The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

KTMADTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFID
FDEFISFCNANPGLMKDVAKVF
Sequence Info Allergen Name Length Opt Bits Score E Value
CAA62634 Cyn d 7 82 540 97.0 6.8e-23
P94092 Cyn d 7 80 529 95.2 2.3e-22
O82040 Phl p 7 78 482 87.6 4.4e-20
AAL92871 Che a 3 86 377 70.6 6.2e-15
ALE34025 Sal k 7.0101 86 372 69.8 1.1e-14
CAA73147 Bet v 4 85 355 67.1 7.3e-14
Q39419 Bet v 4 85 353 66.8 9.1e-14
P58171 Syr v 3 81 352 66.6 9.8e-14
P69197 Bra r 5.0101 79 351 66.4 1.1e-13
CAP05019 Par j 4.0101 84 350 66.3 1.3e-13
O81701 Aln g 4 85 347 65.8 1.8e-13
O81092 Ole e 3 84 345 65.5 2.2e-13
Q39406 Bra n 2 83 343 65.1 2.7e-13
BAA09633 Bra n 2 82 337 64.2 5.3e-13
AY904434 Art v 5.0101 82 316 60.8 5.6e-12
Q2KN25 Amb a 10.0101 160 267 53.1 2.2e-09
O64943 Jun o 4 165 243 49.3 3.3e-08
ABP87672 Cup a 4.0101 177 241 49.0 4.3e-08
AAF31152 Ole e 8 171 234 47.8 9.2e-08
Q9M7R0 Ole e 8 171 226 46.5 2.3e-07
ACL36923 Tyr p 24.0101 153 171 37.6 0.0001
QBF67841 Der f 39.0101 153 171 37.6 0.0001
D2DGW3 Tyr p 34.0101 153 171 37.6 0.0001
QXY82447 Der p 39.0101 153 171 37.6 0.0001
ABB89298 Bla g 6.0301 154 156 35.1 0.00054
ABB89297 Bla g 6.0201 151 155 35.0 0.0006
ABB89296 Bla g 6.0101 151 149 34.0 0.0012
Q1M0Y3 Per a 6.0101 151 145 33.3 0.0018
P43187 Bet v 3 205 141 32.8 0.0036
P29291 Hom a 6.0101 150 136 31.9 0.005
ADV17344 Pen m 6.0101 150 132 31.2 0.0079
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Cyn d 7 Sequence ID: CAA62634

 Score = 97.0 bits 540,  Expect = 7e-23
 Identities = 82/82 100%, Positives = 82/82 100%, Gaps = 0/82 0%
Query  1    KTMADTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFID 60
            KTMADTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFID
Sbjct  1    KTMADTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFID 60
Query  61   FDEFISFCNANPGLMKDVAKVF 82
            FDEFISFCNANPGLMKDVAKVF
Sbjct  61   FDEFISFCNANPGLMKDVAKVF 82

Sequence Alignment: 2. Allergen Name: Cyn d 7 Sequence ID: P94092

 Score = 95.2 bits 529,  Expect = 2e-22
 Identities = 80/80 100%, Positives = 80/80 100%, Gaps = 0/80 0%
Query  3    MADTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFD 62
            MADTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFD
Sbjct  1    MADTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFD 60
Query  63   EFISFCNANPGLMKDVAKVF 82
            EFISFCNANPGLMKDVAKVF
Sbjct  61   EFISFCNANPGLMKDVAKVF 80

Sequence Alignment: 3. Allergen Name: Phl p 7 Sequence ID: O82040

 Score = 87.6 bits 482,  Expect = 4e-20
 Identities = 75/78 96%, Positives = 77/78 98%, Gaps = 2/78 2%
Query  3    MADTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFD 62
            MAD  DME IFKRFDTNGDGKISL+ELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDF+
Sbjct  1    MAD--DMERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFN 58
Query  63   EFISFCNANPGLMKDVAKVF 82
            EFISFCNANPGLMKDVAKVF
Sbjct  59   EFISFCNANPGLMKDVAKVF 78

