The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

KVNYCKIKCLKGGVHTACKYGTSTKPNCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAKG
LETRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYGHDTCKDTEKYPVGQNIAKRST
TAALFDSPGKLVKMWENEVKDFNPNIEWSKNNLKKTGHYTQMVWAKTKEIGCGSVKYVKD
EWYTHYLVCNYGPSGNFRNEKLYEKK
Sequence Info Allergen Name Length Opt Bits Score E Value
P35787 Ves vi 5 206 1448 447.3 1.6e-127
P35786 Ves s 5 205 1219 377.3 1.8e-106
P35785 Ves p 5 204 1134 351.3 1.2e-98
P35783 Ves f 5 204 1123 348.0 1.2e-97
Q05110 Ves v 5 227 1120 347.0 2.7e-97
P35784 Ves g 5 204 1113 344.9 1e-96
P35760 Ves m 5 204 1109 343.7 2.4e-96
P10736 Dol m 5.0101 227 1054 326.8 3.2e-91
P0DMB9 Vesp v 5.0101 202 1044 323.8 2.2e-90
P35781 Vesp c 5 202 1038 322.0 7.9e-90
Q05108 Dol a 5 203 1033 320.5 2.3e-89
P35782 Vesp c 5 202 1020 316.5 3.6e-88
P10737 Dol m 5.02 215 1016 315.2 9.1e-88
P81657 Vesp m 5 202 1010 313.5 3e-87
AAA28302 Dol m 5.02 212 1001 310.7 2.1e-86
P81656 Pol d 5 206 891 277.1 2.7e-76
P35759 Pol e 5.0101 205 884 274.9 1.2e-75
P83377 Pol g 5 206 883 274.6 1.5e-75
Q05109 Pol a 5 209 880 273.7 2.8e-75
P35780 Pol f 5 205 876 272.5 6.4e-75
AAT95009 Pol e 5.0101 226 868 270.0 4e-74
C0HJV9 Poly p 5.0101 206 857 266.7 3.6e-73
P86686 Poly p 5.0102 207 856 266.4 4.5e-73
Q7Z156 Poly s 5.0101 207 856 266.4 4.5e-73
P35778 Sol i 3 234 685 214.1 2.9e-57
P35779 Sol r 3 211 684 213.8 3e-57
C0ITL3 Pac c 3.0101 199 659 206.2 5.6e-55
QEA69430 Sco m 5.0101 210 354 113.0 6.8e-27
ABC58726 Sol s 3.0101 90 267 87.0 2e-19
AAF65314 Cte f 2 264 269 86.9 6.2e-19
AAF82096 Glo m 5 259 250 81.1 3.4e-17
AAY32926 Sol g 3.0101 70 241 79.2 3.4e-17
AAU15051 Cyn d 24.0101 153 189 62.8 6.4e-12
AVD29826 Art la 2.0101 163 183 60.9 2.5e-11
A0A2L1DGQ3 Art ar 2.0101 163 183 60.9 2.5e-11
AVD29827 Art si 2.0101 163 183 60.9 2.5e-11
AVD29822 Art an 2.0101 163 183 60.9 2.5e-11
AVD29824 Art ca 2.0101 163 183 60.9 2.5e-11
AVD29825 Art gm 2.0101 163 183 60.9 2.5e-11
ADM18345 Tab y 5.0101 256 170 56.7 7.6e-10
7065471 Pol m 5.0101 37 155 53.3 1.1e-09
XP_007199020 Pru p 9.0101 161 138 47.2 3.4e-07
P86687 Poly p 2.0101 288 94 33.4 0.0088
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ves vi 5 Sequence ID: P35787

 Score = 447.3 bits 1448,  Expect = 2e-127
 Identities = 206/206 100%, Positives = 206/206 100%, Gaps = 0/206 0%
Query  1    KVNYCKIKCLKGGVHTACKYGTSTKPNCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAKG 60
            KVNYCKIKCLKGGVHTACKYGTSTKPNCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAKG
Sbjct  1    KVNYCKIKCLKGGVHTACKYGTSTKPNCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAKG 60
Query  61   LETRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYGHDTCKDTEKYPVGQNIAKRST 120
            LETRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYGHDTCKDTEKYPVGQNIAKRST
Sbjct  61   LETRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYGHDTCKDTEKYPVGQNIAKRST 120
Query  121  TAALFDSPGKLVKMWENEVKDFNPNIEWSKNNLKKTGHYTQMVWAKTKEIGCGSVKYVKD 180
            TAALFDSPGKLVKMWENEVKDFNPNIEWSKNNLKKTGHYTQMVWAKTKEIGCGSVKYVKD
Sbjct  121  TAALFDSPGKLVKMWENEVKDFNPNIEWSKNNLKKTGHYTQMVWAKTKEIGCGSVKYVKD 180
Query  181  EWYTHYLVCNYGPSGNFRNEKLYEKK 206
            EWYTHYLVCNYGPSGNFRNEKLYEKK
Sbjct  181  EWYTHYLVCNYGPSGNFRNEKLYEKK 206

Sequence Alignment: 2. Allergen Name: Ves s 5 Sequence ID: P35786

 Score = 377.3 bits 1219,  Expect = 2e-106
 Identities = 165/205 80%, Positives = 187/205 91%, Gaps = 0/205 0%
Query  2    VNYCKIKCLKGGVHTACKYGTSTKPNCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAKGL 61
            V+YCKIKCLKGGVHTACKYGTSTKPNCG MVVK+YG+T+AEKQEILK+HNDFR KVA+GL
Sbjct  1    VDYCKIKCLKGGVHTACKYGTSTKPNCGNMVVKSYGVTQAEKQEILKIHNDFRNKVARGL 60
Query  62   ETRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYGHDTCKDTEKYPVGQNIAKRSTT 121
            ETRGNPGPQPPAKNMNNLVWN+ELANIAQ+WASQC YGHDTCKDT KY VGQNIA  S+T
Sbjct  61   ETRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYGHDTCKDTTKYNVGQNIAVSSST 120
Query  122  AALFDSPGKLVKMWENEVKDFNPNIEWSKNNLKKTGHYTQMVWAKTKEIGCGSVKYVKDE 181
            AA++++ G LVK WENEVKDFNP I W +N +KK GHYTQMVWAKTKEIGCGS+KYV + 
Sbjct  121  AAVYENVGNLVKAWENEVKDFNPTISWEQNEFKKIGHYTQMVWAKTKEIGCGSIKYVDNN 180
Query  182  WYTHYLVCNYGPSGNFRNEKLYEKK 206
            WYTHYLVCNYGP+GNF N+++YE+K
Sbjct  181  WYTHYLVCNYGPAGNFGNQEVYERK 205

Sequence Alignment: 3. Allergen Name: Ves p 5 Sequence ID: P35785

 Score = 351.3 bits 1134,  Expect = 1e-98
 Identities = 152/203 74%, Positives = 178/203 87%, Gaps = 1/203 0%
Query  3    NYCKIKCLKGGVHTACKYGTSTKPNCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAKGLE 62
            NYCKIKCLKGGVHTACKYG S KPNCG  +V +YGLT+ EKQ+ILK HNDFRQK+A+GLE
Sbjct  2    NYCKIKCLKGGVHTACKYG-SLKPNCGNKIVVSYGLTKEEKQDILKEHNDFRQKIARGLE 60
Query  63   TRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYGHDTCKDTEKYPVGQNIAKRSTTA 122
            TRGNPGPQPPAKNM NLVWNDELA +AQVWA+QC YGHDTC+D  KYPVGQN+A   +TA
Sbjct  61   TRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYGHDTCRDVAKYPVGQNVALTGSTA 120
Query  123  ALFDSPGKLVKMWENEVKDFNPNIEWSKNNLKKTGHYTQMVWAKTKEIGCGSVKYVKDEW 182
              +D+P KLVKMWE+EVKD+NP  ++S+NN+ K GHYTQMVWA TKEIGCGS+KY+++EW
Sbjct  121  DKYDNPVKLVKMWEDEVKDYNPKKKFSENNFNKIGHYTQMVWANTKEIGCGSIKYIQNEW 180
Query  183  YTHYLVCNYGPSGNFRNEKLYEKK 206
            + HYLVCNYGPSGNF NE+LY+ K
Sbjct  181  HKHYLVCNYGPSGNFGNEELYQTK 204

