbjct  27   LTCSDVSNKITPCLSFLKQGGEVPADCCTGVKGLNDAAKTGPDRQKACNCLKTTFKSNKD 86
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91
            +  +NA  LP KCGV+IPYKIS  T+C TVK
Sbjct  87   LKSDNAVVLPSKCGVNIPYKISLETDCNTVK 117

Sequence Alignment: 39. Allergen Name: Art ar 3.0102 Sequence ID: ANC85020

 Score = 70.7 bits 354,  Expect = 9e-15
 Identities = 47/91 51%, Positives = 63/91 69%, Gaps = 0/91 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            +TC  VS+ + PC+ Y++ GG VP  CC G++ +N+ A+TTPDRQ ACNCLK    S   
Sbjct  26   LTCSDVSNKITPCLNYLKQGGEVPADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKD 85
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91
            +  + AA+LP KCGV+IPYKIS  T+C  VK
Sbjct  86   LKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 40. Allergen Name: Art si 3.0102 Sequence ID: ANC85027

 Score = 70.7 bits 354,  Expect = 9e-15
 Identities = 47/91 51%, Positives = 63/91 69%, Gaps = 0/91 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            +TC  VS+ + PC+ Y++ GG VP  CC G++ +N+ A+TTPDRQ ACNCLK    S   
Sbjct  26   LTCSDVSNKITPCLNYLKQGGEVPADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKD 85
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91
            +  + AA+LP KCGV+IPYKIS  T+C  VK
Sbjct  86   LKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 41. Allergen Name: Art v 3.0202 Sequence ID: ACE07187

 Score = 70.7 bits 354,  Expect = 9e-15
 Identities = 47/91 51%, Positives = 63/91 69%, Gaps = 0/91 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            +TC  VS+ + PC+ Y++ GG VP  CC G++ +N+ A+TTPDRQ ACNCLK    S   
Sbjct  26   LTCSDVSNKITPCLNYLKQGGEVPADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKD 85
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91
            +  + AA+LP KCGV+IPYKIS  T+C  VK
Sbjct  86   LKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 42. Allergen Name: Art an 3.0102 Sequence ID: ANC85018

 Score = 70.4 bits 352,  Expect = 1e-14
 Identities = 47/91 51%, Positives = 60/91 65%, Gaps = 0/91 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            +TC  V+  ++PC  ++  GG VP  CC G++ +N+ A+TTPDRQAACNCLK    S   
Sbjct  27   LTCNDVTKKISPCTSFLEKGGEVPVDCCTGVKGLNDAAKTTPDRQAACNCLKTSFKSSNN 86
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91
                NAA LP KCGV+IPYKIS  T+C  VK
Sbjct  87   FKEENAAVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 43. Allergen Name: Lyc e 3 Sequence ID: AAB42069

 Score = 70.0 bits 350,  Expect = 1e-14
 Identities = 45/90 50%, Positives = 65/90 72%, Gaps = 1/90 1%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            ++CG+V+S LAPC+PY+ G G +   CC G++ +   A+T  DR+ AC CLK  + S+ G
Sbjct  25   LSCGEVTSGLAPCLPYLEGRGPLG-GCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKG 83
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91
            ++   AA LPG CGV+IPYKIS ST+C+TV+
Sbjct  84   IDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114

Sequence Alignment: 44. Allergen Name: Sola l 3.0101 Sequence ID: P93224

 Score = 70.0 bits 350,  Expect = 1e-14
 Identities = 45/90 50%, Positives = 65/90 72%, Gaps = 1/90 1%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            ++CG+V+S LAPC+PY+ G G +   CC G++ +   A+T  DR+ AC CLK  + S+ G
Sbjct  25   LSCGEVTSGLAPCLPYLEGRGPLG-GCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKG 83
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91
            ++   AA LPG CGV+IPYKIS ST+C+TV+
Sbjct  84   IDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114

Sequence Alignment: 45. Allergen Name: Art an 3.0101 Sequence ID: ANC85017

 Score = 69.1 bits 345,  Expect = 3e-14
 Identities = 46/91 50%, Positives = 60/91 65%, Gaps = 0/91 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            +TC  VS+ + PC  +++ GG V   CC G++ +N+ A+TTPDRQAACNCLK    S   
Sbjct  27   LTCSDVSNKILPCTSFLKQGGEVSADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKD 86
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91
               +NA  LP KCGV+IPYKIS  T+C  VK
Sbjct  87   FKSDNAVVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 46. Allergen Name: Art ca 3.0101 Sequence ID: ANC85021

