The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

LCLSLLVAAVVADQVDVKDCGKFVCVIHFFSFHLFNTKHNFLFLVYIHIANNEIKKVMVD
GCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCP
LVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
Sequence Info Allergen Name Length Opt Bits Score E Value
AAK30133 Der f 2 170 1156 281.6 8e-78
Q00855 Der f 2 146 822 202.3 5.1e-54
BAA01239 Der f 2 138 816 200.9 1.3e-53
BAA01241 Der f 2 138 807 198.7 5.7e-53
ABA39438 Der f 2.0109 129 777 191.6 7.4e-51
ABA39437 Der p 2.0109 129 749 185.0 7.4e-49
CAQ68249 Der p 2.0115 129 749 185.0 7.4e-49
P49278 Der p 2 146 747 184.5 1.2e-48
CAK22338 Der p 2.0114 146 745 184.0 1.6e-48
AAC82350 Eur m 2.0102 135 707 175.0 7.8e-46
Q9TZZ2 Eur m 2 145 707 175.0 8.5e-46
BAX34757 Der f 35.0101 143 378 96.8 2.8e-22
CAB76459 Gly d 2.0201 125 369 94.7 1.1e-21
P80384 Lep d 2 141 362 93.0 3.8e-21
A6XEN9 Blo t 2.0104 142 361 92.8 4.6e-21
A6XEN8 Blo t 2.0104 142 361 92.8 4.6e-21
CAD32313 Lep d 2.0102 141 357 91.9 8.7e-21
CAD32314 Lep d 2.0202 141 357 91.9 8.7e-21
O02380 Tyr p 2 141 355 91.4 1.2e-20
A6XEP2 Blo t 2.0104 142 354 91.1 1.4e-20
A6XEP1 Blo t 2.0104 142 354 91.1 1.4e-20
A6XEP6 Blo t 2.0104 142 354 91.1 1.4e-20
A6XEP3 Blo t 2.0104 142 353 90.9 1.7e-20
A6XEP5 Blo t 2.0104 142 353 90.9 1.7e-20
CAA58755 Lep d 2.0201 141 352 90.7 2e-20
AAQ73483 Blo t 2.0101 144 350 90.2 2.8e-20
AAQ73482 Blo t 2.0102 142 349 90.0 3.3e-20
CAB59976 Gly d 2.0101 128 348 89.7 3.4e-20
A6XEP4 Blo t 2.0104 142 347 89.5 4.6e-20
A6XEP0 Blo t 2.0104 142 344 88.8 7.5e-20
AAQ73481 Blo t 2.0103 141 343 88.5 8.8e-20
CAA57160 Lep d 2.0101 98 310 80.8 1.3e-17
ABG76195 Der f 22.0101 155 220 59.3 6.1e-11
Q28895 Can f 7.0101 149 158 44.6 1.6e-06
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Der f 2 Sequence ID: AAK30133

 Score = 281.6 bits 1156,  Expect = 8e-78
 Identities = 170/170 100%, Positives = 170/170 100%, Gaps = 0/170 0%
Query  1    LCLSLLVAAVVADQVDVKDCGKFVCVIHFFSFHLFNTKHNFLFLVYIHIANNEIKKVMVD 60
            LCLSLLVAAVVADQVDVKDCGKFVCVIHFFSFHLFNTKHNFLFLVYIHIANNEIKKVMVD
Sbjct  1    LCLSLLVAAVVADQVDVKDCGKFVCVIHFFSFHLFNTKHNFLFLVYIHIANNEIKKVMVD 60
Query  61   GCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCP 120
            GCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCP
Sbjct  61   GCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCP 120
Query  121  LVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD 170
            LVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
Sbjct  121  LVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD 170

Sequence Alignment: 2. Allergen Name: Der f 2 Sequence ID: Q00855

 Score = 202.3 bits 822,  Expect = 5e-54
 Identities = 141/141 100%, Positives = 141/141 100%, Gaps = 29/141 20%
Query  1    LCLSLLVAAVVADQVDVKDCGKFVCVIHFFSFHLFNTKHNFLFLVYIHIANNEIKKVMVD 60
            LCLSLLVAAVVADQVDVKDC                             ANNEIKKVMVD
Sbjct  6    LCLSLLVAAVVADQVDVKDC-----------------------------ANNEIKKVMVD 36
Query  61   GCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCP 120
            GCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCP
Sbjct  37   GCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCP 96
Query  121  LVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD 170
            LVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
Sbjct  97   LVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD 146