Sequence Alignment: 4. Allergen Name: Ves f 5 Sequence ID: P35783

 Score = 348.0 bits 1123,  Expect = 1e-97
 Identities = 151/203 74%, Positives = 178/203 87%, Gaps = 1/203 0%
Query  3    NYCKIKCLKGGVHTACKYGTSTKPNCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAKGLE 62
            NYCKIKCLKGGVHTACKYG S KPNCG  VV +YGLT+ EKQ+ILK HNDFRQK+A+GLE
Sbjct  2    NYCKIKCLKGGVHTACKYG-SLKPNCGNKVVVSYGLTKQEKQDILKEHNDFRQKIARGLE 60
Query  63   TRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYGHDTCKDTEKYPVGQNIAKRSTTA 122
            TRGNPGPQPPAKNM NLVWNDELA +AQVWA+QC YGHDTC+D  KY VGQN+A   +TA
Sbjct  61   TRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYGHDTCRDIAKYQVGQNVALTGSTA 120
Query  123  ALFDSPGKLVKMWENEVKDFNPNIEWSKNNLKKTGHYTQMVWAKTKEIGCGSVKYVKDEW 182
            A +D P KLVKMWE+EVKD+NP  ++S NN+ KTGHYTQMVWA TKE+GCGS+K+++++W
Sbjct  121  AKYDDPVKLVKMWEDEVKDYNPKKKFSGNNFLKTGHYTQMVWANTKEVGCGSIKFIQEKW 180
Query  183  YTHYLVCNYGPSGNFRNEKLYEKK 206
            + HYLVCNYGPSGNF+NE+LY+ K
Sbjct  181  HKHYLVCNYGPSGNFQNEELYQTK 204

Sequence Alignment: 5. Allergen Name: Ves v 5 Sequence ID: Q05110

 Score = 347.0 bits 1120,  Expect = 3e-97
 Identities = 151/203 74%, Positives = 177/203 87%, Gaps = 1/203 0%
Query  3    NYCKIKCLKGGVHTACKYGTSTKPNCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAKGLE 62
            NYCKIKCLKGGVHTACKYG S KPNCG  VV +YGLT+ EKQ+ILK HNDFRQK+A+GLE
Sbjct  25   NYCKIKCLKGGVHTACKYG-SLKPNCGNKVVVSYGLTKQEKQDILKEHNDFRQKIARGLE 83
Query  63   TRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYGHDTCKDTEKYPVGQNIAKRSTTA 122
            TRGNPGPQPPAKNM NLVWNDELA +AQVWA+QC YGHDTC+D  KY VGQN+A   +TA
Sbjct  84   TRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYGHDTCRDVAKYQVGQNVALTGSTA 143
Query  123  ALFDSPGKLVKMWENEVKDFNPNIEWSKNNLKKTGHYTQMVWAKTKEIGCGSVKYVKDEW 182
            A +D P KLVKMWE+EVKD+NP  ++S N++ KTGHYTQMVWA TKE+GCGS+KY++++W
Sbjct  144  AKYDDPVKLVKMWEDEVKDYNPKKKFSGNDFLKTGHYTQMVWANTKEVGCGSIKYIQEKW 203
Query  183  YTHYLVCNYGPSGNFRNEKLYEKK 206
            + HYLVCNYGPSGNF NE+LY+ K
Sbjct  204  HKHYLVCNYGPSGNFMNEELYQTK 227

Sequence Alignment: 6. Allergen Name: Ves g 5 Sequence ID: P35784

 Score = 344.9 bits 1113,  Expect = 1e-96
 Identities = 151/203 74%, Positives = 176/203 86%, Gaps = 1/203 0%
Query  3    NYCKIKCLKGGVHTACKYGTSTKPNCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAKGLE 62
            NYCKIKCLKGGVHTACKY  S KPNC    V AYGLT+ EKQ+ILK HNDFRQK+A+GLE
Sbjct  2    NYCKIKCLKGGVHTACKY-ESLKPNCANKKVVAYGLTKQEKQDILKEHNDFRQKIARGLE 60
Query  63   TRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYGHDTCKDTEKYPVGQNIAKRSTTA 122
            TRGNPGPQPPAKNM NLVW+DELA IAQVWA+QC YGHDTC+D  KYPVGQN+A   +TA
Sbjct  61   TRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKYPVGQNVALTGSTA 120
Query  123  ALFDSPGKLVKMWENEVKDFNPNIEWSKNNLKKTGHYTQMVWAKTKEIGCGSVKYVKDEW 182
            A +D+P KLVKMWE+EVKD+NP  ++S+NN+ K GHYTQMVWA TKE+GCGS+KY++D+W
Sbjct  121  AKYDNPVKLVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKYIQDKW 180
Query  183  YTHYLVCNYGPSGNFRNEKLYEKK 206
            + HYLVCNYGPSGNF NE+LY+ K
Sbjct  181  HKHYLVCNYGPSGNFGNEELYQTK 204

Sequence Alignment: 7. Allergen Name: Ves m 5 Sequence ID: P35760

 Score = 343.7 bits 1109,  Expect = 2e-96
 Identities = 149/203 73%, Positives = 177/203 87%, Gaps = 1/203 0%
Query  3    NYCKIKCLKGGVHTACKYGTSTKPNCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAKGLE 62
            NYCKIKCLKGGVHTACKYG S KPNCG   V +YGLT+ EKQ+ILK HNDFRQK+A+GLE
Sbjct  2    NYCKIKCLKGGVHTACKYG-SLKPNCGNKKVVSYGLTKQEKQDILKEHNDFRQKIARGLE 60
Query  63   TRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYGHDTCKDTEKYPVGQNIAKRSTTA 122
            TRGNPGPQPPAKNM NLVW+DELA IAQVWA+QC YGHDTC+D  KY VGQN+A   +TA
Sbjct  61   TRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYGHDTCRDVAKYQVGQNVALTGSTA 120
Query  123  ALFDSPGKLVKMWENEVKDFNPNIEWSKNNLKKTGHYTQMVWAKTKEIGCGSVKYVKDEW 182
            A+++ P KLVKMWE+EVKD+NP  ++S+NN+ K GHYTQMVWA TKE+GCGS+KY+++ W
Sbjct  121  AVYNDPVKLVKMWEDEVKDYNPKKKFSENNFLKIGHYTQMVWANTKEVGCGSIKYIQENW 180
Query  183  YTHYLVCNYGPSGNFRNEKLYEKK 206
            + HYLVCNYGPSGNF+NE+LY+ K
Sbjct  181  HKHYLVCNYGPSGNFQNEELYQTK 204

Sequence Alignment: 8. Allergen Name: Dol m 5.0101 Sequence ID: P10736

 Score = 326.8 bits 1054,  Expect = 3e-91
 Identities = 144/203 70%, Positives = 165/203 81%, Gaps = 1/203 0%
Query  3    NYCKIKCLKGGVHTACKYGTSTKPNCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAKGLE 62
            NYCKIKC KG +HT CK+GTS KPNCG+ VVKAYGLT  EK EILK HNDFRQ VAKGLE
Sbjct  25   NYCKIKCRKG-IHTLCKFGTSMKPNCGRNVVKAYGLTNDEKNEILKRHNDFRQNVAKGLE 83
Query  63   TRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYGHDTCKDTEKYPVGQNIAKRSTTA 122
            TRG PGPQPPAKNMN LVWNDELA IAQ WA+QC++ HD C++T KY VGQNIA  STTA
Sbjct  84   TRGKPGPQPPAKNMNVLVWNDELAKIAQTWANQCDFNHDDCRNTAKYQVGQNIAISSTTA 143
Query  123  ALFDSPGKLVKMWENEVKDFNPNIEWSKNNLKKTGHYTQMVWAKTKEIGCGSVKYVKDEW 182
              FD P KL+K WE+EV +FN  +    +N++K GHYTQMVW KTKEIGCGS+KY++D W
Sbjct  144  TQFDRPSKLIKQWEDEVTEFNYKVGLQNSNFRKVGHYTQMVWGKTKEIGCGSIKYIEDNW 203
Query  183  YTHYLVCNYGPSGNFRNEKLYEKK 206
            YTHYLVCNYGP GN  N+ +YE+K
Sbjct  204  YTHYLVCNYGPGGNDFNQPIYERK 227