 Score = 69.1 bits 345,  Expect = 3e-14
 Identities = 46/91 50%, Positives = 60/91 65%, Gaps = 0/91 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            +TC  VS+ + PC  +++ GG V   CC G++ +N+ A+TTPDRQAACNCLK    S   
Sbjct  27   LTCSDVSNKILPCTSFLKQGGEVSADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKD 86
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91
               +NA  LP KCGV+IPYKIS  T+C  VK
Sbjct  87   FKSDNAVVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 47. Allergen Name: Art v 3.0201 Sequence ID: EU564845

 Score = 68.1 bits 339,  Expect = 5e-14
 Identities = 45/91 49%, Positives = 61/91 67%, Gaps = 0/91 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            + C  VS+ ++ C+ Y++ GG VP  CC G++ +N+ A+TTPDRQ ACNCLK    S   
Sbjct  24   LKCSDVSNKISACLSYLKQGGEVPADCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKD 83
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91
               + AA+LP KCGV+IPYKIS  T+C  VK
Sbjct  84   FKSDFAASLPSKCGVNIPYKISLETDCNKVK 114

Sequence Alignment: 48. Allergen Name: Art ar 3.0101 Sequence ID: ANC85019

 Score = 68.1 bits 339,  Expect = 5e-14
 Identities = 45/91 49%, Positives = 61/91 67%, Gaps = 0/91 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            + C  VS+ ++ C+ Y++ GG VP  CC G++ +N+ A+TTPDRQ ACNCLK    S   
Sbjct  26   LKCSDVSNKISACLSYLKQGGEVPADCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKD 85
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91
               + AA+LP KCGV+IPYKIS  T+C  VK
Sbjct  86   FKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 49. Allergen Name: Art la 3.0101 Sequence ID: ANC85024

 Score = 68.1 bits 339,  Expect = 5e-14
 Identities = 45/91 49%, Positives = 61/91 67%, Gaps = 0/91 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            + C  VS+ ++ C+ Y++ GG VP  CC G++ +N+ A+TTPDRQ ACNCLK    S   
Sbjct  26   LKCSDVSNKISACLSYLKQGGEVPADCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKD 85
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91
               + AA+LP KCGV+IPYKIS  T+C  VK
Sbjct  86   FKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 50. Allergen Name: Art si 3.0101 Sequence ID: ANC85026

 Score = 67.6 bits 336,  Expect = 8e-14
 Identities = 43/91 47%, Positives = 60/91 65%, Gaps = 0/91 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            +TC  VS+ ++PC+ Y++ GG VP  CC G++ +N+ A+TTPDRQ AC CLK    +   
Sbjct  26   LTCSDVSNKISPCLNYLKQGGEVPANCCAGVKGLNDAAKTTPDRQTACTCLKNSFKTNKD 85
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91
            +  + A  LP KCGV IPYK+S  T+C  VK
Sbjct  86   LKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116

Sequence Alignment: 51. Allergen Name: Hor v 1 Sequence ID: AAA32970

 Score = 67.6 bits 336,  Expect = 8e-14
 Identities = 40/90 44%, Positives = 62/90 68%, Gaps = 0/90 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            + CGQV S + PC+ YV+GG      CCNG+R+++N A+++ DRQ  CNCLK ++  +  
Sbjct  27   LNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHN 86
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATV 90
            +N NNAA++P KC V++PY IS   +C+ +
Sbjct  87   LNLNNAASIPSKCNVNVPYTISPDIDCSRI 116

Sequence Alignment: 52. Allergen Name: Art la 3.0102 Sequence ID: ANC85025

 Score = 67.4 bits 335,  Expect = 9e-14
 Identities = 42/91 46%, Positives = 61/91 67%, Gaps = 0/91 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            +TC  VS+ ++PC+ Y++ GG VP  CC G++ +N+  +TTPDRQ ACNCLK    S   
Sbjct  25   LTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKD 84
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91
            +  + A  LP KCG+++PYK+S  T+C  VK
Sbjct  85   LKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 115

Sequence Alignment: 53. Allergen Name: Art v 3.0301 Sequence ID: EU564847

 Score = 67.4 bits 335,  Expect = 9e-14
 Identities = 42/91 46%, Positives = 61/91 67%, Gaps = 0/91 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            +TC  VS+ ++PC+ Y++ GG VP  CC G++ +N+  +TTPDRQ ACNCLK    S   
Sbjct  27   LTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKD 86
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91
            +  + A  LP KCG+++PYK+S  T+C  VK
Sbjct  87   LKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117