Sequence Alignment: 3. Allergen Name: Der f 2 Sequence ID: BAA01239

 Score = 200.9 bits 816,  Expect = 1e-53
 Identities = 137/138 99%, Positives = 138/138 100%, Gaps = 29/138 21%
Query  4    SLLVAAVVADQVDVKDCGKFVCVIHFFSFHLFNTKHNFLFLVYIHIANNEIKKVMVDGCH 63
            SLLVAAVVADQVDVKDC                             ANNEIKKVMVDGCH
Sbjct  1    SLLVAAVVADQVDVKDC-----------------------------ANNEIKKVMVDGCH 31
Query  64   GSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVK 123
            GSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHF+KCPLVK
Sbjct  32   GSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVK 91
Query  124  GQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD 170
            GQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
Sbjct  92   GQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD 138

Sequence Alignment: 4. Allergen Name: Der f 2 Sequence ID: BAA01241

 Score = 198.7 bits 807,  Expect = 6e-53
 Identities = 135/138 97%, Positives = 136/138 98%, Gaps = 29/138 21%
Query  4    SLLVAAVVADQVDVKDCGKFVCVIHFFSFHLFNTKHNFLFLVYIHIANNEIKKVMVDGCH 63
            SLLVAAVVADQVDVKDC                             ANNEIKKVMVDGCH
Sbjct  1    SLLVAAVVADQVDVKDC-----------------------------ANNEIKKVMVDGCH 31
Query  64   GSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVK 123
            GSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVK
Sbjct  32   GSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVK 91
Query  124  GQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD 170
            GQQYD KYTWNVPKIAPKSENVVVTVKL+GDNGVLACAIATH KIRD
Sbjct  92   GQQYDAKYTWNVPKIAPKSENVVVTVKLVGDNGVLACAIATHAKIRD 138

Sequence Alignment: 5. Allergen Name: Der f 2.0109 Sequence ID: ABA39438

 Score = 191.6 bits 777,  Expect = 7e-51
 Identities = 114/121 94%, Positives = 119/121 98%, Gaps = 0/121 0%
Query  50   ANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGI 109
            ANNEIKKVMVDG HGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKA+++GLE+DVPGI
Sbjct  9    ANNEIKKVMVDGRHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKANINGLEVDVPGI 68
Query  110  DTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIR 169
            DTNACHF+KCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATH KIR
Sbjct  69   DTNACHFVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHAKIR 128
Query  170  D 170
            D
Sbjct  129  D 129

Sequence Alignment: 6. Allergen Name: Der p 2.0109 Sequence ID: ABA39437

 Score = 185.0 bits 749,  Expect = 7e-49
 Identities = 106/121 87%, Positives = 117/121 96%, Gaps = 0/121 0%
Query  50   ANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGI 109
            AN+EIKKV+V GCHGS+PCIIHRGKPF LEA+F+ANQN+KTAKIEIKAS+DGLE+DVPGI
Sbjct  9    ANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDGLEVDVPGI 68
Query  110  DTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIR 169
            D NACH+MKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVK++GDNGVLACAIATH KIR
Sbjct  69   DPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLACAIATHAKIR 128
Query  170  D 170
            D
Sbjct  129  D 129

Sequence Alignment: 7. Allergen Name: Der p 2.0115 Sequence ID: CAQ68249

 Score = 185.0 bits 749,  Expect = 7e-49
 Identities = 106/121 87%, Positives = 117/121 96%, Gaps = 0/121 0%
Query  50   ANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGI 109
            AN+EIKKV+V GCHGS+PCIIHRGKPF LEA+F+ANQN+KTAKIEIKAS+DGLE+DVPGI
Sbjct  9    ANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNSKTAKIEIKASIDGLEVDVPGI 68
Query  110  DTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIR 169
            D NACH+MKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVK++GDNGVLACAIATH KIR
Sbjct  69   DPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVMGDNGVLACAIATHAKIR 128
Query  170  D 170
            D
Sbjct  129  D 129