Sequence Alignment: 9. Allergen Name: Vesp v 5.0101 Sequence ID: P0DMB9

 Score = 323.8 bits 1044,  Expect = 2e-90
 Identities = 147/201 73%, Positives = 170/201 84%, Gaps = 3/201 1%
Query  3    NYCKIKCLKGGVHTACKYGTSTKPNCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAKGLE 62
            NYCKIKC + G+HT CKYGTSTKPNCG+ VVKA GLT+AEK EILK HN+FRQKVA+GLE
Sbjct  2    NYCKIKC-RSGIHTLCKYGTSTKPNCGRSVVKASGLTKAEKLEILKQHNEFRQKVARGLE 60
Query  63   TRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYGHDTCKDTEKYPVGQNIAKRSTTA 122
            TRGNPGPQPPAK+MN LVWNDELA IAQVWASQC YGHD C++T KY VGQNIA++STTA
Sbjct  61   TRGNPGPQPPAKSMNTLVWNDELAQIAQVWASQCKYGHDNCRNTAKYLVGQNIAEQSTTA 120
Query  123  ALFDSPGKLVKMWENEVKDFNPNIEWSKNNLKKTGHYTQMVWAKTKEIGCGSVKYVKDEW 182
            A F+    +VKMW +EVKD+      SKN L   GHYTQMVWAKTKEIGCG++KY+++ W
Sbjct  121  ASFEPVSNMVKMWSDEVKDYQYGS--SKNKLNDVGHYTQMVWAKTKEIGCGNIKYIENGW 178
Query  183  YTHYLVCNYGPSGNFRNEKLYEKK 206
            + HYLVCNYGP+GN  NE +YEKK
Sbjct  179  HHHYLVCNYGPAGNIGNEPIYEKK 202

Sequence Alignment: 10. Allergen Name: Vesp c 5 Sequence ID: P35781

 Score = 322.0 bits 1038,  Expect = 8e-90
 Identities = 146/201 72%, Positives = 168/201 83%, Gaps = 3/201 1%
Query  3    NYCKIKCLKGGVHTACKYGTSTKPNCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAKGLE 62
            NYCKIKC + G+HT CKYGTSTKPNCGK VVKA GLT+ E  EILK HN+FRQKVA+GLE
Sbjct  2    NYCKIKC-RSGIHTLCKYGTSTKPNCGKNVVKASGLTKQENLEILKQHNEFRQKVARGLE 60
Query  63   TRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYGHDTCKDTEKYPVGQNIAKRSTTA 122
            TRGNPGPQPPAK+MN LVWNDELA IAQVWA+QCNYGHD C+++ KY VGQNIA+ STTA
Sbjct  61   TRGNPGPQPPAKSMNTLVWNDELAQIAQVWANQCNYGHDNCRNSAKYSVGQNIAEGSTTA 120
Query  123  ALFDSPGKLVKMWENEVKDFNPNIEWSKNNLKKTGHYTQMVWAKTKEIGCGSVKYVKDEW 182
              F S   +VKMWE+EVKD+       KN L K GHYTQMVWAKTKEIGCGS+KY+++ W
Sbjct  121  DNFGSVSNMVKMWEDEVKDYQYGS--PKNKLNKVGHYTQMVWAKTKEIGCGSIKYIENGW 178
Query  183  YTHYLVCNYGPSGNFRNEKLYEKK 206
            + HYLVCNYGP+GN  NE +YE+K
Sbjct  179  HRHYLVCNYGPAGNVGNEPIYERK 202

Sequence Alignment: 11. Allergen Name: Dol a 5 Sequence ID: Q05108

 Score = 320.5 bits 1033,  Expect = 2e-89
 Identities = 140/202 69%, Positives = 169/202 83%, Gaps = 2/202 0%
Query  3    NYCKIKCLKGGVHTACKYGTSTKPNCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAKGLE 62
            NYCKI C KG  HT CKYGTS KPNCG  +VK+YG+T  EK EI+K HN+FRQKVA+GLE
Sbjct  2    NYCKI-CPKG-THTLCKYGTSMKPNCGGKIVKSYGVTNDEKNEIVKRHNEFRQKVAQGLE 59
Query  63   TRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYGHDTCKDTEKYPVGQNIAKRSTTA 122
            TRGNPGPQPPAKNMN LVWNDELA IAQ WA+QCN+GHD C++T KYPVGQN+A  STT 
Sbjct  60   TRGNPGPQPPAKNMNLLVWNDELAKIAQTWANQCNFGHDQCRNTAKYPVGQNVAIASTTG 119
Query  123  ALFDSPGKLVKMWENEVKDFNPNIEWSKNNLKKTGHYTQMVWAKTKEIGCGSVKYVKDEW 182
              + +   L+KMWE+EVKD+NP+ +   NN+ K GHYTQMVW KTKEIGCGSVKY++++W
Sbjct  120  NSYQTMSYLIKMWEDEVKDYNPHKDLMHNNFSKVGHYTQMVWGKTKEIGCGSVKYIENKW 179
Query  183  YTHYLVCNYGPSGNFRNEKLYEKK 206
            +THYLVCNYGP+GN+ N+ +YE+K
Sbjct  180  HTHYLVCNYGPAGNYMNQPVYERK 203

Sequence Alignment: 12. Allergen Name: Vesp c 5 Sequence ID: P35782

 Score = 316.5 bits 1020,  Expect = 4e-88
 Identities = 144/201 71%, Positives = 166/201 82%, Gaps = 3/201 1%
Query  3    NYCKIKCLKGGVHTACKYGTSTKPNCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAKGLE 62
            NYCKIKC + G+HT CKYGTSTKPNCGK VVKA GLT+ E  EILK HN+FRQKVA+GLE
Sbjct  2    NYCKIKC-RSGIHTLCKYGTSTKPNCGKNVVKASGLTKQENLEILKQHNEFRQKVARGLE 60
Query  63   TRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYGHDTCKDTEKYPVGQNIAKRSTTA 122
            TRGNPGPQPPAK+MN LVWNDELA IAQVWA+QCNYGHD C+++ KY VGQNIA+ ST+A
Sbjct  61   TRGNPGPQPPAKSMNTLVWNDELAQIAQVWANQCNYGHDNCRNSAKYSVGQNIAEGSTSA 120
Query  123  ALFDSPGKLVKMWENEVKDFNPNIEWSKNNLKKTGHYTQMVWAKTKEIGCGSVKYVKDEW 182
              F +   +VKMWE+EVKD+       KN L K GHYTQMVWAKTKEIGCGS  Y++D W
Sbjct  121  DNFVNVSNMVKMWEDEVKDYQYGS--PKNKLNKVGHYTQMVWAKTKEIGCGSEDYIEDGW 178
Query  183  YTHYLVCNYGPSGNFRNEKLYEKK 206
            + HYLVCNYGP+GN  NE +YE+K
Sbjct  179  HRHYLVCNYGPAGNVGNEPIYERK 202

Sequence Alignment: 13. Allergen Name: Dol m 5.02 Sequence ID: P10737

 Score = 315.2 bits 1016,  Expect = 9e-88
 Identities = 137/203 67%, Positives = 166/203 81%, Gaps = 2/203 0%
Query  3    NYCKIKCLKGGVHTACKYGTSTKPNCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAKGLE 62
            NYCKIKC +G +HT CK+GTS KPNCG  +VK +G++  EK EI+  HN FRQKVAKGLE
Sbjct  12   NYCKIKCSRG-IHTLCKFGTSMKPNCGSKLVKVHGVSNDEKNEIVNRHNQFRQKVAKGLE 70
Query  63   TRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYGHDTCKDTEKYPVGQNIAKRSTTA 122
            TRGNPGPQPPAKNMN LVWNDELA IAQ WA+QC++GHD C++TEKY VGQN+A  STT 
Sbjct  71   TRGNPGPQPPAKNMNVLVWNDELAKIAQTWANQCSFGHDQCRNTEKYQVGQNVAIASTTG 130
Query  123  ALFDSPGKLVKMWENEVKDFNPNI-EWSKNNLKKTGHYTQMVWAKTKEIGCGSVKYVKDE 181
              + +  KL++MWENEVKDFNP       NN+ K GHYTQMVW KTKEIGCGSVKY+++ 
Sbjct  131  NSYATMSKLIEMWENEVKDFNPKKGTMGDNNFSKVGHYTQMVWGKTKEIGCGSVKYIENN 190
Query  182  WYTHYLVCNYGPSGNFRNEKLYEKK 206
            W+THYLVCNYGP+GN+ ++ +YE+K
Sbjct  191  WHTHYLVCNYGPAGNYMDQPIYERK 215

