The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

KYHNPHFIGNRSVITHLMEWKYDDIGDECERFLGPYGYGGVQVSPVNEHAILDRRPWYER
YQPVSYDIRTRSGDEQQFRRMVKRCNKAGVRIYVDIVLNHMTGAQSGKGTNGHHYDGNTL
QYPGVPFGPNDFHGHESCPTQDLEIHDYTNPKEARNCRLSGLRDLKQQSEYVRQKQVDFL
NHLIDIGVAGFRSDASTHQWPDDLRSIYSRLHNLNKEFFPENSQPFIYHETIYYGGNGIN
SNEYTSLGRIIEFRFYKEITNVFRGNNPLHWLKNFGTEWGLVPSGDALVMIDSHDLRVGH
TGKLGFNINCFEGRLLKAATAFMLAWNYGVPRVMSSYFWNQIIKDGKDVNDWVGPPSDKN
GNILSVHPNPDMTCNHEWICEHRWREIYNMVKFRMIAGQEPVHNWWDNGDYQIAFSRGNR
AFIAINLQKNQQNLQQKLHTGLPAGTYCDIISGNLIDNKCTGKSIHVDKNGQADVYVGHD
EFDAFVAYHIGARIVS
Sequence Info Allergen Name Length Opt Bits Score E Value
AAD38942 Der p 4 496 3532 811.4 0
AAD38943 Eur m 4.0101 521 3224 741.1 3.3e-215
AHX03180 Der f 4.0101 525 3180 731.1 3.5e-212
AAQ24543 Blo t 4.0101 506 2512 578.9 2.3e-166
Q2L7A6 Bla g 11.0101 515 1276 297.1 1.5e-81
AKH04310 Per a 11.0101 494 438 106.1 4.6e-24
P13080 Aed a 4.0101 579 177 46.6 4.5e-06
P49274 Der p 4 19 104 33.8 0.001
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Der p 4 Sequence ID: AAD38942

 Score = 811.4 bits 3532,  Expect = 0
 Identities = 496/496 100%, Positives = 496/496 100%, Gaps = 0/496 0%
Query  1    KYHNPHFIGNRSVITHLMEWKYDDIGDECERFLGPYGYGGVQVSPVNEHAILDRRPWYER 60
            KYHNPHFIGNRSVITHLMEWKYDDIGDECERFLGPYGYGGVQVSPVNEHAILDRRPWYER
Sbjct  1    KYHNPHFIGNRSVITHLMEWKYDDIGDECERFLGPYGYGGVQVSPVNEHAILDRRPWYER 60
Query  61   YQPVSYDIRTRSGDEQQFRRMVKRCNKAGVRIYVDIVLNHMTGAQSGKGTNGHHYDGNTL 120
            YQPVSYDIRTRSGDEQQFRRMVKRCNKAGVRIYVDIVLNHMTGAQSGKGTNGHHYDGNTL
Sbjct  61   YQPVSYDIRTRSGDEQQFRRMVKRCNKAGVRIYVDIVLNHMTGAQSGKGTNGHHYDGNTL 120
Query  121  QYPGVPFGPNDFHGHESCPTQDLEIHDYTNPKEARNCRLSGLRDLKQQSEYVRQKQVDFL 180
            QYPGVPFGPNDFHGHESCPTQDLEIHDYTNPKEARNCRLSGLRDLKQQSEYVRQKQVDFL
Sbjct  121  QYPGVPFGPNDFHGHESCPTQDLEIHDYTNPKEARNCRLSGLRDLKQQSEYVRQKQVDFL 180
Query  181  NHLIDIGVAGFRSDASTHQWPDDLRSIYSRLHNLNKEFFPENSQPFIYHETIYYGGNGIN 240
            NHLIDIGVAGFRSDASTHQWPDDLRSIYSRLHNLNKEFFPENSQPFIYHETIYYGGNGIN
Sbjct  181  NHLIDIGVAGFRSDASTHQWPDDLRSIYSRLHNLNKEFFPENSQPFIYHETIYYGGNGIN 240
Query  241  SNEYTSLGRIIEFRFYKEITNVFRGNNPLHWLKNFGTEWGLVPSGDALVMIDSHDLRVGH 300
            SNEYTSLGRIIEFRFYKEITNVFRGNNPLHWLKNFGTEWGLVPSGDALVMIDSHDLRVGH
Sbjct  241  SNEYTSLGRIIEFRFYKEITNVFRGNNPLHWLKNFGTEWGLVPSGDALVMIDSHDLRVGH 300
Query  301  TGKLGFNINCFEGRLLKAATAFMLAWNYGVPRVMSSYFWNQIIKDGKDVNDWVGPPSDKN 360
            TGKLGFNINCFEGRLLKAATAFMLAWNYGVPRVMSSYFWNQIIKDGKDVNDWVGPPSDKN
Sbjct  301  TGKLGFNINCFEGRLLKAATAFMLAWNYGVPRVMSSYFWNQIIKDGKDVNDWVGPPSDKN 360
Query  361  GNILSVHPNPDMTCNHEWICEHRWREIYNMVKFRMIAGQEPVHNWWDNGDYQIAFSRGNR 420
            GNILSVHPNPDMTCNHEWICEHRWREIYNMVKFRMIAGQEPVHNWWDNGDYQIAFSRGNR
Sbjct  361  GNILSVHPNPDMTCNHEWICEHRWREIYNMVKFRMIAGQEPVHNWWDNGDYQIAFSRGNR 420
Query  421  AFIAINLQKNQQNLQQKLHTGLPAGTYCDIISGNLIDNKCTGKSIHVDKNGQADVYVGHD 480
            AFIAINLQKNQQNLQQKLHTGLPAGTYCDIISGNLIDNKCTGKSIHVDKNGQADVYVGHD
Sbjct  421  AFIAINLQKNQQNLQQKLHTGLPAGTYCDIISGNLIDNKCTGKSIHVDKNGQADVYVGHD 480
Query  481  EFDAFVAYHIGARIVS 496
            EFDAFVAYHIGARIVS
Sbjct  481  EFDAFVAYHIGARIVS 496