Sequence Alignment: 4. Allergen Name: Che a 3 Sequence ID: AAL92871

 Score = 70.6 bits 377,  Expect = 6e-15
 Identities = 58/81 71%, Positives = 65/81 80%, Gaps = 0/81 0%
Query  2    TMADTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDF 61
            T  D  D E IFKRFDTNGDGKIS +EL DAL+TLGS + DEV+RMMAEIDTDGDGFI F
Sbjct  6    TPQDIADRERIFKRFDTNGDGKISSSELGDALKTLGSVTPDEVRRMMAEIDTDGDGFISF 65
Query  62   DEFISFCNANPGLMKDVAKVF 82
            DEF  F  AN GL+KDV+K+F
Sbjct  66   DEFTDFARANRGLVKDVSKIF 86

Sequence Alignment: 5. Allergen Name: Sal k 7.0101 Sequence ID: ALE34025

 Score = 69.8 bits 372,  Expect = 1e-14
 Identities = 57/81 70%, Positives = 65/81 80%, Gaps = 0/81 0%
Query  2    TMADTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDF 61
            T  D  D E IFKRFDTNGDGKIS +EL DAL+TLGS ++DE+ RMMAEIDTDGDGFI F
Sbjct  6    TPQDLADRERIFKRFDTNGDGKISSSELGDALKTLGSVTSDEIVRMMAEIDTDGDGFISF 65
Query  62   DEFISFCNANPGLMKDVAKVF 82
            +EF  F  AN GL+KDVAK+F
Sbjct  66   EEFTEFARANRGLIKDVAKIF 86

Sequence Alignment: 6. Allergen Name: Bet v 4 Sequence ID: CAA73147

 Score = 67.1 bits 355,  Expect = 7e-14
 Identities = 54/78 69%, Positives = 61/78 78%, Gaps = 0/78 0%
Query  5    DTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFDEF 64
            D  + E IFKRFD NGDGKIS AEL +AL+TLGS + DEV+ MMAEIDTDGDGFI F EF
Sbjct  8    DKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEF 67
Query  65   ISFCNANPGLMKDVAKVF 82
              F  AN GL+KDVAK+F
Sbjct  68   TDFARANRGLLKDVAKIF 85

Sequence Alignment: 7. Allergen Name: Bet v 4 Sequence ID: Q39419

 Score = 66.8 bits 353,  Expect = 9e-14
 Identities = 54/78 69%, Positives = 61/78 78%, Gaps = 0/78 0%
Query  5    DTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFDEF 64
            D  + E IFKRFD NGDGKIS AEL +AL+TLGS + DEV+ MMAEIDTDGDGFI F EF
Sbjct  8    DKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEF 67
Query  65   ISFCNANPGLMKDVAKVF 82
              F  AN GL+KDVAK+F
Sbjct  68   TDFGRANRGLLKDVAKIF 85

Sequence Alignment: 8. Allergen Name: Syr v 3 Sequence ID: P58171

 Score = 66.6 bits 352,  Expect = 1e-13
 Identities = 51/78 65%, Positives = 63/78 80%, Gaps = 0/78 0%
Query  5    DTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFDEF 64
            +  ++E IFKRFD NGDGKIS +EL + L+TLGS + +E+QRMMAEIDTDGDGFI F+EF
Sbjct  4    EVAELERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEIDTDGDGFISFEEF 63
Query  65   ISFCNANPGLMKDVAKVF 82
              F  AN GL+KDVAK+F
Sbjct  64   KDFARANSGLIKDVAKIF 81

Sequence Alignment: 9. Allergen Name: Bra r 5.0101 Sequence ID: P69197

 Score = 66.4 bits 351,  Expect = 1e-13
 Identities = 55/79 69%, Positives = 64/79 81%, Gaps = 1/79 1%
Query  3    MADTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFD 62
            MAD  + E IFK+FDT+GDGKIS AEL +AL+ LGS + D+V RMMA+IDTDGDG I F 
Sbjct  1    MADA-EHERIFKKFDTDGDGKISAAELEEALKKLGSVTPDDVTRMMAKIDTDGDGNISFQ 59
Query  63   EFISFCNANPGLMKDVAKVF 82
            EF  F +ANPGLMKDVAKVF
Sbjct  60   EFTEFASANPGLMKDVAKVF 79