Sequence Alignment: 14. Allergen Name: Vesp m 5 Sequence ID: P81657

 Score = 313.5 bits 1010,  Expect = 3e-87
 Identities = 140/201 69%, Positives = 167/201 83%, Gaps = 3/201 1%
Query  3    NYCKIKCLKGGVHTACKYGTSTKPNCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAKGLE 62
            NYCKIKC + G+HT CK+G STKPNCGK VVKA GLT+AEK EILK HN+FRQKVA+GLE
Sbjct  2    NYCKIKC-RSGIHTLCKFGISTKPNCGKNVVKASGLTKAEKLEILKQHNEFRQKVARGLE 60
Query  63   TRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYGHDTCKDTEKYPVGQNIAKRSTTA 122
            TRG PGPQPPAK+MN LVWNDELA IAQVWA QC+YGHD C++T KY VGQNIA+  +TA
Sbjct  61   TRGKPGPQPPAKSMNTLVWNDELAQIAQVWAGQCDYGHDVCRNTAKYSVGQNIAENGSTA 120
Query  123  ALFDSPGKLVKMWENEVKDFNPNIEWSKNNLKKTGHYTQMVWAKTKEIGCGSVKYVKDEW 182
            A F S   +V+MW +EVK++      +KN L + GHYTQMVWAKTKEIGCGS+KY+++ W
Sbjct  121  ASFASVSNMVQMWADEVKNYQYGS--TKNKLIEVGHYTQMVWAKTKEIGCGSIKYIENGW 178
Query  183  YTHYLVCNYGPSGNFRNEKLYEKK 206
            + HYLVCNYGP+GN  NE +YE+K
Sbjct  179  HRHYLVCNYGPAGNIGNEPIYERK 202

Sequence Alignment: 15. Allergen Name: Dol m 5.02 Sequence ID: AAA28302

 Score = 310.7 bits 1001,  Expect = 2e-86
 Identities = 135/200 67%, Positives = 163/200 81%, Gaps = 2/200 1%
Query  3    NYCKIKCLKGGVHTACKYGTSTKPNCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAKGLE 62
            NYCKIKC +G +HT CK+GTS KPNCG  +VK +G++  EK EI+  HN FRQKVAKGLE
Sbjct  12   NYCKIKCSRG-IHTLCKFGTSMKPNCGSKLVKVHGVSNDEKNEIVNRHNQFRQKVAKGLE 70
Query  63   TRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYGHDTCKDTEKYPVGQNIAKRSTTA 122
            TRGNPGPQPPAKNMN LVWNDELA IAQ WA+QC++GHD C++TEKY VGQN+A  STT 
Sbjct  71   TRGNPGPQPPAKNMNVLVWNDELAKIAQTWANQCSFGHDQCRNTEKYQVGQNVAIASTTG 130
Query  123  ALFDSPGKLVKMWENEVKDFNPNI-EWSKNNLKKTGHYTQMVWAKTKEIGCGSVKYVKDE 181
              + +  KL++MWENEVKDFNP       NN+ K GHYTQMVW KTKEIGCGSVKY+++ 
Sbjct  131  NSYATMSKLIEMWENEVKDFNPKKGTMGDNNFSKVGHYTQMVWGKTKEIGCGSVKYIENN 190
Query  182  WYTHYLVCNYGPSGNFRNEKLY 203
            W+THYLVCNYGP+GN+ ++ +Y
Sbjct  191  WHTHYLVCNYGPAGNYMDQPIY 212

Sequence Alignment: 16. Allergen Name: Pol d 5 Sequence ID: P81656

 Score = 277.1 bits 891,  Expect = 3e-76
 Identities = 129/202 63%, Positives = 155/202 76%, Gaps = 5/202 2%
Query  3    NYCKIKCLKGGVHTACKYGTSTKP--NCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAKG 60
            +YCKIKC   GVHT C+YG STKP  NC   ++K+ G TE EK+ I++ HN FRQKVAKG
Sbjct  2    DYCKIKC-SSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEHNRFRQKVAKG 60
Query  61   LETRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYG-HDTCKDTEKYPVGQNIAKRS 119
            LETRGNPGPQP A NMNNLVWNDELA IAQVWASQC    HD C++TEKY VGQNIA  +
Sbjct  61   LETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILVHDKCRNTEKYQVGQNIA-YA 119
Query  120  TTAALFDSPGKLVKMWENEVKDFNPNIEWSKNNLKKTGHYTQMVWAKTKEIGCGSVKYVK 179
             ++  F S  KL+++WENEVKDFN N   +  N+ K GHYTQMVW  TKE+GCGS+KYV+
Sbjct  120  GSSNHFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVE 179
Query  180  DEWYTHYLVCNYGPSGNFRNEKLYEKK 206
                 HYL+CNYGP+GN+  + +Y KK
Sbjct  180  KNMQIHYLICNYGPAGNYLGQPIYTKK 206

Sequence Alignment: 17. Allergen Name: Pol e 5.0101 Sequence ID: P35759

 Score = 274.9 bits 884,  Expect = 1e-75
 Identities = 129/202 63%, Positives = 158/202 78%, Gaps = 6/202 2%
Query  2    VNYCKIKCLKGGVHTACKYGTSTKP--NCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAK 59
            V+YCKIKC   G+HT C+YG STKP  NC   V+K+ G TE EK+ I+  HN FRQKVA+
Sbjct  1    VDYCKIKC-PSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQ 59
Query  60   GLETRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYG-HDTCKDTEKYPVGQNIAKR 118
            GLETRGNPGPQP A +MN+LVWNDELA+IAQVWASQC +  HD C++T KYPVGQNIA  
Sbjct  60   GLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIA-Y 118
Query  119  STTAALFDSPGKLVKMWENEVKDFNPNIEWSKNNLKKTGHYTQMVWAKTKEIGCGSVKYV 178
            +  + L D    L+K+WENEVKDFN N   +K N+ K GHYTQMVW KTKEIGCGS+KY+
Sbjct  119  AGGSKLPDVVS-LIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYI 177
Query  179  KDEWYTHYLVCNYGPSGNFRNEKLYEKK 206
            +++   HYL+CNYGP+GN+  +  Y KK
Sbjct  178  ENKMQNHYLICNYGPAGNYLGQLPYTKK 205

Sequence Alignment: 18. Allergen Name: Pol g 5 Sequence ID: P83377

 Score = 274.6 bits 883,  Expect = 1e-75
 Identities = 128/202 63%, Positives = 154/202 76%, Gaps = 5/202 2%
Query  3    NYCKIKCLKGGVHTACKYGTSTKP--NCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAKG 60
            +YCKIKC   GVHT C+YG STKP  NC   V+K+ G TE EK+ I++ HN FRQKVA+G
Sbjct  2    DYCKIKC-SSGVHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVEEHNRFRQKVAQG 60
Query  61   LETRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYG-HDTCKDTEKYPVGQNIAKRS 119
            LETRGNPGPQP A NMNNLVWNDE A IAQVWASQC    HD C++TEKY VGQNIA  +
Sbjct  61   LETRGNPGPQPAASNMNNLVWNDEQAKIAQVWASQCQILVHDKCRNTEKYQVGQNIA-YA 119
Query  120  TTAALFDSPGKLVKMWENEVKDFNPNIEWSKNNLKKTGHYTQMVWAKTKEIGCGSVKYVK 179
             ++  F S  KL+++WENEVKDFN N   +  N+ K GHYTQMVW  TKE+GCGS+KYV+
Sbjct  120  GSSNHFPSVTKLIQLWENEVKDFNYNTGITNKNFGKVGHYTQMVWGNTKEVGCGSLKYVE 179
Query  180  DEWYTHYLVCNYGPSGNFRNEKLYEKK 206
                 HYL+CNYGP+GN+  + +Y KK
Sbjct  180  KNMKIHYLICNYGPAGNYLGQPIYTKK 206