Sequence Alignment: 2. Allergen Name: Eur m 4.0101 Sequence ID: AAD38943

 Score = 741.1 bits 3224,  Expect = 3e-215
 Identities = 447/494 90%, Positives = 477/494 96%, Gaps = 1/494 0%
Query  1    KYHNPHFIGNRSVITHLMEWKYDDIGDECERFLGPYGYGGVQVSPVNEHAILDRRPWYER 60
            KYHNPHFIGNR VITHLMEWKYDDIGDECERFLGPYGYGGVQVSPVNEHAILDRRPWYER
Sbjct  26   KYHNPHFIGNRCVITHLMEWKYDDIGDECERFLGPYGYGGVQVSPVNEHAILDRRPWYER 85
Query  61   YQPVSYDIRTRSGDEQQFRRMVKRCNKAGVRIYVDIVLNHMTGAQSGKGTNGHHYDGNTL 120
            YQPVSYD+RTRSGDEQQFRRMVKRCNKAGVRIYVDIVLNHMTG QSG+GTNG+HY+G T+
Sbjct  86   YQPVSYDLRTRSGDEQQFRRMVKRCNKAGVRIYVDIVLNHMTGGQSGQGTNGNHYNGITM 145
Query  121  QYPGVPFGPNDFHGHESCPTQDLEIHDYTNPKEARNCRLSGLRDLKQQSEYVRQKQVDFL 180
            QYPGVPFGPNDFHGHESC T+DLEIH+Y++  EARNCRLSGLRDLKQQSEYVR+KQVDFL
Sbjct  146  QYPGVPFGPNDFHGHESCQTKDLEIHNYSDRNEARNCRLSGLRDLKQQSEYVRKKQVDFL 205
Query  181  NHLIDIGVAGFRSDASTHQWPDDLRSIYSRLHNLNKEFFPENSQPFIYHETIYYGGNGIN 240
            NHLIDIGVAGFRSDASTHQWPDDLRSIYS+LH LNKEFFPENS+PFIYHETIYYGGNGIN
Sbjct  206  NHLIDIGVAGFRSDASTHQWPDDLRSIYSQLHTLNKEFFPENSHPFIYHETIYYGGNGIN 265
Query  241  SNEYTSLGRIIEFRFYKEITNVFRGNNPLHWLKNFGTEWGLVPSGDALVMIDSHDLRVGH 300
            SNEYTSLGRIIEFRFYKEITNVFRGNN L WLKNFGTEWGLVPS DALVMIDSHDLRVGH
Sbjct  266  SNEYTSLGRIIEFRFYKEITNVFRGNNQLRWLKNFGTEWGLVPSNDALVMIDSHDLRVGH 325
Query  301  TGKLGFNINCFEGRLLKAATAFMLAWNYGVPRVMSSYFWNQIIKDGKDVNDWVGPPSDKN 360
            TGKLGFNINCFE RLLKA+TAFMLAWNYG+PRVMSSYFWNQII+DGKDVNDWVGPP+D++
Sbjct  326  TGKLGFNINCFEARLLKASTAFMLAWNYGIPRVMSSYFWNQIIRDGKDVNDWVGPPTDQH 385
Query  361  GNILSVHPNPDMTCNHEWICEHRWREIYNMVKFRMIAGQEPVHNWWDNGDYQIAFSRGNR 420
            GNILSVHPN D+TCNHEWICEHRWR+IYNMV+F+MIAGQEPV NWWDNGDYQIAFSRG+ 
Sbjct  386  GNILSVHPNADLTCNHEWICEHRWRQIYNMVRFKMIAGQEPVRNWWDNGDYQIAFSRGSH 445
Query  421  AFIAINLQKN-QQNLQQKLHTGLPAGTYCDIISGNLIDNKCTGKSIHVDKNGQADVYVGH 479
            AFIAINLQKN  +NL+Q+LHTGLPAGTYCDIISG+LI NKCTGKSI+VDKNG AD+YVGH
Sbjct  446  AFIAINLQKNGDKNLRQRLHTGLPAGTYCDIISGDLIHNKCTGKSIQVDKNGLADIYVGH 505
Query  480  DEFDAFVAYHIGARI 494
            DE+DAFVAYHIGARI
Sbjct  506  DELDAFVAYHIGARI 520