Sequence Alignment: 54. Allergen Name: Hor v 1 Sequence ID: CAA42832

 Score = 67.1 bits 333,  Expect = 1e-13
 Identities = 40/88 45%, Positives = 61/88 69%, Gaps = 0/88 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            + CGQV S + PC+ YV+GG      CCNG+R+++N A+++ DRQ  CNCLK ++  +  
Sbjct  27   LNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHN 86
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCA 88
            +N NNAA++P KC V++PY IS   +C+
Sbjct  87   LNLNNAASIPSKCNVNVPYTISPDIDCS 114

Sequence Alignment: 55. Allergen Name: Tri a 14.0101 Sequence ID: 19846220

 Score = 66.4 bits 330,  Expect = 1e-13
 Identities = 41/90 45%, Positives = 64/90 71%, Gaps = 0/90 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            I CG+V S + PC+ YV+GG      CC+G++N++N AR+  DRQ+ACNCLK ++  +  
Sbjct  1    IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN 60
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATV 90
            +N +NA ++P KCGV++PY IS + +C+ V
Sbjct  61   LNEDNARSIPPKCGVNLPYTISLNIDCSRV 90

Sequence Alignment: 56. Allergen Name: Sola l 7.0101 Sequence ID: NP_001316123

 Score = 63.6 bits 313,  Expect = 1e-12
 Identities = 38/90 42%, Positives = 58/90 64%, Gaps = 0/90 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            ITCGQV + LAPC+P++  GG    ACC+G+R +N   +++ DR+ ACNC+K  +   P 
Sbjct  25   ITCGQVDANLAPCVPFLTQGGEPGAACCSGVRTLNGNTQSSDDRRTACNCVKAAANRYPN 84
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATV 90
            +  + A +LP KCG+ +   IS + NC T+
Sbjct  85   LKDDAAQSLPSKCGISLTVPISRTVNCDTI 114

Sequence Alignment: 57. Allergen Name: Hel a 3.0101 Sequence ID: P82007

 Score = 59.7 bits 291,  Expect = 2e-11
 Identities = 38/89 42%, Positives = 53/89 59%, Gaps = 1/89 1%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            ITC  V+  L PC+PY+R GG   PACC G + +    RT  DR+ AC C K  +  +  
Sbjct  27   ITCNDVTGNLTPCLPYLRSGGKPTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK- 85
Query  61   VNPNNAAALPGKCGVHIPYKISASTNCATV 90
            V P+ A++LPGKCG+     I+ + NC T+
Sbjct  86   VRPDMASSLPGKCGISTSIPINPNVNCNTI 115

Sequence Alignment: 58. Allergen Name: Amb a 6 Sequence ID: O04004

 Score = 46.9 bits 217,  Expect = 1e-07
 Identities = 32/85 37%, Positives = 48/85 56%, Gaps = 3/85 3%
Query  2    TCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGV 61
            TC  V + LAPC  ++ G      ACC G+ N+NN  +T  DR A CNC+K+L+ S+   
Sbjct  29   TCDTVQNILAPCAGFLTGQEP-SKACCTGVNNLNNSRKTKADRVAVCNCIKELTKSI-AY 86
Query  62   NPNNAAALPGKCGVHIPYK-ISASTNCA 88
            +P     L  KCGV   +  +  + +C+
Sbjct  87   DPKRMPLLSTKCGVKPDFPAVDKNLDCS 114

Sequence Alignment: 59. Allergen Name: Par j 1 Sequence ID: Q40905

 Score = 44.3 bits 202,  Expect = 9e-07
 Identities = 28/88 31%, Positives = 48/88 54%, Gaps = 5/88 5%
Query  2    TCGQVSSALAPCIPYVRGGGAVPP-ACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            TCG V  AL PC+P+V+G    P   CC+G + ++   +T P R  AC C++    +   
Sbjct  39   TCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 98
Query  61   VNPNNAAALPGKCGV---HIPYKISASTNCATV 90
            ++    + +P  CG+    +P  I  + +C T+
Sbjct  99   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 130

Sequence Alignment: 60. Allergen Name: Par j 2 Sequence ID: O04403

 Score = 44.1 bits 201,  Expect = 1e-06
 Identities = 26/88 29%, Positives = 51/88 57%, Gaps = 4/88 4%
Query  3    CGQVSSALAPCIPYVRGGGAVPP-ACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGV 61
            CG+V   + PC+ +V+G    P  +CC+G + ++   +TT  ++ AC C+   +  + G+
Sbjct  35   CGKVVHHIMPCLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGI 94
Query  62   NPNNAAALPGKCGVH--IPYKISASTNCATVK 91
                 A +P KCG+   +P  I+A  +C+ ++
Sbjct  95   KNELVAEVPKKCGITTTLP-PITADFDCSKIE 125