Sequence Alignment: 8. Allergen Name: Der p 2 Sequence ID: P49278

 Score = 184.5 bits 747,  Expect = 1e-48
 Identities = 124/141 87%, Positives = 135/141 95%, Gaps = 29/141 20%
Query  1    LCLSLLVAAVVADQVDVKDCGKFVCVIHFFSFHLFNTKHNFLFLVYIHIANNEIKKVMVD 60
            LCLSLLVAAV  DQVDVKDC                             AN+EIKKV+V 
Sbjct  6    LCLSLLVAAVARDQVDVKDC-----------------------------ANHEIKKVLVP 36
Query  61   GCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCP 120
            GCHGS+PCIIHRGKPF LEA+F+ANQNTKTAKIEIKAS+DGLE+DVPGID NACH+MKCP
Sbjct  37   GCHGSEPCIIHRGKPFQLEAVFEANQNTKTAKIEIKASIDGLEVDVPGIDPNACHYMKCP 96
Query  121  LVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD 170
            LVKGQQYDIKYTWNVPKIAPKSENVVVTVK++GD+GVLACAIATH KIRD
Sbjct  97   LVKGQQYDIKYTWNVPKIAPKSENVVVTVKVMGDDGVLACAIATHAKIRD 146

Sequence Alignment: 9. Allergen Name: Der p 2.0114 Sequence ID: CAK22338

 Score = 184.0 bits 745,  Expect = 2e-48
 Identities = 125/141 88%, Positives = 135/141 95%, Gaps = 29/141 20%
Query  1    LCLSLLVAAVVADQVDVKDCGKFVCVIHFFSFHLFNTKHNFLFLVYIHIANNEIKKVMVD 60
            LCLSLLVAAV ADQVDVKDC                             AN+EIKKV+V 
Sbjct  6    LCLSLLVAAVAADQVDVKDC-----------------------------ANHEIKKVLVP 36
Query  61   GCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCP 120
            GCHGS+PCIIHRGKPF LEALF+ANQNTK AKIEIKAS+DGLE+DVPGID NACH++KCP
Sbjct  37   GCHGSEPCIIHRGKPFQLEALFEANQNTKNAKIEIKASIDGLEVDVPGIDPNACHYVKCP 96
Query  121  LVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD 170
            LVKGQQYDIKYTWNVPKIAPKSENVVVTVK++GDNGVLACAIATH KIRD
Sbjct  97   LVKGQQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLACAIATHAKIRD 146

Sequence Alignment: 10. Allergen Name: Eur m 2.0102 Sequence ID: AAC82350

 Score = 175.0 bits 707,  Expect = 8e-46
 Identities = 113/135 83%, Positives = 124/135 91%, Gaps = 29/135 21%
Query  7    VAAVVADQVDVKDCGKFVCVIHFFSFHLFNTKHNFLFLVYIHIANNEIKKVMVDGCHGSD 66
            VAAV ADQVDVKDC                             AN+EIKKVMV GC GS+
Sbjct  1    VAAVAADQVDVKDC-----------------------------ANHEIKKVMVPGCKGSE 31
Query  67   PCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQ 126
            PC+IHRG  F LEA+FDANQN+  AKIEIKA++DG+EIDVPGID N CHFMKCPLVKGQ+
Sbjct  32   PCVIHRGTAFQLEAVFDANQNSNAAKIEIKATIDGVEIDVPGIDNNLCHFMKCPLVKGQE 91
Query  127  YDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD 170
            YDIKYTWNVP+IAPKSENVVVTVKL+GDNGVLACAIATH KIRD
Sbjct  92   YDIKYTWNVPRIAPKSENVVVTVKLLGDNGVLACAIATHAKIRD 135

Sequence Alignment: 11. Allergen Name: Eur m 2 Sequence ID: Q9TZZ2

 Score = 175.0 bits 707,  Expect = 9e-46
 Identities = 118/141 83%, Positives = 130/141 92%, Gaps = 29/141 20%
Query  1    LCLSLLVAAVVADQVDVKDCGKFVCVIHFFSFHLFNTKHNFLFLVYIHIANNEIKKVMVD 60
            LCLSLLVAAV ADQVD+KDC                             AN+EIKKVMV 
Sbjct  5    LCLSLLVAAVAADQVDIKDC-----------------------------ANHEIKKVMVP 35
Query  61   GCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCP 120
            GC GS+PC+IHRG  F LEA+FDANQN+  AKIEIKA++DG+EIDVPGID N CHFMKCP
Sbjct  36   GCKGSEPCVIHRGTAFQLEAVFDANQNSNAAKIEIKATIDGVEIDVPGIDNNLCHFMKCP 95
Query  121  LVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD 170
            LVKGQ+YDIKYTWNVP+IAPKSENVVVTVKL+GDNGVLACAIATH KIRD
Sbjct  96   LVKGQEYDIKYTWNVPRIAPKSENVVVTVKLLGDNGVLACAIATHAKIRD 145