Sequence Alignment: 10. Allergen Name: Par j 4.0101 Sequence ID: CAP05019

 Score = 66.3 bits 350,  Expect = 1e-13
 Identities = 52/78 66%, Positives = 65/78 83%, Gaps = 0/78 0%
Query  5    DTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFDEF 64
            D  + E IFKRFD+NGDGKIS +EL +AL+ LGS +ADEV+RMMAEIDTDGDG I ++EF
Sbjct  7    DRAEQERIFKRFDSNGDGKISSSELGEALKALGSVTADEVHRMMAEIDTDGDGAISLEEF 66
Query  65   ISFCNANPGLMKDVAKVF 82
             SF +AN GL+KD+AK+F
Sbjct  67   SSFADANRGLIKDIAKIF 84

Sequence Alignment: 11. Allergen Name: Aln g 4 Sequence ID: O81701

 Score = 65.8 bits 347,  Expect = 2e-13
 Identities = 53/78 67%, Positives = 61/78 78%, Gaps = 0/78 0%
Query  5    DTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFDEF 64
            D  + E IFK FD NGDGKIS +EL DAL+TLGS + DEV+ MMAEIDTDGDGFI F EF
Sbjct  8    DQAEHERIFKCFDANGDGKISASELGDALKTLGSVTPDEVKHMMAEIDTDGDGFISFQEF 67
Query  65   ISFCNANPGLMKDVAKVF 82
             +F  AN GL+KDVAK+F
Sbjct  68   TNFARANRGLVKDVAKIF 85

Sequence Alignment: 12. Allergen Name: Ole e 3 Sequence ID: O81092

 Score = 65.5 bits 345,  Expect = 2e-13
 Identities = 51/78 65%, Positives = 62/78 79%, Gaps = 0/78 0%
Query  5    DTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFDEF 64
            +  + E IFKRFD NGDGKIS +EL + L+TLGS + +E+QRMMAEIDTDGDGFI F+EF
Sbjct  7    EVAEHERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEIDTDGDGFISFEEF 66
Query  65   ISFCNANPGLMKDVAKVF 82
              F  AN GL+KDVAK+F
Sbjct  67   TVFARANRGLVKDVAKIF 84

Sequence Alignment: 13. Allergen Name: Bra n 2 Sequence ID: Q39406

 Score = 65.1 bits 343,  Expect = 3e-13
 Identities = 54/80 67%, Positives = 65/80 81%, Gaps = 3/80 3%
Query  3    MAD-TGDMEH--IFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFI 59
            MAD T   EH  IFK+FD NGDGKIS +EL DAL+ LGS + D+++RMMAEIDTDGDG+I
Sbjct  1    MADATEKAEHDRIFKKFDANGDGKISASELGDALKNLGSVTHDDIKRMMAEIDTDGDGYI 60
Query  60   DFDEFISFCNANPGLMKDVAKVF 82
             + EF  F +AN GLMKDVAK+F
Sbjct  61   SYQEFSDFASANRGLMKDVAKIF 83

Sequence Alignment: 14. Allergen Name: Bra n 2 Sequence ID: BAA09633

 Score = 64.2 bits 337,  Expect = 5e-13
 Identities = 48/78 61%, Positives = 62/78 79%, Gaps = 0/78 0%
Query  5    DTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFDEF 64
            +  + + IFK+FD NGDGKIS +EL DAL+ LGS + D+++RMMAEIDTDGDG+I + EF
Sbjct  5    EKAEHDRIFKKFDANGDGKISASELGDALKNLGSVTHDDIKRMMAEIDTDGDGYISYQEF 64
Query  65   ISFCNANPGLMKDVAKVF 82
              F +AN GLMKDVAK+F
Sbjct  65   SDFASANRGLMKDVAKIF 82