Sequence Alignment: 19. Allergen Name: Pol a 5 Sequence ID: Q05109

 Score = 273.7 bits 880,  Expect = 3e-75
 Identities = 129/202 63%, Positives = 157/202 77%, Gaps = 6/202 2%
Query  2    VNYCKIKCLKGGVHTACKYGTSTKP--NCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAK 59
            V+YCKIKC   G+HT C+YG STKP  NC   V+K+ G TE EK+ I+  HN FRQKVA+
Sbjct  5    VDYCKIKC-PSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQ 63
Query  60   GLETRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYG-HDTCKDTEKYPVGQNIAKR 118
            GLETRGNPGPQP A +MN+LVWNDELA+IAQVWASQC +  HD C++T KYPVGQNIA  
Sbjct  64   GLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIA-Y 122
Query  119  STTAALFDSPGKLVKMWENEVKDFNPNIEWSKNNLKKTGHYTQMVWAKTKEIGCGSVKYV 178
            +  + L D    L+K+WENEVKDFN N   +K N+ K GHYTQMVW KTKEIGCGS+KY+
Sbjct  123  AGGSNLPDVVS-LIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYM 181
Query  179  KDEWYTHYLVCNYGPSGNFRNEKLYEKK 206
            ++    HYL+CNYGP+GN+  +  Y KK
Sbjct  182  ENNMQNHYLICNYGPAGNYLGQLPYTKK 209

Sequence Alignment: 20. Allergen Name: Pol f 5 Sequence ID: P35780

 Score = 272.5 bits 876,  Expect = 6e-75
 Identities = 130/202 64%, Positives = 156/202 77%, Gaps = 6/202 2%
Query  2    VNYCKIKCLKGGVHTACKYGTSTKP--NCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAK 59
            V+YCKIKC   G+HT C+YG STKP  NC   V+K+ G TE EK+ I+  HN FRQKVA+
Sbjct  1    VDYCKIKC-SSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQ 59
Query  60   GLETRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYG-HDTCKDTEKYPVGQNIAKR 118
            GLETRGNPGPQP A +MNNLVWNDELA+IAQVWASQC    HD C++T KY VGQNIA  
Sbjct  60   GLETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIA-Y 118
Query  119  STTAALFDSPGKLVKMWENEVKDFNPNIEWSKNNLKKTGHYTQMVWAKTKEIGCGSVKYV 178
            +  + L D    L+K+WENEVKDFN N   +K N+ K GHYTQM+WAKTKEIGCGS+KY+
Sbjct  119  AGGSKLPDVVS-LIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAKTKEIGCGSLKYM 177
Query  179  KDEWYTHYLVCNYGPSGNFRNEKLYEKK 206
            K+    HYL+CNYGP+GN+  +  Y KK
Sbjct  178  KNNMQHHYLICNYGPAGNYLGQLPYTKK 205

Sequence Alignment: 21. Allergen Name: Pol e 5.0101 Sequence ID: AAT95009

 Score = 270.0 bits 868,  Expect = 4e-74
 Identities = 127/202 62%, Positives = 157/202 77%, Gaps = 6/202 2%
Query  2    VNYCKIKCLKGGVHTACKYGTSTKP--NCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAK 59
            V+YCKI+C   G+HT C+YG STKP  NC   V+K+ G TE EK+ I+  HN FRQKVA+
Sbjct  22   VDYCKIRC-PSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEHNRFRQKVAQ 80
Query  60   GLETRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYG-HDTCKDTEKYPVGQNIAKR 118
            GLETRGNPGPQP A +MN+LVWNDELA+IAQVWASQC +  HD C++T KYPVGQNIA  
Sbjct  81   GLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLVHDKCRNTAKYPVGQNIA-Y 139
Query  119  STTAALFDSPGKLVKMWENEVKDFNPNIEWSKNNLKKTGHYTQMVWAKTKEIGCGSVKYV 178
            +  + L D    L+K+WENEVKDFN N   +K N+ K GHYTQMVW KTKEIGCGS+KY+
Sbjct  140  AGGSKLPDVVS-LIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYM 198
Query  179  KDEWYTHYLVCNYGPSGNFRNEKLYEKK 206
            +++   HYL+CNYGP+GN+  +    KK
Sbjct  199  ENKMQNHYLICNYGPAGNYLGQLPNTKK 226

Sequence Alignment: 22. Allergen Name: Poly p 5.0101 Sequence ID: C0HJV9

 Score = 266.7 bits 857,  Expect = 4e-73
 Identities = 125/199 62%, Positives = 156/199 78%, Gaps = 9/199 4%
Query  4    YCKIKCLKGGVHTACKYGTSTKPN--CGKMVVKAYGLTEAEKQEILKVHNDFRQKVAKGL 61
            YC IKC K   HT C+YG STKP+  C K+ + + G+TE EK+ I+  HN FRQKVA+GL
Sbjct  3    YCNIKCSKVA-HTVCQYGESTKPSSKCNKVSITSVGVTEEEKKLIVDEHNRFRQKVAQGL 61
Query  62   ETRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYG-HDTCKDTEKYPVGQNIAKRST 120
            ETRGNPGPQP A +MNNLVWNDELA IAQVWASQC +  HD C++T +Y VGQNIA  ++
Sbjct  62   ETRGNPGPQPAASDMNNLVWNDELAYIAQVWASQCQFFVHDKCRNTAQYQVGQNIAYSAS 121
Query  121  TAALFDSPG--KLVKMWENEVKDFNPNIEWSKNNLKKTGHYTQMVWAKTKEIGCGSVKYV 178
            TAA    PG   L+ +WENEVKDFN +   +K N+ K GHYTQ+VWAKTKE+GCGS+KY+
Sbjct  122  TAAY---PGIVSLIVLWENEVKDFNYSQGITKENFSKVGHYTQVVWAKTKEVGCGSIKYI 178
Query  179  KDEWYTHYLVCNYGPSGNFRNEKLYEKK 206
            +    +HYLVCNYGP+GN+  + +Y KK
Sbjct  179  EKGMKSHYLVCNYGPAGNYMGQPIYTKK 206

Sequence Alignment: 23. Allergen Name: Poly p 5.0102 Sequence ID: P86686

 Score = 266.4 bits 856,  Expect = 4e-73
 Identities = 127/199 63%, Positives = 155/199 77%, Gaps = 10/199 5%
Query  4    YCKIKCLKGGVHTACKYGTSTKP---NCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAKG 60
            YC IKC K   HT C+ G STKP   NC K+ + + G+TE EK+ I+  HN FRQKVA+G
Sbjct  3    YCNIKCSKVA-HTVCQTGESTKPSSKNCAKVSITSVGVTEEEKKLIVDEHNRFRQKVAQG 61
Query  61   LETRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYG-HDTCKDTEKYPVGQNIAKRS 119
            LETRGNPGPQP A +MNNLVWNDELA IAQVWASQC +  HD C++T +Y VGQNIA  +
Sbjct  62   LETRGNPGPQPAASDMNNLVWNDELAYIAQVWASQCQFFVHDKCRNTAQYQVGQNIAYSA 121
Query  120  TTAALFDSPG--KLVKMWENEVKDFNPNIEWSKNNLKKTGHYTQMVWAKTKEIGCGSVKY 177
            +TAA    PG  KL+ +WENEVKDFN N   +K N+ K GHYTQ+VWAKTKE+GCGS+KY
Sbjct  122  STAAY---PGVVKLIVLWENEVKDFNYNTGITKENFAKVGHYTQVVWAKTKEVGCGSIKY 178
Query  178  VKDEWYTHYLVCNYGPSGNFRNEKLYEKK 206
            ++    +HYLVCNYGP+GN    ++YE K
Sbjct  179  IEKGMKSHYLVCNYGPAGNVLGAQIYEIK 207

Sequence Alignment: 24. Allergen Name: Poly s 5.0101 Sequence ID: Q7Z156

 Score = 266.4 bits 856,  Expect = 4e-73
 Identities = 125/199 62%, Positives = 156/199 78%, Gaps = 10/199 5%
Query  4    YCKIKCLKGGVHTACKYGTSTKP---NCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAKG 60
            YC IKC K   HT C+YG STKP   NC K+ + + G+TE EK+ I+  HN FRQKVA+G
Sbjct  3    YCNIKCSKVA-HTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVDEHNRFRQKVAQG 61
Query  61   LETRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYG-HDTCKDTEKYPVGQNIAKRS 119
            LETRGNPGPQP A +MNNLVWNDELA IAQVWA+QC +  HD C++T +Y VGQNIA  +
Sbjct  62   LETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQCQFFVHDKCRNTAQYQVGQNIAYSA 121
Query  120  TTAALFDSPG--KLVKMWENEVKDFNPNIEWSKNNLKKTGHYTQMVWAKTKEIGCGSVKY 177
            +TAA    PG   L+ +WENEVKDFN +   +K N+ K GHYTQ+VWAKTKE+GCGS+KY
Sbjct  122  STAAY---PGIVSLIVLWENEVKDFNYSQGITKENFAKVGHYTQVVWAKTKEVGCGSIKY 178
Query  178  VKDEWYTHYLVCNYGPSGNFRNEKLYEKK 206
            ++    +HYLVCNYGP+GN+  + +Y KK
Sbjct  179  IEKGMKSHYLVCNYGPAGNYMGQPIYTKK 207