Sequence Alignment: 3. Allergen Name: Der f 4.0101 Sequence ID: AHX03180

 Score = 731.1 bits 3180,  Expect = 3e-212
 Identities = 441/496 88%, Positives = 471/496 94%, Gaps = 4/496 0%
Query  1    KYHNPHFIGNRSVITHLMEWKYDDIGDECERFLGPYGYGGVQVSPVNEHAILDRRPWYER 60
            K+ NPHFIGNRSVITHLMEWKYDDIGDECERFLGPYGYGGVQVSPVNEHAI+D RPWYER
Sbjct  26   KFSNPHFIGNRSVITHLMEWKYDDIGDECERFLGPYGYGGVQVSPVNEHAIMDGRPWYER 85
Query  61   YQPVSYDIRTRSGDEQQFRRMVKRCNKAGVRIYVDIVLNHMTGAQSGKGTNGHHYDGNTL 120
            YQPVSYDI TRSGDEQQFRRMV+RCNKAGVRIYVDIVLNHMTG QSG GTNGHHYDG  +
Sbjct  86   YQPVSYDIHTRSGDEQQFRRMVQRCNKAGVRIYVDIVLNHMTGGQSGLGTNGHHYDGVAM 145
Query  121  QYPGVPFGPNDFHGHESCPTQDLEIHDYTNPKEARNCRLSGLRDLKQQSEYVRQKQVDFL 180
            QYPGVPFGPNDFHGHE+CPT DLEIH+Y+N  EARNCRL GLRDLKQQSEYV+QKQVDFL
Sbjct  146  QYPGVPFGPNDFHGHETCPTNDLEIHNYSNRIEARNCRLVGLRDLKQQSEYVKQKQVDFL 205
Query  181  NHLIDIGVAGFRSDASTHQWPDDLRSIYSRLHNLNKEFFPENSQPFIYHETIYYGGNGIN 240
            NHLIDIGVAGFRSDASTHQWPDDLRSIYSRLHNLN EFF ENS+PFIYHETIYYGGNGIN
Sbjct  206  NHLIDIGVAGFRSDASTHQWPDDLRSIYSRLHNLNNEFFTENSHPFIYHETIYYGGNGIN 265
Query  241  SNEYTSLGRIIEFRFYKEITNVFRGNNPLHWLKNFGTEWGLVPSGDALVMIDSHDLRVGH 300
            SNEYTSLGRIIEFRFYKEITNVFR NN L WL+NFGTEWGLVPSGDALVMIDSHDLRVGH
Sbjct  266  SNEYTSLGRIIEFRFYKEITNVFRNNNQLRWLRNFGTEWGLVPSGDALVMIDSHDLRVGH 325
Query  301  TGKLGFNINCFEGRLLKAATAFMLAWNYGVPRVMSSYFWNQIIKDGKDVNDWVGPPSDKN 360
            TG+LGFNINCFE RLLKAATAFMLAWNYG+PRVMSSYFW+QII+DGKDVNDWVGPP+D++
Sbjct  326  TGQLGFNINCFEARLLKAATAFMLAWNYGIPRVMSSYFWDQIIRDGKDVNDWVGPPTDQH 385
Query  361  GNILSVHPNPDMTCNHEWICEHRWREIYNMVKFRMIAGQEPVHNWWDNGDYQIAFSRGNR 420
            GNILSVHPNPDMTCNHEWICEHRWREIYNMVKF++IAGQEPV+NWWDNGD QIAFSRGNR
Sbjct  386  GNILSVHPNPDMTCNHEWICEHRWREIYNMVKFKLIAGQEPVNNWWDNGDNQIAFSRGNR 445
Query  421  AFIAINLQKN----QQNLQQKLHTGLPAGTYCDIISGNLIDNKCTGKSIHVDKNGQADVY 476
            AFIAINLQKN     +NLQ++L+TGLP G YCDIISGNLI+N+C GKSI+VDKNG +D+Y
Sbjct  446  AFIAINLQKNGNDHDKNLQKRLQTGLPPGIYCDIISGNLINNRCMGKSIQVDKNGLSDIY 505
Query  477  VGHDEFDAFVAYHIGARIVS 496
            VGHDEFDAFVAYHI AR+ S
Sbjct  506  VGHDEFDAFVAYHIDARVES 525