Sequence Alignment: 61. Allergen Name: Par j 1 Sequence ID: P43217

 Score = 44.2 bits 201,  Expect = 1e-06
 Identities = 28/88 31%, Positives = 48/88 54%, Gaps = 5/88 5%
Query  2    TCGQVSSALAPCIPYVRGGGAVPP-ACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            TCG +  AL PC+P+V+G    P   CC+G + ++   +T P R  AC C++    +   
Sbjct  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
Query  61   VNPNNAAALPGKCGV---HIPYKISASTNCATV 90
            ++    + +P  CG+    +P  I  + +C TV
Sbjct  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94

Sequence Alignment: 62. Allergen Name: Par j 1.0103 Sequence ID: CAI94601

 Score = 43.5 bits 197,  Expect = 2e-06
 Identities = 27/88 30%, Positives = 48/88 54%, Gaps = 5/88 5%
Query  2    TCGQVSSALAPCIPYVRGGGAVPP-ACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            TCG +  AL PC+P+V+G    P   CC+G + ++   +T P R  AC C++    +   
Sbjct  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
Query  61   VNPNNAAALPGKCGV---HIPYKISASTNCATV 90
            ++    + +P  CG+    +P  I  + +C T+
Sbjct  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 94

Sequence Alignment: 63. Allergen Name: Par j 2 Sequence ID: P55958

 Score = 43.1 bits 195,  Expect = 2e-06
 Identities = 25/88 28%, Positives = 50/88 56%, Gaps = 4/88 4%
Query  3    CGQVSSALAPCIPYVRGGGAVPPA-CCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGV 61
            CG+V   + PC+ +V+G    P   CC+G + ++   +TT  ++ AC C+ + +  + G+
Sbjct  35   CGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGI 94
Query  62   NPNNAAALPGKCGVH--IPYKISASTNCATVK 91
                 A +P KC +   +P  I+A  +C+ ++
Sbjct  95   KNELVAEVPKKCDIKTTLP-PITADFDCSKIQ 125

Sequence Alignment: 64. Allergen Name: Par j 1 Sequence ID: O04404

 Score = 41.8 bits 187,  Expect = 7e-06
 Identities = 27/88 30%, Positives = 47/88 53%, Gaps = 5/88 5%
Query  2    TCGQVSSALAPCIPYVRGGGAVPP-ACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
            TCG V  AL PC+P+V+G    P   CC+G + ++   +T   R  AC C++    +   
Sbjct  40   TCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSD 99
Query  61   VNPNNAAALPGKCGV---HIPYKISASTNCATV 90
            ++    + +P  CG+    +P  I  + +C T+
Sbjct  100  IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 131

Sequence Alignment: 65. Allergen Name: Par j 1.0101 Sequence ID: CAA54587

 Score = 40.1 bits 178,  Expect = 2e-05
 Identities = 25/81 30%, Positives = 44/81 54%, Gaps = 5/81 6%
Query  9    ALAPCIPYVRGGGAVPP-ACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAA 67
            AL PC+P+V+G    P   CC+G + ++   +T P R  AC C++    +   ++    +
Sbjct  4    ALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVS 63
Query  68   ALPGKCGV---HIPYKISASTNCATV 90
             +P  CG+    +P  I  + +C TV
Sbjct  64   EVPKHCGIVDSKLP-PIDVNMDCKTV 88

Sequence Alignment: 66. Allergen Name: Art v 3.0101 Sequence ID: P0C088

 Score = 33.7 bits 144,  Expect = 0.0004
 Identities = 15/36 41%, Positives = 26/36 72%, Gaps = 0/36 0%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNN 36
            +TC  VS+ ++PC+ Y++ GG VP  CC G++ +N+
Sbjct  2    LTCSDVSNKISPCLSYLKQGGEVPADCCAGVKGLND 37

Sequence Alignment: 67. Allergen Name: Vit v 1 Sequence ID: P80274

 Score = 32.1 bits 135,  Expect = 0.001
 Identities = 18/28 64%, Positives = 24/28 85%, Gaps = 1/28 3%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPP-ACC 28
            +TCGQV+SAL+PCI Y++  GAVP  +CC
Sbjct  2    VTCGQVASALSPCIDYLQKDGAVPAGSCC 30

Sequence Alignment: 68. Allergen Name: Cas s 8 Sequence ID: 10998016

 Score = 31.6 bits 132,  Expect = 0.002
 Identities = 16/32 50%, Positives = 22/32 68%, Gaps = 2/32 6%
Query  1    ITCGQVSSALAPCIPYVRGGGAVPP--ACCNGIR 32
            ITC QVS +L PC+ Y++  G  PP   CC G++
Sbjct  2    ITCTQVSKSLMPCLTYLKSNGGSPPPGTCCQGVK 35

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.