Sequence Alignment: 25. Allergen Name: Sol i 3 Sequence ID: P35778

 Score = 214.1 bits 685,  Expect = 3e-57
 Identities = 101/200 50%, Positives = 136/200 68%, Gaps = 14/200 7%
Query  3    NYCKIKCLK--GGVHTACKYGTSTK-PNCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAK 59
            NYC ++  K    +HT C+Y + T  P C  +     G+T+AEK  I+  HN++RQ+VA 
Sbjct  24   NYCNLQSCKRNNAIHTMCQYTSPTPGPMC--LEYSNVGFTDAEKDAIVNKHNELRQRVAS 81
Query  60   GLETRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYGHDTCKDTEKYPVGQNIAKRS 119
            G E RG  GPQPPA  M NL W+ ELA IAQ WA+QC + HD C++ E++ VGQNIA  S
Sbjct  82   GKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFEHDACRNVERFAVGQNIAATS 141
Query  120  TTAALFDSPGKLVKMWENEVKDFNPNIEW-----SKNN-LKKTGHYTQMVWAKTKEIGCG 173
            ++     +P +++ +W NEVKDF+    W     S +N L K GHYTQ+VWAKT +IGCG
Sbjct  142  SSGKNKSTPNEMILLWYNEVKDFDN--RWISSFPSDDNILMKVGHYTQIVWAKTTKIGCG 199
Query  174  SVKYVK-DEWYTHYLVCNYGPSGNFRNEKLYEKK 206
             + + + D W  HYLVCNYGP+GN     +YE K
Sbjct  200  RIMFKEPDNWTKHYLVCNYGPAGNVLGAPIYEIK 233

Sequence Alignment: 26. Allergen Name: Sol r 3 Sequence ID: P35779

 Score = 213.8 bits 684,  Expect = 3e-57
 Identities = 99/200 49%, Positives = 133/200 66%, Gaps = 13/200 6%
Query  3    NYCKIKCLK--GGVHTACKYGTSTK-PNCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAK 59
            NYC ++  K    +HT C+Y + T  P C  +     G+T+AEK  I+  HN++RQ+VA 
Sbjct  2    NYCNLQSCKRNNAIHTMCQYTSPTPGPMC--LEYSNVGFTDAEKDAIVNKHNELRQRVAS 59
Query  60   GLETRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYGHDTCKDTEKYPVGQNIAKRS 119
            G E RG  GPQPPA  M NL W+ ELA IAQ WA+QC + HD C++ E++ VGQNIA  S
Sbjct  60   GKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFEHDACRNVERFAVGQNIAATS 119
Query  120  TTAALFDSPGKLVKMWENEVKDFNPNIEW------SKNNLKKTGHYTQMVWAKTKEIGCG 173
            ++     +   ++ +W NEVKDF+    W        N L   GHYTQ+VWAKTK+IGCG
Sbjct  120  SSGKNKSTLSDMILLWYNEVKDFDN--RWISSFPSDGNILMHVGHYTQIVWAKTKKIGCG 177
Query  174  SVKYVKDEWYTHYLVCNYGPSGNFRNEKLYEKK 206
             + + +D W  HYLVCNYGP+GN    ++YE K
Sbjct  178  RIMFKEDNWNKHYLVCNYGPAGNVLGAQIYEIK 210

Sequence Alignment: 27. Allergen Name: Pac c 3.0101 Sequence ID: C0ITL3

 Score = 206.2 bits 659,  Expect = 6e-55
 Identities = 96/191 50%, Positives = 127/191 66%, Gaps = 7/191 3%
Query  12   GGVHTACKYGT-STKPNCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAKGLETRGNPGPQ 70
            G VHT C+Y +    PNCG        +T A+K+ ILKVHND RQKV  G ETRGNPGPQ
Sbjct  4    GAVHTMCQYTSPQPSPNCG--TYSNAHITAADKETILKVHNDERQKVKAGQETRGNPGPQ 61
Query  71   PPAKNMNNLVWNDELANIAQVWASQCNYGHDTCKDTEKYPVGQNIAKRSTTAALFDSPGK 130
            P A NM +L W++ELA IAQ W +QC  GHD C++ E+Y VGQNIA   +TA    +   
Sbjct  62   PAASNMPDLTWDNELAAIAQRWVNQCKIGHDGCRNVERYQVGQNIAMSGSTAKGPCNMNN 121
Query  131  LVKMWENEVKDFNP----NIEWSKNNLKKTGHYTQMVWAKTKEIGCGSVKYVKDEWYTHY 186
            LV+MW NEV  +N     ++    N + K GHYTQ+VW KT ++GCG ++++  ++Y  Y
Sbjct  122  LVQMWINEVNALNAADVSSMPSDGNYFMKIGHYTQLVWGKTTKVGCGIIQFLDGKFYKCY 181
Query  187  LVCNYGPSGNFRNEKLYE 204
            L CNYGP+GN     +Y+
Sbjct  182  LACNYGPAGNMFGAPIYQ 199

Sequence Alignment: 28. Allergen Name: Sco m 5.0101 Sequence ID: QEA69430

 Score = 113.0 bits 354,  Expect = 7e-27
 Identities = 69/161 42%, Positives = 94/161 58%, Gaps = 16/161 9%
Query  33   VKAYGLTEAEKQEILKVHNDFRQKVAKGLETRGNPGPQPPAKNMNNLVWNDELANIAQVW 92
            +K  GL    K+ IL +HN  RQ VA G ++ G    QP A NM  L W+D++A  AQ  
Sbjct  26   MKVRGLDANMKKMILDLHNKKRQTVANGQQS-G----QPSAANMKELHWDDQIAANAQRS 80
Query  93   ASQCNYGHDT--CKDTEKYP-VGQNIAKRSTTAALFDSPGKLVKMWENEVKDFNPNIEWS 149
            A  C + H     + T KY  +G+NI   S      D   + V  W +EVKD  P +  S
Sbjct  81   AETCVFQHTAKNLRKTSKYSYLGENIYMGSYP----DPIPRSVNAWYDEVKDVTPAVVKS 136
Query  150  -KNNLKKTGHYTQMVWAKTKEIGCGSVKYVKDEWYTHYLVCNYGPSGNFRNEKLYEK 205
             ++     GHYTQMVWA T+ +GCG V    D+    Y+ C YGPSGN+  E +Y++
Sbjct  137  FRSGGPMIGHYTQMVWANTEALGCGLVT-ASDK--NTYIFCQYGPSGNYPGEPIYKQ 190

Sequence Alignment: 29. Allergen Name: Sol s 3.0101 Sequence ID: ABC58726

 Score = 87.0 bits 267,  Expect = 2e-19
 Identities = 42/86 48%, Positives = 56/86 65%, Gaps = 5/86 5%
Query  3    NYCKIK-CLKGG-VHTACKYGTSTK-PNCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAK 59
            NYC ++ C +   +HT C+Y + T  P C  +     G+T+AEK  I+  HN++RQ+VA 
Sbjct  2    NYCNLQSCKRNNAIHTMCQYTSPTPGPMC--LEYSNVGFTDAEKDAIVNKHNELRQRVAS 59
Query  60   GLETRGNPGPQPPAKNMNNLVWNDELANIAQ 90
            G E RG   PQPPA  M NL W+ ELA IAQ
Sbjct  60   GKEMRGTNSPQPPAVKMPNLTWDPELATIAQ 90