Sequence Alignment: 12. Allergen Name: Der f 35.0101 Sequence ID: BAX34757

 Score = 96.8 bits 378,  Expect = 3e-22
 Identities = 54/141 38%, Positives = 95/141 67%, Gaps = 8/141 5%
Query  22   KFVCVIHFFSFHLFNTKHNFLFLVYIHIANNEIKKVMVDGCHGSDPCIIHRGKPFTLEAL 81
            KF+C+  + +F + +       + ++   + E+  + V GC G D C++H+GK   L+  
Sbjct  3    KFLCIFAL-TFAVASAGK----MKFVDCGHKEVISLDVSGCEG-DYCVLHKGKTIDLDMK 56
Query  82   FDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPK 141
              +NQ+++  K+ I A ++G+EI+VPG D + CH+++CP+ KGQ YDIKY++NVP + P 
Sbjct  57   CKSNQDSEHLKLIISADVNGIEIEVPGFDQDGCHYVQCPIHKGQDYDIKYSYNVPAVLPN 116
Query  142  SENVVVTVKLIGDNGVLACAIATHGKIRD 170
             +  + T K+IGDNG++ C +  +G+I D
Sbjct  117  IKGTL-TAKVIGDNGLVGC-LKLNGEIAD 143

Sequence Alignment: 13. Allergen Name: Gly d 2.0201 Sequence ID: CAB76459

 Score = 94.7 bits 369,  Expect = 1e-21
 Identities = 55/106 51%, Positives = 74/106 69%, Gaps = 2/106 1%
Query  53   EIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTN 112
            E+ ++ +  C G D C+IHRGKP+TLEA F ANQ+T  A I++ A + G  I VPG++T+
Sbjct  12   EVTELDITDCSG-DFCVIHRGKPLTLEAKFAANQDTTKATIKVLAKVAGTPIQVPGLETD 70
Query  113  ACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLAC 160
             C F+KCP+ KG   D KYT  VP I PK +   VT +L+GD+GVLAC
Sbjct  71   GCKFVKCPIKKGDPIDFKYTTTVPAILPKVK-AEVTAELVGDHGVLAC 117

Sequence Alignment: 14. Allergen Name: Lep d 2 Sequence ID: P80384

 Score = 93.0 bits 362,  Expect = 4e-21
 Identities = 52/122 42%, Positives = 79/122 64%, Gaps = 3/122 2%
Query  44   LVYIHIANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLE 103
            + +    + E+ ++ + GC G D C+IHRG+  TLEA F ANQ+T    I++ A + G  
Sbjct  19   MTFKDCGHGEVTELDITGCSG-DTCVIHRGEKMTLEAKFAANQDTAKVTIKVLAKVAGTT 77
Query  104  IDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIA 163
            I VPG++T+ C F+KCP+ KG+  D  Y+  +P I PK +   VT +LIGD+GV+AC   
Sbjct  78   IQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVK-ADVTAELIGDHGVMACG-T 135
Query  164  THGKI 168
             HG++
Sbjct  136  VHGQV 140

Sequence Alignment: 15. Allergen Name: Blo t 2.0104 Sequence ID: A6XEN9

 Score = 92.8 bits 361,  Expect = 5e-21
 Identities = 51/131 38%, Positives = 86/131 65%, Gaps = 8/131 6%
Query  22   KFVCVIHFFSFHLFNTKHNFLFLVYIHIANNEIKKVMVDGCHGSDPCIIHRGKPFTLEAL 81
            KF+C+  + S+           + +   A+ E+  + + GC G D C IH+GK FTL+ +
Sbjct  3    KFICLALLVSYAAAGD------VKFTDCAHGEVTSLDLSGCSG-DHCTIHKGKSFTLKTF 55
Query  82   FDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPK 141
            F ANQ+++  +I+I A+++G+E+ VPG+D + C    CPL KGQ+Y++ Y+  +P + P 
Sbjct  56   FIANQDSEKLEIKISATMNGIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTVLPN 115
Query  142  SENVVVTVKLIGDNGVLAC 160
             + V  T  L+GD+GV+AC
Sbjct  116  VKTVT-TASLVGDHGVVAC 133