Sequence Alignment: 4. Allergen Name: Blo t 4.0101 Sequence ID: AAQ24543

 Score = 578.9 bits 2512,  Expect = 2e-166
 Identities = 337/481 70%, Positives = 402/481 83%, Gaps = 1/481 0%
Query  2    YHNPHFIGNRSVITHLMEWKYDDIGDECERFLGPYGYGGVQVSPVNEHAILDRRPWYERY 61
            Y +PHF  NR VITHLM+WK+ DI DECERFLGPYGYGGVQVSPVNEHA LDR PWYE Y
Sbjct  24   YSDPHFQHNRKVITHLMQWKFVDIADECERFLGPYGYGGVQVSPVNEHASLDRHPWYELY 83
Query  62   QPVSYDIRTRSGDEQQFRRMVKRCNKAGVRIYVDIVLNHMTGAQSGKGTNGHHYDGNTLQ 121
            QPVSY I +RSG E QFR MV RCNKAGVRIYVD+VLNHMTG QSG G +G HYDGN++Q
Sbjct  84   QPVSYRIVSRSGTESQFRDMVHRCNKAGVRIYVDVVLNHMTGPQSGVGIDGTHYDGNSMQ 143
Query  122  YPGVPFGPNDFHGHESCPTQDLEIHDYTNPKEARNCRLSGLRDLKQQSEYVRQKQVDFLN 181
            YPG+PFGPNDFHGHESCPT +L+I++Y +P +ARNCRLSGLRDLKQ ++YVR KQ DFLN
Sbjct  144  YPGIPFGPNDFHGHESCPTSNLDIQNYDDPTQARNCRLSGLRDLKQSADYVRTKQADFLN 203
Query  182  HLIDIGVAGFRSDASTHQWPDDLRSIYSRLHNLNKEFFPENSQPFIYHETIYYGGNGINS 241
            HLIDIGVAGFR DAS H WP DL++IYS+LH+LN+++FP NS PFIYHE IY   N I+ 
Sbjct  204  HLIDIGVAGFRFDASKHMWPGDLQAIYSKLHHLNEKYFPSNSNPFIYHEVIYSNNNAISI 263
Query  242  NEYTSLGRIIEFRFYKEITNVFRGNNPLHWLKNFGTEWGLVPSGDALVMIDSHDLRVGHT 301
            ++YT LGR IEF +Y E+ NV RGNN L WL NFG  WG+VP+ DAL+M+DSHDL+ GHT
Sbjct  264  SDYTKLGRSIEFHYYHELCNVIRGNNKLKWLHNFGQPWGMVPNDDALIMVDSHDLQRGHT 323
Query  302  GKLGFNINCFEGRLLKAATAFMLAWNYGVPRVMSSYFWNQIIKDGKDVNDWVGPPSDKNG 361
            G+LG+NIN FE RLLK ATAFMLAW YG+PRVMSSY WNQ I +GKD NDW+GPP+D +G
Sbjct  324  GQLGLNINYFESRLLKVATAFMLAWPYGIPRVMSSYRWNQKIVNGKDENDWIGPPADGSG 383
Query  362  NILSVHPNPDMTCNHEWICEHRWREIYNMVKFRMIAGQEPVHNWWDNGDYQIAFSRGNRA 421
            +ILSV PN D+TCN+EWICEHRW++IYNMV+FR  AG EPV NWWDNGDYQIAFSRG + 
Sbjct  384  SILSVKPNSDLTCNQEWICEHRWKQIYNMVQFRNTAGDEPVKNWWDNGDYQIAFSRGAKT 443
Query  422  FIAINLQKNQQNLQQKLHTGLPAGTYCDIISGNLIDNKCTGKSIHVDKNGQADVYVGHDE 481
            FIAINLQ N Q+L+Q LHTGLP+G YC++++GN+ + KC+G+ +HVD +G+A + +G + 
Sbjct  444  FIAINLQ-NGQHLKQNLHTGLPSGNYCNLVTGNVHNGKCSGQMVHVDGSGHAMISIGANA 502
Query  482  FD 483
             D
Sbjct  503  DD 504