Sequence Alignment: 15. Allergen Name: Art v 5.0101 Sequence ID: AY904434

 Score = 60.8 bits 316,  Expect = 6e-12
 Identities = 48/78 61%, Positives = 57/78 73%, Gaps = 0/78 0%
Query  5    DTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFDEF 64
            D  + + IF  FD NGDGKIS AEL ++L  LGS S +EVQ MM E+DTDGDG+I +DEF
Sbjct  5    DKAECDRIFGAFDKNGDGKISAAELGESLTKLGSVSPEEVQTMMDELDTDGDGYISYDEF 64
Query  65   ISFCNANPGLMKDVAKVF 82
              F NAN GLMKDV K+F
Sbjct  65   AEFFNANRGLMKDVGKIF 82

Sequence Alignment: 16. Allergen Name: Amb a 10.0101 Sequence ID: Q2KN25

 Score = 53.1 bits 267,  Expect = 2e-09
 Identities = 42/64 65%, Positives = 50/64 78%, Gaps = 1/64 1%
Query  5    DTGDMEHIFKRFDTNGDGKISLAELTDALRTLGS-TSADEVQRMMAEIDTDGDGFIDFDE 63
            D  ++  IF RFDTNGDG+IS  EL   L++LGS TS DEV+R+MAEID DGDGFI +DE
Sbjct  14   DKEEVTKIFNRFDTNGDGQISEDELFAILKSLGSDTSPDEVKRVMAEIDADGDGFISLDE 73
Query  64   FISFC 68
            FI FC
Sbjct  74   FILFC 78
 Score = 36.3 bits 163,  Expect = 0.0003
 Identities = 25/60 41%, Positives = 36/60 60%, Gaps = 1/60 1%
Query  5    DTGDMEHIFKRFDTNGDGKISLAELTDALRTLGST-SADEVQRMMAEIDTDGDGFIDFDE 63
            +  D++  FK +D N +G IS  EL   L  LG   S +    M+  +D+DGDGF+DF+E
Sbjct  87   EINDLKEAFKFYDQNNNGVISANELHQILGRLGENYSVESCADMIKSVDSDGDGFVDFEE 146
Query  64   F 64
            F
Sbjct  147  F 147

Sequence Alignment: 17. Allergen Name: Jun o 4 Sequence ID: O64943

 Score = 49.3 bits 243,  Expect = 3e-08
 Identities = 37/75 49%, Positives = 53/75 70%, Gaps = 3/75 4%
Query  8    DMEHIFKRFDTNGDGKISLAELTDALRTLGSTSAD-EVQRMMAEIDTDGDGFIDFDEFIS 66
            ++E +FK+FD NGDGKIS +EL D LR+LGS   + EV+ MM E D DGDG++ + EF+ 
Sbjct  26   ELEEVFKKFDANGDGKISGSELADILRSLGSDVGEAEVKAMMEEADADGDGYVSLQEFVD 85
Query  67   FCNANPGL--MKDVAKVF 82
            + N    +  +K+  KVF
Sbjct  86   LNNKGASVKDLKNAFKVF 103

Sequence Alignment: 18. Allergen Name: Cup a 4.0101 Sequence ID: ABP87672

 Score = 49.0 bits 241,  Expect = 4e-08
 Identities = 36/74 48%, Positives = 52/74 70%, Gaps = 2/74 2%
Query  8    DMEHIFKRFDTNGDGKISLAELTDALRTLGSTSAD-EVQRMMAEIDTDGDGFIDFDEFIS 66
            ++E +FK+FD NGDGKIS +EL D LR++GS   + EV+ MM E DTDGDG++ + EF+ 
Sbjct  38   ELEEVFKKFDANGDGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVD 97
Query  67   FCNANPGLMKDVAKVF 82
            + N     +KD+   F
Sbjct  98   L-NIKGATVKDLKNAF 112

Sequence Alignment: 19. Allergen Name: Ole e 8 Sequence ID: AAF31152

 Score = 47.8 bits 234,  Expect = 9e-08
 Identities = 37/68 54%, Positives = 48/68 70%, Gaps = 1/68 1%
Query  3    MADTGDMEHIFKRFDTNGDGKISLAELTDALRTLGS-TSADEVQRMMAEIDTDGDGFIDF 61
            + +  +++ +F RFD NGDGKIS  EL  AL+ LGS TS +E+ RMM EIDTD DGFI+ 
Sbjct  15   LQEPNEVQGVFNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFINV 74
Query  62   DEFISFCNA 70
             EF +F  A
Sbjct  75   QEFAAFVKA 83