Sequence Alignment: 16. Allergen Name: Blo t 2.0104 Sequence ID: A6XEN8

 Score = 92.8 bits 361,  Expect = 5e-21
 Identities = 52/131 39%, Positives = 86/131 65%, Gaps = 8/131 6%
Query  22   KFVCVIHFFSFHLFNTKHNFLFLVYIHIANNEIKKVMVDGCHGSDPCIIHRGKPFTLEAL 81
            KF+C+  + S+           + +   A+ E+  + + GC G D C IH+GK FTL+ +
Sbjct  3    KFICLALLVSYAAAGD------VKFTDCAHGEVTSLDLSGCSG-DHCTIHKGKSFTLKTF 55
Query  82   FDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPK 141
            F ANQ+++  +I+I A+++G+E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P 
Sbjct  56   FIANQDSEKLEIKISATMNGIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILP- 114
Query  142  SENVVVTVKLIGDNGVLAC 160
            +   V T  L+GD+GV+AC
Sbjct  115  NLKTVTTASLVGDHGVVAC 133

Sequence Alignment: 17. Allergen Name: Lep d 2.0102 Sequence ID: CAD32313

 Score = 91.9 bits 357,  Expect = 9e-21
 Identities = 51/122 41%, Positives = 78/122 63%, Gaps = 3/122 2%
Query  44   LVYIHIANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLE 103
            + +    + E+ ++ + GC G D C+IHRG+  TLEA F ANQ+T    I++   + G  
Sbjct  19   MTFKDCGHGEVTELDITGCSG-DTCVIHRGEKMTLEAKFAANQDTAKVTIKVLTKVAGTT 77
Query  104  IDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIA 163
            I VPG++T+ C F+KCP+ KG+  D  Y+  +P I PK +   VT +LIGD+GV+AC   
Sbjct  78   IQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVK-ADVTAELIGDHGVMACG-T 135
Query  164  THGKI 168
             HG++
Sbjct  136  VHGQV 140

Sequence Alignment: 18. Allergen Name: Lep d 2.0202 Sequence ID: CAD32314

 Score = 91.9 bits 357,  Expect = 9e-21
 Identities = 50/122 40%, Positives = 78/122 63%, Gaps = 3/122 2%
Query  44   LVYIHIANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLE 103
            + +    + E+ ++ + GC G D C+IHRG+  TL+A F ANQ+T    I++ A + G  
Sbjct  19   MTFKDCGHGEVTELDISGCSG-DTCVIHRGQKMTLDAKFAANQDTNKVTIKVLAKVAGTT 77
Query  104  IDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIA 163
            I VPG++T+ C  +KCP+ KG+  D  Y   +P I PK + V VT +L+GD+GV+AC   
Sbjct  78   IQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIK-VDVTAELVGDHGVMACG-T 135
Query  164  THGKI 168
             HG++
Sbjct  136  IHGQV 140

Sequence Alignment: 19. Allergen Name: Tyr p 2 Sequence ID: O02380

 Score = 91.4 bits 355,  Expect = 1e-20
 Identities = 54/111 48%, Positives = 77/111 69%, Gaps = 7/111 6%
Query  53   EIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTN 112
            EI  V VDGC G D C+IH+ KP  + A F ANQ+T   ++++   L+GLE+ +PGI+T+
Sbjct  27   EIASVAVDGCEG-DLCVIHKSKPVHVIAEFTANQDTCKIEVKVTGQLNGLEVPIPGIETD 85
Query  113  ACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLI--GDNGVLAC-AIATHGK 167
             C  +KCPL KG +Y + Y+ NVP + P   N+   VKL+  G++GVLAC A+ T  K
Sbjct  86   GCKVLKCPLKKGTKYTMNYSVNVPSVVP---NIKTVVKLLATGEHGVLACGAVNTDVK 140

Sequence Alignment: 20. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP2

 Score = 91.1 bits 354,  Expect = 1e-20
 Identities = 52/131 39%, Positives = 85/131 64%, Gaps = 8/131 6%
Query  22   KFVCVIHFFSFHLFNTKHNFLFLVYIHIANNEIKKVMVDGCHGSDPCIIHRGKPFTLEAL 81
            KF+C+  + S+           + +   A+ E+  + + GC G D CIIH+GK FTL+ +
Sbjct  3    KFICLALLVSYAAAGD------VKFTDCAHGEVTSLDLSGCSG-DHCIIHKGKSFTLKTF 55
Query  82   FDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPK 141
            F ANQ+++  +I+I A ++ +E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P 
Sbjct  56   FIANQDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILP- 114
Query  142  SENVVVTVKLIGDNGVLAC 160
            +   V T  L+GD+GV+AC
Sbjct  115  NLKTVTTASLVGDHGVVAC 133