Sequence Alignment: 30. Allergen Name: Cte f 2 Sequence ID: AAF65314

 Score = 86.9 bits 269,  Expect = 6e-19
 Identities = 70/195 35%, Positives = 94/195 48%, Gaps = 23/195 11%
Query  3    NYCKIKCLKGGVHTACKYGTSTKPNCGK--MVVKAYGLTEAEKQEILKVHNDFRQKVAKG 60
            +YC + C  G  +  C     TKP+  +     K   +TE  K+  L  HN  R+ VA G
Sbjct  33   DYCNLNCTNGP-NVGC-----TKPDVPRDCQNFKLVNITERMKKAFLNAHNRKRRLVAAG 86
Query  61   LETRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYGHDTCKDTEKYPVGQNIAKRST 120
                 +    P A  M NL WN  LA +A+    QC   HD C  T     GQN+    T
Sbjct  87   KGLLKDGVHTPIAAKMPNLTWNIALAKLAEYNVKQCEMKHD-CAKTRHGHTGQNLFFYGT 145
Query  121  TAALFDSPGKLVKM----WENEVKDFN-PNIEWSKN---NLKKTGHYTQMVWAKTKEIGC 172
            T +   +   + KM    W  E KD    +I+       N K  GHYTQ++W  T ++GC
Sbjct  146  TLSPIKN-STIAKMAVDGWYAESKDTRLEDIKKLTTIYPNGKPIGHYTQLIWGNTTKVGC 204
Query  173  GSVKYVKD---EWYTHYLV-CNYGPSGNFRNEKLYEKK 206
                Y K      +   LV CNY   GN   E +Y+ K
Sbjct  205  AVSTYKKHSNGNMFNMTLVACNYR-GGNMLEEAVYQIK 241

Sequence Alignment: 31. Allergen Name: Glo m 5 Sequence ID: AAF82096

 Score = 81.1 bits 250,  Expect = 3e-17
 Identities = 58/181 32%, Positives = 90/181 49%, Gaps = 20/181 11%
Query  3    NYCKIKCLKGGVHTACKYGTSTKPNCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAKGLE 62
            +YC + C     H AC      +  C     K   L + +   +L  HN  R  VA G E
Sbjct  21   DYCGL-CDN---HDACVMQNVFQSGCPSGA-KMIDLNKYQSA-LLDAHNKKRNHVAGGGE 74
Query  63   TRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYGHDTCKDTEKYP-VGQNIAKRSTT 121
            ++        A  M  + W+ ELA +A+    QC   HD C++T K+   GQN+A+   +
Sbjct  75   SK-----LKRACQMATMKWDSELAKLAEYNVKQCQMNHDRCRNTVKFKYAGQNLAELGRS 129
Query  122  AALFDSPGKLVKM----WENEVKDFNPN-IEWSKNNLK--KTGHYTQMVWAKTKEIGCGS 174
                    KL++     W  EVKD N   I+    N +    GH+T MV  +   +GC +
Sbjct  130  GGPPPDYRKLIEKAVDKWYEEVKDCNQGYIDSYPMNYRGPAIGHFTVMVAERNTHVGCAA 189
Query  175  VKYVKDEWYTHYLV-CNYGPS 194
             +Y K   + ++L+ CNY  +
Sbjct  190  SEYTKSNGFQYFLMACNYATT 210

Sequence Alignment: 32. Allergen Name: Sol g 3.0101 Sequence ID: AAY32926

 Score = 79.2 bits 241,  Expect = 3e-17
 Identities = 34/56 60%, Positives = 41/56 73%, Gaps = 1/56 1%
Query  151  NNLKKTGHYTQMVWAKTKEIGCGSVKYVK-DEWYTHYLVCNYGPSGNFRNEKLYEKK 206
            N L K GHYTQ+VWAKT +IGCG + + + D W  HYLVCNYGP+GN    K+YE K
Sbjct  13   NILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNVLGAKIYEIK 69

Sequence Alignment: 33. Allergen Name: Cyn d 24.0101 Sequence ID: AAU15051

 Score = 62.8 bits 189,  Expect = 6e-12
 Identities = 53/141 37%, Positives = 75/141 53%, Gaps = 27/141 19%
Query  37   GLTEAEKQEILKVHNDFRQKVAKGLETRGNPGPQPPAKNMNNLVWNDELANIAQVWASQC 96
            GL +   Q+IL  HN FR K              PP      L WN  LA  +Q +A + 
Sbjct  12   GLNDKAIQDILNEHNMFRAKEHV-----------PP------LTWNTTLAKFSQDYA-ES 53
Query  97   NYGHDTCKDTEK-YPVGQNIAKRSTTAALFDSPGKLVKMWENEVKDFNPNIEWSKNNLKK 155
                D CK      P G+N+   S   A+  S    V  W +E K ++     + +  K 
Sbjct  54   KLKKD-CKMVHSDSPYGENLMFGS--GAI--SWKTTVDTWSDEKKSYHYGSN-TCDQGKM 107
Query  156  TGHYTQMVWAKTKEIGCGSVKYVKDEWYTHYLVCNYGPSGNFRNEKLY 203
             GHYT +VW  T  +GCG V  + D+     ++C+Y P GN+ N+K Y
Sbjct  108  CGHYTAVVWKDTTSVGCGRV--LCDDKKDTMIMCSYWPPGNYENQKPY 153

Sequence Alignment: 34. Allergen Name: Art la 2.0101 Sequence ID: AVD29826

 Score = 60.9 bits 183,  Expect = 3e-11
 Identities = 53/123 43%, Positives = 76/123 61%, Gaps = 35/123 28%
Query  62   ETRGNPGPQPP----AKN-------MNNLVWNDELANIAQVWAS----QCNYGH-DTCKD 105
            ET G PG  P     A N       M  L W+DELA +AQ WA      C+  H D C  
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLIHSDRC-- 82
Query  106  TEKYPVGQNIAKRSTTAALFDSPGKLVKMWENEVKDFNPNIEWSKNNLKKTGHYTQMVWA 165
                  G+N+A+ +   ++       V++W +E  D++ N       +K  GHYTQ+VWA
Sbjct  83   ------GENMAQGAINGSM------AVQLWLDERLDYDYN---ENKCIKMCGHYTQIVWA 127
Query  166  KTKEIGCGSVKYVKDEWYTHYLVCNYGPSGNFRNEKLY 203
             ++ +GCG      + W  + +VCNY P GN   +K Y
Sbjct  128  NSERVGCGRA-LCSNGW-AYIIVCNYDPPGNVVGQKPY 163

Sequence Alignment: 35. Allergen Name: Art ar 2.0101 Sequence ID: A0A2L1DGQ3

 Score = 60.9 bits 183,  Expect = 3e-11
 Identities = 53/123 43%, Positives = 76/123 61%, Gaps = 35/123 28%
Query  62   ETRGNPGPQPP----AKN-------MNNLVWNDELANIAQVWAS----QCNYGH-DTCKD 105
            ET G PG  P     A N       M  L W+DELA +AQ WA      C+  H D C  
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLIHSDRC-- 82
Query  106  TEKYPVGQNIAKRSTTAALFDSPGKLVKMWENEVKDFNPNIEWSKNNLKKTGHYTQMVWA 165
                  G+N+A+ +   ++       V++W +E  D++ N       +K  GHYTQ+VWA
Sbjct  83   ------GENMAQGAINGSM------AVQLWLDERLDYDYN---ENKCIKMCGHYTQIVWA 127
Query  166  KTKEIGCGSVKYVKDEWYTHYLVCNYGPSGNFRNEKLY 203
             ++ +GCG      + W  + +VCNY P GN   +K Y
Sbjct  128  NSERVGCGRA-LCSNGW-AYIIVCNYDPPGNVVGQKPY 163

Sequence Alignment: 36. Allergen Name: Art si 2.0101 Sequence ID: AVD29827

 Score = 60.9 bits 183,  Expect = 3e-11
 Identities = 53/123 43%, Positives = 77/123 62%, Gaps = 35/123 28%
Query  62   ETRGNPGPQPP----AKN-------MNNLVWNDELANIAQVWA----SQCNYGH-DTCKD 105
            ET G PG  P     A N       M  L W+DELA +AQ WA    + C+  H D C  
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAEARTADCSLVHSDRC-- 82
Query  106  TEKYPVGQNIAKRSTTAALFDSPGKLVKMWENEVKDFNPNIEWSKNNLKKTGHYTQMVWA 165
                  G+N+A+ +   ++       V++W +E  D++ N       +K  GHYTQ+VWA
Sbjct  83   ------GENMAQGAINGSM------AVQLWLDERLDYDYN---ENKCIKMCGHYTQIVWA 127
Query  166  KTKEIGCGSVKYVKDEWYTHYLVCNYGPSGNFRNEKLY 203
             ++ +GCG      + W  + +VCNY P GN   +K Y
Sbjct  128  NSERVGCGRA-LCSNGW-AYIIVCNYDPPGNVVGQKPY 163