Sequence Alignment: 5. Allergen Name: Bla g 11.0101 Sequence ID: Q2L7A6

 Score = 297.1 bits 1276,  Expect = 2e-81
 Identities = 251/475 52%, Positives = 331/475 69%, Gaps = 23/475 4%
Query  4    NPHFIGNRSVITHLMEWKYDDIGDECERFLGPYGYGGVQVSPVNEHAILDR--RPWYERY 61
            +PH    RS I HL EWK+ DI DECERFLGP G+ GVQVSPV+E+ I+    RPW+ERY
Sbjct  21   DPHVWDGRSAIVHLFEWKFADIADECERFLGPKGFAGVQVSPVHENVIISSPFRPWWERY 80
Query  62   QPVSYDIRTRSGDEQQFRRMVKRCNKAGVRIYVDIVLNHMTGAQ-SGKGTNGHHYDGNTL 120
            Q VSY + +RSGDE  FR MV+RCN  G+RIYVD+VLN+M+G+     G  G   D   L
Sbjct  81   QLVSYKLVSRSGDENAFRDMVRRCNNVGIRIYVDVVLNQMSGSWPDAHGQGGSTADTYNL 140
Query  121  QYPGVPFGPNDFHGHESCPTQDLEIHDYTNPKEARNCRLSGLRDLKQQSEYVRQKQVDFL 180
            QYP VP+GP DFH   +C      + +Y +P   RNC L GL DL Q S+YVR K +++L
Sbjct  141  QYPAVPYGPGDFHS--TCT-----VSNYQDPSNVRNCELVGLHDLNQGSDYVRGKMIEYL 193
Query  181  NHLIDIGVAGFRSDASTHQWPDDLRSIYSRLHNLNKEF-FPENSQPFIYHETIYYGGNGI 239
            NHL+D GVAGFR DA+ H WP DL+ IYS+++NLN +  FP  ++PF Y+E I  GG  I
Sbjct  194  NHLVDCGVAGFRVDAAKHMWPADLQYIYSKVNNLNTDHGFPSGARPFFYQEVIDLGGEAI 253
Query  240  NSNEYTSLGRIIEFRFYKEITNVFRGNNPLHWLKNFGTEWGLVPSGDALVMIDSHDLRVG 299
            +S EYT +GR+ EF++ ++I + FRGNN + WL NFG  WG +P GDALV +D+HD + G
Sbjct  254  HSTEYTGFGRVTEFKYSRDIGDAFRGNNAIKWLVNFGVGWGYIPDGDALVFVDNHDNQRG 313
Query  300  HTGKLGFNINCFE-GRLLKAATAFMLAWNYGVPRVMSSYFWNQIIKDGKDVNDWVGPPSD 358
            H G  G +I  ++  +L K A AFMLA+ YG PRVMSS+ +     D  D     GPP D
Sbjct  314  H-GAGGASILTYKTSKLYKMAVAFMLAYPYGYPRVMSSFSF-----DNSDQ----GPPQD 363
Query  359  KNGNILSVHPNPDMTCNHEWICEHRWREIYNMVKFRMIAGQEPVHNWWDNGDYQIAFSRG 418
             NGNI+S   N D TC + W+CEHRWR+I+NMV FR       V NWWDNGD QI+F RG
Sbjct  364  GNGNIISPSINADGTCGNGWVCEHRWRQIFNMVGFRNAVAGTAVSNWWDNGDKQISFCRG 423
Query  419  NRAFIAINLQKNQQNLQQKLHTGLPAGTYCDIISGNLIDNKCTGKSIHVDKNGQADVYVG 478
            N+ F+A N + N  +L+Q L+T LPAG YCD+ISG+  +  CTGK++ V  +G+A + + 
Sbjct  424  NKGFVAFNDEFNN-DLKQTLQTCLPAGDYCDVISGSYENGSCTGKTVTVGSDGKAYIEIL 482
Query  479  HDEFDAFVAYHIGARIVS 496
                D  +A H+ +++ S
Sbjct  483  SSADDGVLAIHVNSKVGS 500