Sequence Alignment: 20. Allergen Name: Ole e 8 Sequence ID: Q9M7R0

 Score = 46.5 bits 226,  Expect = 2e-07
 Identities = 35/68 51%, Positives = 47/68 69%, Gaps = 1/68 1%
Query  3    MADTGDMEHIFKRFDTNGDGKISLAELTDALRTLGS-TSADEVQRMMAEIDTDGDGFIDF 61
            + +  +++ +F RFD NGDGKIS  EL   L+ LGS TS +E+ R+M EIDTD DGFI+ 
Sbjct  15   LQEPNEVQGVFNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGFINV 74
Query  62   DEFISFCNA 70
             EF +F  A
Sbjct  75   QEFAAFVKA 83

Sequence Alignment: 21. Allergen Name: Tyr p 24.0101 Sequence ID: ACL36923

 Score = 37.6 bits 171,  Expect = 0.0001
 Identities = 25/58 43%, Positives = 37/58 63%, Gaps = 1/58 1%
Query  8    DMEHIFKRFDTNGDGKISLAELTDALRTLGST-SADEVQRMMAEIDTDGDGFIDFDEFI 65
            ++   F+ +D  G+G I  + L + LR L    + DE+  M+AEIDTDG G +DFDEF+
Sbjct  89   ELREAFRMYDKEGNGYIPTSALREILRALDDKLTEDELDEMIAEIDTDGSGTVDFDEFM 147

Sequence Alignment: 22. Allergen Name: Der f 39.0101 Sequence ID: QBF67841

 Score = 37.6 bits 171,  Expect = 0.0001
 Identities = 25/58 43%, Positives = 37/58 63%, Gaps = 1/58 1%
Query  8    DMEHIFKRFDTNGDGKISLAELTDALRTLGST-SADEVQRMMAEIDTDGDGFIDFDEFI 65
            ++   F+ +D  G+G I  + L + LR L    + DE+  M+AEIDTDG G +DFDEF+
Sbjct  89   ELREAFRMYDKEGNGYIPTSALREILRALDDKLTNDELDEMIAEIDTDGSGTVDFDEFM 147

Sequence Alignment: 23. Allergen Name: Tyr p 34.0101 Sequence ID: D2DGW3

 Score = 37.6 bits 171,  Expect = 0.0001
 Identities = 25/58 43%, Positives = 37/58 63%, Gaps = 1/58 1%
Query  8    DMEHIFKRFDTNGDGKISLAELTDALRTLGST-SADEVQRMMAEIDTDGDGFIDFDEFI 65
            ++   F+ +D  G+G I  + L + LR L    + DE+  M+AEIDTDG G +DFDEF+
Sbjct  89   ELREAFRMYDKEGNGYIPTSALREILRALDDKLTEDELDEMIAEIDTDGSGTVDFDEFM 147

Sequence Alignment: 24. Allergen Name: Der p 39.0101 Sequence ID: QXY82447

 Score = 37.6 bits 171,  Expect = 0.0001
 Identities = 25/58 43%, Positives = 37/58 63%, Gaps = 1/58 1%
Query  8    DMEHIFKRFDTNGDGKISLAELTDALRTLGST-SADEVQRMMAEIDTDGDGFIDFDEFI 65
            ++   F+ +D  G+G I  + L + LR L    + DE+  M+AEIDTDG G +DFDEF+
Sbjct  89   ELREAFRMYDKEGNGYIPTSALREILRALDDKLTNDELDEMIAEIDTDGSGTVDFDEFM 147

Sequence Alignment: 25. Allergen Name: Bla g 6.0301 Sequence ID: ABB89298

 Score = 35.1 bits 156,  Expect = 0.0005
 Identities = 23/58 39%, Positives = 36/58 62%, Gaps = 1/58 1%
Query  8    DMEHIFKRFDTNGDGKISLAELTDALRTLG-STSADEVQRMMAEIDTDGDGFIDFDEFI 65
            ++   F+ +D  G+G I  + L + LR L    ++DE+  M+ EID DG G +DFDEF+
Sbjct  91   ELREAFRLYDKEGNGYIPTSCLREILRELDEQLTSDELDMMIEEIDADGSGTVDFDEFM 149