Sequence Alignment: 37. Allergen Name: Art an 2.0101 Sequence ID: AVD29822

 Score = 60.9 bits 183,  Expect = 3e-11
 Identities = 54/123 43%, Positives = 75/123 60%, Gaps = 35/123 28%
Query  62   ETRGNPGPQPP----AKN-------MNNLVWNDELANIAQVWAS----QCNYGH-DTCKD 105
            ET G PG  P     A N       M  L W+DELA +AQ WA      C+  H D C  
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLVHSDRC-- 82
Query  106  TEKYPVGQNIAKRSTTAALFDSPGKLVKMWENEVKDFNPNIEWSKNNLKKTGHYTQMVWA 165
                  G+N+A+ +   ++       V++W +E  D++ N       +K  GHYTQ+VWA
Sbjct  83   ------GENMAQGAINGSM------AVQLWLDERLDYDYN---ENKCIKMCGHYTQIVWA 127
Query  166  KTKEIGCGSVKYVKDEWYTHYLVCNYGPSGNFRNEKLY 203
             T+ +GCG      + W  +  VCNY P GN   +K Y
Sbjct  128  NTERVGCGRA-LCSNGW-AYITVCNYDPPGNVVGQKPY 163

Sequence Alignment: 38. Allergen Name: Art ca 2.0101 Sequence ID: AVD29824

 Score = 60.9 bits 183,  Expect = 3e-11
 Identities = 52/122 42%, Positives = 75/122 61%, Gaps = 35/122 28%
Query  63   TRGNPGPQPP----AKN-------MNNLVWNDELANIAQVWAS----QCNYGH-DTCKDT 106
            T G PG  P     A N       M  L W+DELA +AQ WA      C+  H D C   
Sbjct  26   TYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLIHSDRC--- 82
Query  107  EKYPVGQNIAKRSTTAALFDSPGKLVKMWENEVKDFNPNIEWSKNNLKKTGHYTQMVWAK 166
                 G+N+A+ +   ++       V++W +E  D++ N       +K  GHYTQ+VWA 
Sbjct  83   -----GENMAQGAINGSM------AVQLWLDERLDYDYN---ENKCIKMCGHYTQIVWAN 128
Query  167  TKEIGCGSVKYVKDEWYTHYLVCNYGPSGNFRNEKLY 203
            ++ +GCG      + W  + +VCNY P GN   +K Y
Sbjct  129  SERVGCGRA-LCSNGW-AYIIVCNYDPPGNVVGQKPY 163

Sequence Alignment: 39. Allergen Name: Art gm 2.0101 Sequence ID: AVD29825

 Score = 60.9 bits 183,  Expect = 3e-11
 Identities = 54/123 43%, Positives = 75/123 60%, Gaps = 35/123 28%
Query  62   ETRGNPGPQPP----AKN-------MNNLVWNDELANIAQVWAS----QCNYGH-DTCKD 105
            ET G PG  P     A N       M  L W+DELA +AQ WA      C+  H D C  
Sbjct  25   ETYGEPGNTPDDYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLVHSDRC-- 82
Query  106  TEKYPVGQNIAKRSTTAALFDSPGKLVKMWENEVKDFNPNIEWSKNNLKKTGHYTQMVWA 165
                  G+N+A+ +   ++       V++W +E  D++ N       +K  GHYTQ+VWA
Sbjct  83   ------GENMAQGAINGSM------AVQLWLDERLDYDYN---ENKCIKMCGHYTQIVWA 127
Query  166  KTKEIGCGSVKYVKDEWYTHYLVCNYGPSGNFRNEKLY 203
             T+ +GCG      + W  +  VCNY P GN   +K Y
Sbjct  128  NTERVGCGRA-LCSNGW-AYITVCNYDPPGNVVGQKPY 163

Sequence Alignment: 40. Allergen Name: Tab y 5.0101 Sequence ID: ADM18345

 Score = 56.7 bits 170,  Expect = 8e-10
 Identities = 53/189 28%, Positives = 92/189 48%, Gaps = 25/189 13%
Query  2    VNYCKIKCLKG-GVHTAC-KYGTSTKPNCGKMVVKAYGLTEAEKQEILKVHNDFRQKVAK 59
            ++YC + C  G G H  C   G S+  +CG+   +   +T+  K+ IL   ND R  VAK
Sbjct  24   LDYCSL-CRGGRGEHVGCGSPGFSS--DCGQKA-RTRKFTKEHKKVILDKINDVRDHVAK 79
Query  60   GLETRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYGHDTCKDTEKY--PVGQNIA- 116
            G  + G     P A  M  +VW++ELA +A+     C      C+ T ++  P   N   
Sbjct  80   G--SWG----LPVASRMKVIVWDEELAALAKRHTQGCVPEAYKCRHTLRFWSPGQLNFEF 133
Query  117  ---KRSTTAALFDSPGKLVKMWENEV-KDFNPNIEWS--KNNLKKTGHYTQMVWAKTKEI 170
               K  +T +L  +  K     ++ + +D     + +  K N+K+       +  +   +
Sbjct  134  YADKMPSTMSLISTAIKRGHTQKHNITRDIIEKYQPAGPKGNVKEL---ALAISDRVTAV 190
Query  171  GCGSVKYVKDEWYTHYLVCNYGPSGNFRNEKLYE 204
            GCG   +         L CN+    ++ N  +Y+
Sbjct  191  GCGLTTWKLGGKARALLTCNFSSENDY-NRPVYK 223

Sequence Alignment: 41. Allergen Name: Pol m 5.0101 Sequence ID: 7065471

 Score = 53.3 bits 155,  Expect = 1e-09
 Identities = 22/35 62%, Positives = 27/35 77%, Gaps = 3/35 8%
Query  2    VNYCKIKCLKGGVHTACKYGTSTKP--NCGKMVVKAYG 37
            V+YCKIKC   G+HT C+YG STKP  NC   V+K+ G
Sbjct  1    VDYCKIKC-SSGIHTVCQYGESTKPSKNCADKVIKSVG 37

Sequence Alignment: 42. Allergen Name: Pru p 9.0101 Sequence ID: XP_007199020

 Score = 47.2 bits 138,  Expect = 3e-07
 Identities = 40/108 37%, Positives = 57/108 52%, Gaps = 22/108 20%
Query  79   LVWNDELANIAQVWASQ----CNYGHDTCKDTEKYPVGQNIAKRSTTAALFDSPGKLVKM 134
            L WN  LA  AQ +A +    C   H   +  E    G  ++  + T           K 
Sbjct  49   LKWNTTLAQYAQEYADKRVGDCAMEHSMGRWGENLASGDGMSGAAAT-----------KY 97
Query  135  WENEVKDFNPNIEWSKNNLK-KTGHYTQMVWAKTKEIGCGSVKYVKDEWYTHYLVCNYGP 193
            W  E K+F    E S   +K + GHY  +VW KT E+GCG  K    +   +Y+VC+Y P
Sbjct  98   WVTE-KEFYD--EKSNKCVKDECGHYLAVVWGKTTEVGCGISKCNNGQ---NYVVCSYDP 151
Query  194  SGNFRNEKLY 203
                 +E+ Y
Sbjct  152  MYQPEDERPY 161

Sequence Alignment: 43. Allergen Name: Poly p 2.0101 Sequence ID: P86687

 Score = 33.4 bits 94,  Expect = 0.009
 Identities = 41/141 29%, Positives = 66/141 46%, Gaps = 28/141 19%
Query  44   QEILKVHNDFRQKVAKGLE--------TRGNPGPQPPAKNMNNLVWNDELA---NIAQVW 92
            +E LK+    R++   G          T  NPGP   AK M   + ND L+   N  ++ 
Sbjct  119  EETLKLAKKTRKRAKWGYYGFPYCYNYTPNNPGPDCDAKAM---IENDRLSWMYNNQEIL 175
Query  93   ASQCNYGHDTCKDTEKYPVGQNIAKR-STTAALFDSPGKLVKMWENEVKDFNPNIEWSKN 151
                   H+   D   Y V   I +    +  L  SP K++  W    +D   +I  S+ 
Sbjct  176  FPSVYVRHELTPDQRVYLVQGRIKEAVRISNNLKHSP-KVLSYWWYVYQD-KMDIFLSET 233
Query  152  NLKKT-------GHYTQMVWAKTKEIGCGSVKYVKDEWYTHYLVCNYGP 193
            ++KKT       G    ++W  + ++   S    K +    YL+   GP
Sbjct  234  DVKKTFQEIVTNGGDGIIIWGSSSDVNSLS----KCKRLREYLLNTLGP 278

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.