Sequence Alignment: 21. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP1

 Score = 91.1 bits 354,  Expect = 1e-20
 Identities = 52/131 39%, Positives = 85/131 64%, Gaps = 8/131 6%
Query  22   KFVCVIHFFSFHLFNTKHNFLFLVYIHIANNEIKKVMVDGCHGSDPCIIHRGKPFTLEAL 81
            KF+C+  + S+           + +   A+ E+  + + GC G D CIIH+GK FTL+ +
Sbjct  3    KFICLALLVSYAAAGD------VKFTDCAHGEVTSLDLSGCSG-DHCIIHKGKSFTLKTF 55
Query  82   FDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPK 141
            F ANQ+++  +I+I A ++ +E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P 
Sbjct  56   FIANQDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILP- 114
Query  142  SENVVVTVKLIGDNGVLAC 160
            +   V T  L+GD+GV+AC
Sbjct  115  NLKTVTTASLVGDHGVVAC 133

Sequence Alignment: 22. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP6

 Score = 91.1 bits 354,  Expect = 1e-20
 Identities = 52/131 39%, Positives = 85/131 64%, Gaps = 8/131 6%
Query  22   KFVCVIHFFSFHLFNTKHNFLFLVYIHIANNEIKKVMVDGCHGSDPCIIHRGKPFTLEAL 81
            KF+C+  + S+           + +   A+ E+  + + GC G D CIIH+GK FTL+ +
Sbjct  3    KFICLALLVSYAAAGD------VKFTDCAHGEVTSLDLSGCSG-DHCIIHKGKSFTLKTF 55
Query  82   FDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPK 141
            F ANQ+++  +I+I A ++ +E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P 
Sbjct  56   FIANQDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILP- 114
Query  142  SENVVVTVKLIGDNGVLAC 160
            +   V T  L+GD+GV+AC
Sbjct  115  NLKTVTTASLVGDHGVVAC 133

Sequence Alignment: 23. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP3

 Score = 90.9 bits 353,  Expect = 2e-20
 Identities = 51/131 38%, Positives = 85/131 64%, Gaps = 8/131 6%
Query  22   KFVCVIHFFSFHLFNTKHNFLFLVYIHIANNEIKKVMVDGCHGSDPCIIHRGKPFTLEAL 81
            KF+C+  + S+           + +   A+ E+  + + GC G D CIIH+GK FTL+ +
Sbjct  3    KFICLALLVSYAAAGD------VKFTDCAHGEVTSLDLSGCSG-DHCIIHKGKSFTLKTF 55
Query  82   FDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPK 141
            F ANQ+++  +I+I A ++ +E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P 
Sbjct  56   FIANQDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILP- 114
Query  142  SENVVVTVKLIGDNGVLAC 160
            +   + T  L+GD+GV+AC
Sbjct  115  NLKTITTASLVGDHGVVAC 133

Sequence Alignment: 24. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP5

 Score = 90.9 bits 353,  Expect = 2e-20
 Identities = 52/131 39%, Positives = 86/131 65%, Gaps = 8/131 6%
Query  22   KFVCVIHFFSFHLFNTKHNFLFLVYIHIANNEIKKVMVDGCHGSDPCIIHRGKPFTLEAL 81
            KF+C+  + S+    T  +  F      A+ E+  + +  C G D C IH+GK FTL+ +
Sbjct  3    KFICLALLVSY---ATAGDVKF---TDCAHGEVTSLDLSRCSG-DHCTIHKGKSFTLKTF 55
Query  82   FDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPK 141
            F ANQ+++  +I+I A+++G+E+ VPG+D + C    CPL KGQ+Y++ Y+  +P + P 
Sbjct  56   FIANQDSEKLEIKISATMNGIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTVLPN 115
Query  142  SENVVVTVKLIGDNGVLAC 160
             + V  T  L+GD+GV+AC
Sbjct  116  VKTVT-TASLVGDHGVVAC 133

Sequence Alignment: 25. Allergen Name: Lep d 2.0201 Sequence ID: CAA58755

 Score = 90.7 bits 352,  Expect = 2e-20
 Identities = 49/122 40%, Positives = 77/122 63%, Gaps = 3/122 2%
Query  44   LVYIHIANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLE 103
            + +    + E+ ++ + GC G D C+IHRG+  TL+A F ANQ+T    I++ A + G  
Sbjct  19   MTFKDCGHGEVTELDISGCSG-DTCVIHRGQKMTLDAKFAANQDTNKVTIKVLAKVAGTT 77
Query  104  IDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIA 163
            I VPG++T+ C  +KCP+ KG+  D  Y   +P I PK +   VT +L+GD+GV+AC   
Sbjct  78   IQVPGLETDGCKVLKCPIKKGEALDFNYGMTIPAITPKIK-ADVTAELVGDHGVMACG-T 135
Query  164  THGKI 168
             HG++
Sbjct  136  IHGQV 140