Sequence Alignment: 26. Allergen Name: Bla g 6.0201 Sequence ID: ABB89297

 Score = 35.0 bits 155,  Expect = 0.0006
 Identities = 22/58 37%, Positives = 38/58 65%, Gaps = 1/58 1%
Query  8    DMEHIFKRFDTNGDGKISLAELTDALRTLGST-SADEVQRMMAEIDTDGDGFIDFDEFI 65
            ++   F+ +D  G+G I+ A L + L+ L    +A+++  M+ EID+DG G +DFDEF+
Sbjct  87   ELREAFRLYDKEGNGYITTAVLREILKELDDKITAEDLDMMIEEIDSDGSGTVDFDEFM 145

Sequence Alignment: 27. Allergen Name: Bla g 6.0101 Sequence ID: ABB89296

 Score = 34.0 bits 149,  Expect = 0.001
 Identities = 21/58 36%, Positives = 37/58 63%, Gaps = 1/58 1%
Query  8    DMEHIFKRFDTNGDGKISLAELTDALRTLGST-SADEVQRMMAEIDTDGDGFIDFDEFI 65
            ++   F+ +D  G+G I+   L + L+ L    +A+++  M+ EID+DG G +DFDEF+
Sbjct  87   ELREAFRLYDKEGNGYITTNVLREILKELDDKITAEDLDMMIEEIDSDGSGTVDFDEFM 145

Sequence Alignment: 28. Allergen Name: Per a 6.0101 Sequence ID: Q1M0Y3

 Score = 33.3 bits 145,  Expect = 0.002
 Identities = 21/58 36%, Positives = 36/58 62%, Gaps = 1/58 1%
Query  8    DMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADE-VQRMMAEIDTDGDGFIDFDEFI 65
            +++  F+ +D  G+G I+   L + L+ L     +E +  M+ EID+DG G +DFDEF+
Sbjct  87   ELKEAFRLYDKEGNGYITTTVLREILKELDDKLTNEDLDAMIEEIDSDGSGTVDFDEFM 145

Sequence Alignment: 29. Allergen Name: Bet v 3 Sequence ID: P43187

 Score = 32.8 bits 141,  Expect = 0.004
 Identities = 24/52 46%, Positives = 33/52 63%, Gaps = 3/52 5%
Query  13   FKRFDTNGDGKISLAELTDALRTLG---STSADEVQRMMAEIDTDGDGFIDFDEF 64
            FK FD +GDG IS  EL   L  LG    +  D V++M+  +D++ DG +DF EF
Sbjct  139  FKVFDEDGDGYISARELQMVLGKLGFSEGSEIDRVEKMIVSVDSNRDGRVDFFEF 193

Sequence Alignment: 30. Allergen Name: Hom a 6.0101 Sequence ID: P29291

 Score = 31.9 bits 136,  Expect = 0.005
 Identities = 20/62 32%, Positives = 36/62 58%, Gaps = 1/62 1%
Query  8    DMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADE-VQRMMAEIDTDGDGFIDFDEFIS 66
            ++   F+ +D  G+G I+   L + LR L +   +E +  ++ E+D DG G +DF+EF+ 
Sbjct  87   ELREAFRVYDRGGNGYITTDVLKEILRELDNRLTEEDLDSIIEEVDEDGSGTLDFNEFMQ 146
Query  67   FCN 69
              N
Sbjct  147  MMN 149

Sequence Alignment: 31. Allergen Name: Pen m 6.0101 Sequence ID: ADV17344

 Score = 31.2 bits 132,  Expect = 0.008
 Identities = 21/56 37%, Positives = 31/56 55%, Gaps = 1/56 1%
Query  9    MEHIFKRFDTNGDGKISLAELTDALRTLG-STSADEVQRMMAEIDTDGDGFIDFDEF 64
            +   F  FDT G G I+   +   LR +G   S   +Q ++AE D DG G ++F+EF
Sbjct  12   LRKAFNSFDTEGAGSINAETVGVILRMMGVKISEKNLQEVIAETDEDGSGMLEFEEF 68

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.