Sequence Alignment: 6. Allergen Name: Per a 11.0101 Sequence ID: AKH04310

 Score = 106.1 bits 438,  Expect = 5e-24
 Identities = 230/467 49%, Positives = 308/467 65%, Gaps = 31/467 6%
Query  4    NPHFIGNRSVITHLMEWKYDDIGDECERFLGPYGYGGVQVSPVNEHAILDRR-P--WYER 60
            +P ++ + S +  L EWK+DDI DECERFL P GY GVQVSPV+++ +     P  W ER
Sbjct  21   DPKLVPDESTLLRLFEWKFDDIADECERFLAPKGYAGVQVSPVHKNLLYTATAPGLW-ER 79
Query  61   YQPVSYDIRTRSGDEQQFRRMVKRCNKAGVRIYVDIVLNHMTGAQSGK-GTNGHHYDGNT 119
            YQP+SY + +RSGDE  FR MV+RCN  GVRIYVD+VLNHM+G      GT G   D   
Sbjct  80   YQPMSYKLVSRSGDETAFRDMVRRCNAVGVRIYVDVVLNHMSGNWDNAVGTGGSTADTYN 139
Query  120  LQYPGVPFGPNDFHGHESCPTQDLEIHDYTNPKEARNCRLSGLRDLKQQSEYVRQKQVDF 179
              YPGVP+  +DFH +  C      ++DY +P+  RNC L GL DL Q  +YVR+K +DF
Sbjct  140  YSYPGVPYDHSDFHPY--CI-----LNDYQDPEIVRNCELVGLHDLDQSQDYVREKLIDF 192
Query  180  LNHLIDIGVAGFRSDASTHQWPDDLRSIYSRLHNLNKEF-FPENSQPFIYHETIYYGGNG 238
            LNHL+D GVAGFR DA+ H WP DL  IY +++N N +  +  +S P  Y+E I  GG  
Sbjct  193  LNHLVDAGVAGFRVDAAKHMWPADLEYIYGKVNNRNSDAGYCGDSSPSRYQEVIDLGGEA 252
Query  239  INSNEYTSLGRIIEFRFYKEITNVFRGNNPLHWLKNFGTEWGLVPSGDALVMIDSHD-LR 297
            ++  EY  +GR+ EF+  ++I   FRGNN L W   +   WGL+PSGDALV +D+HD  R
Sbjct  253  VSKFEYNGFGRVTEFKHSEQIGYAFRGNNRLEWTYTYKPNWGLLPSGDALVFVDNHDNQR 312
Query  298  VGHTGKLGFNINCFEGRLLKAATAFMLAWNYGVPRVMSSYFWNQIIKDGKDVNDWVGPPS 357
             G    L +       +  K A AF+LA  YG PRVMSS+ +        + +D  GPP 
Sbjct  313  GGGNAILTYKTP----KNYKMAIAFILAHPYGYPRVMSSFDF--------EAHDQ-GPPQ 359
Query  358  DKNGNILSVHPNPDMTCNHEWICEHRWREIYNMVKFRMIAGQEPVHNWWDNGDYQIAFSR 417
            D + NILS   N D TC + W+CEHRWR+  NMV FR       + NWWDNG++QI F R
Sbjct  360  DSDKNILSPSINADGTCGNGWVCEHRWRQHANMVGFRNAVRGTEITNWWDNGNHQIGFCR 419
Query  418  GNRAFIAINLQKNQQNLQQKLHTGLPAGTYCDIISGNLIDNKCTGKSIHVDKNGQA-DVY 476
            G+R F+A N++ N  +L+Q L+T LPAGTYCD+ISG+  +    G  + V  NG+A  V 
Sbjct  420  GDRGFVAFNVEDN--DLKQTLQTCLPAGTYCDVISGSKNNRAHLGAELVVAPNGEAFSVR 477
Query  477  VGHDEFDAFVAYHIGARI 494
            +  D+ D  +A H+  ++
Sbjct  478  LISDD-DGVLAIHLEEKL 494