Sequence Alignment: 26. Allergen Name: Blo t 2.0101 Sequence ID: AAQ73483

 Score = 90.2 bits 350,  Expect = 3e-20
 Identities = 52/133 39%, Positives = 87/133 65%, Gaps = 6/133 4%
Query  22   KFVCVIHFFSFHLFNTKHNFLFLVYIHIANNEIKKVMVDGCHGSDPCIIHRGKPFTLEAL 81
            KF+C    +++  F ++     + +   A+ E+  + + GC G D CIIH+GK FTL+ +
Sbjct  3    KFIC----LALLPFWSRAAAGDVKFTDCAHGEVTSLDLSGCSG-DHCIIHKGKSFTLKTF 57
Query  82   FDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPK 141
            F ANQ+++  +I+I A ++ +E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P 
Sbjct  58   FIANQDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILP- 116
Query  142  SENVVVTVKLIGDNGVLAC 160
            +   V T  L+GD+GV+AC
Sbjct  117  NLKTVTTASLVGDHGVVAC 135

Sequence Alignment: 27. Allergen Name: Blo t 2.0102 Sequence ID: AAQ73482

 Score = 90.0 bits 349,  Expect = 3e-20
 Identities = 48/109 44%, Positives = 75/109 68%, Gaps = 2/109 1%
Query  50   ANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGI 109
            A+ E+  + + GC G D CIIH+GK FTL+ +F ANQ+++  +I+I A ++ +E+ VPG+
Sbjct  25   AHGEVTSLDLSGCSG-DHCIIHKGKSFTLKTFFIANQDSEKLEIKISAIMNNIEVPVPGV 83
Query  110  DTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLAC 160
            D + C    CPL KGQ+Y++ Y+  +P I P  + V  T  L+GD+GV+AC
Sbjct  84   DKDGCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT-TASLVGDHGVVAC 133

Sequence Alignment: 28. Allergen Name: Gly d 2.0101 Sequence ID: CAB59976

 Score = 89.7 bits 348,  Expect = 3e-20
 Identities = 52/108 48%, Positives = 80/108 74%, Gaps = 4/108 3%
Query  51   NNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDG-LEIDVPGI 109
            +NEIK++ V  C G + C+IHRGKP+TL+A FDANQ+T +  + + A +DG + ID+PG+
Sbjct  10   HNEIKELSVSNCTG-NYCVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGDIAIDIPGL 68
Query  110  DTNACHFMKCPLVKGQQYDIKYTWN-VPKIAPKSENVVVTVKLIGDNGVLAC 160
            +TNAC +MKCP+ KG++ ++ Y    +P   P+ +   V  +LIG++GVLAC
Sbjct  69   ETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIK-AKVKAQLIGEHGVLAC 119

Sequence Alignment: 29. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP4

 Score = 89.5 bits 347,  Expect = 5e-20
 Identities = 51/131 38%, Positives = 84/131 64%, Gaps = 8/131 6%
Query  22   KFVCVIHFFSFHLFNTKHNFLFLVYIHIANNEIKKVMVDGCHGSDPCIIHRGKPFTLEAL 81
            KF+C+  + S+           + +   A+ E+  + + GC   D CIIH+GK FTL+ +
Sbjct  3    KFICLALLVSYAAAGD------VKFTDCAHGEVTSLDLSGC-SDDHCIIHKGKSFTLKTF 55
Query  82   FDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPK 141
            F ANQ+++  +I+I A ++ +E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P 
Sbjct  56   FIANQDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILP- 114
Query  142  SENVVVTVKLIGDNGVLAC 160
            +   V T  L+GD+GV+AC
Sbjct  115  NLKTVTTASLVGDHGVVAC 133