Sequence Alignment: 7. Allergen Name: Aed a 4.0101 Sequence ID: P13080

 Score = 46.6 bits 177,  Expect = 4e-06
 Identities = 56/202 27%, Positives = 99/202 49%, Gaps = 24/202 11%
Query  23   DDIGD-----ECERFLGPYGYGGVQVSPVNEHAILDRRPWYERYQPVSY-DIRTRSGDEQ 76
            D IGD     E  ++L   G  GV +SP+    + D       Y   ++ +I+T  GD  
Sbjct  41   DGIGDLDGVTEKLKYLKDIGMDGVWLSPIFSSPMADFG-----YDISNFREIQTEYGDLD 95
Query  77   QFRRMVKRCNKAGVRIYVDIVLNHMTGAQS--GKGTNGHH-YDGNTLQYPGVPFGPNDFH 133
             F+R+  +C + G+ + +D V NH +  +    K       Y    + +PGV  GPN+  
Sbjct  96   AFQRLSDKCKQLGLHLILDFVPNHTSDQHEYFKKSVQKDETYKDFYVWHPGV-HGPNNTK 154
Query  134  GHESCPTQDLEIHDYTNPKEARNCRLSGLR----DLKQQSEYVRQKQVDFLNHLIDIGVA 189
               S     +    +   +E +   L  +     DL  ++  V ++  + L + +D GV+
Sbjct  155  VPPSNWISVFRGSSWEWNEERQEFYLHQFLKEQPDLNYRNPAVVEEMKNVLRYWLDRGVS 214
Query  190  GFRSDASTHQWPDDLRSIYSRLHNLNKEFF---PENSQPFIYHETI 232
            GFR DA  + +  D+  I  R  N  +      PEN   +++ +T+
Sbjct  215  GFRIDAVPYLFESDI--IDGRYRNEPESRTTDDPENPAYLVHTQTM 258

Sequence Alignment: 8. Allergen Name: Der p 4 Sequence ID: P49274

 Score = 33.8 bits 104,  Expect = 0.001
 Identities = 16/19 84%, Positives = 16/19 84%, Gaps = 0/19 0%
Query  1    KYHNPHFIGNRSVITHLME 19
            KY NPHFIG RSVIT LME
Sbjct  1    KYXNPHFIGXRSVITXLME 19

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.