Sequence Alignment: 30. Allergen Name: Blo t 2.0104 Sequence ID: A6XEP0

 Score = 88.8 bits 344,  Expect = 7e-20
 Identities = 51/131 38%, Positives = 84/131 64%, Gaps = 8/131 6%
Query  22   KFVCVIHFFSFHLFNTKHNFLFLVYIHIANNEIKKVMVDGCHGSDPCIIHRGKPFTLEAL 81
            KF+C+  + S+           + +   A+ E+  + + GC G D CII +GK FTL+ +
Sbjct  3    KFICLALLVSYAAAGD------VKFTDCAHGEVTSLDLSGCSG-DHCIIRKGKSFTLKTF 55
Query  82   FDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPK 141
            F ANQ+++  +I+I A ++ +E+ VPG+D + C    CPL KGQ+Y++ Y+  +P I P 
Sbjct  56   FIANQDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQKYELDYSLIIPTILP- 114
Query  142  SENVVVTVKLIGDNGVLAC 160
            +   V T  L+GD+GV+AC
Sbjct  115  NLKTVTTASLVGDHGVVAC 133

Sequence Alignment: 31. Allergen Name: Blo t 2.0103 Sequence ID: AAQ73481

 Score = 88.5 bits 343,  Expect = 9e-20
 Identities = 47/106 44%, Positives = 73/106 68%, Gaps = 2/106 1%
Query  53   EIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTN 112
            E+  + + GC G D CIIH+GK FTL+ +F ANQ+++  +I+I A ++ +E+ VPG+D +
Sbjct  27   EVTSLDLSGCSG-DHCIIHKGKSFTLKTFFIANQDSEKLEIKISAIMNNIEVPVPGVDKD 85
Query  113  ACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLAC 160
             C    CPL KGQ+Y++ Y+  +P I P  + V  T  L+GD+GV+AC
Sbjct  86   GCKHTTCPLKKGQKYELDYSLIIPTILPNLKTVT-TASLVGDHGVVAC 132

Sequence Alignment: 32. Allergen Name: Lep d 2.0101 Sequence ID: CAA57160

 Score = 80.8 bits 310,  Expect = 1e-17
 Identities = 46/97 47%, Positives = 65/97 67%, Gaps = 2/97 2%
Query  70   IHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDI 129
            IHRG+  TLEA F ANQ+T    I++ A + G  I VPG++T+ C F+KCP+ KG+  D 
Sbjct  1    IHRGEKMTLEAKFAANQDTAKVTIKVLAKVAGTTIQVPGLETDGCKFIKCPVKKGEALDF 60
Query  130  KYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKI 168
             Y+  +P I PK +   VT +LIGD+GV+AC    HG++
Sbjct  61   IYSGTIPAITPKVK-ADVTAELIGDHGVMACG-TVHGQV 97

Sequence Alignment: 33. Allergen Name: Der f 22.0101 Sequence ID: ABG76195

 Score = 59.3 bits 220,  Expect = 6e-11
 Identities = 47/113 41%, Positives = 64/113 56%, Gaps = 9/113 7%
Query  46   YIHIANNEIKKVMVDGCHGSDP-CIIHRGKPFTLEALFDANQNTKTAKIEIK--ASLDGL 102
            Y    +NEIK   V G + +   C+IH+     L   F AN+NT   KI  +   +L G+
Sbjct  27   YKDCGHNEIKSFFVTGGNPNQKSCVIHKHSKNQLRISFVANENTGN-KINTRFICNLGGI 85
Query  103  EIDVPGID-TNAC--HFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKL-IGDNGVL 158
            E+  PGID T+AC  H + CPL KGQ Y+    +N+    P + NV  TV+L  G  G L
Sbjct  86   ELGWPGIDGTDACQGHGLSCPLTKGQTYNYHLDFNLGDDVP-TANVTATVRLENGHGGDL 144
Query  159  AC 160
             C
Sbjct  145  LC 146

Sequence Alignment: 34. Allergen Name: Can f 7.0101 Sequence ID: Q28895

 Score = 44.6 bits 158,  Expect = 2e-06
 Identities = 28/99 28%, Positives = 55/99 55%, Gaps = 5/99 5%
Query  54   IKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNA 113
            IK++ V+ C  + PC +H+G+ +++   F +N  ++++K  +   + G+ +  P  + + 
Sbjct  34   IKELNVNPCP-AQPCKLHKGQSYSVNVTFTSNIPSQSSKAVVHGIVLGVAVPFPIPEADG 92
Query  114  CHF-MKCPLVKGQQYDIKYTWNVP-KIAPKSENVVVTVKLIGDN 155
            C   + CP+ K + Y   Y   +P K    S  +VV   L+GDN
Sbjct  93   CKSGINCPIQKDKTY--SYLNKLPVKNEYPSIKLVVQWMLLGDN 134

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.