The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

LFLENKDPKPLKKISIMKFIIAFFVATLAVMTVSGEDKKHDYQNEFDFLLMERIHEQIKK
GELALFYLQEQINHFEEKPTKEMKDKIVAEMDTIIAMIDGVRGVLDRLMQRKDLDIFEQY
NLEMAKKSGDILERDLKKEEARVKKIEV
Sequence Info Allergen Name Length Opt Bits Score E Value
CAA35692 Der p 5.0101 148 942 222.0 5.5e-60
P14004 Der p 5.0102 132 839 198.6 5.4e-53
AAB32842 Der p 5.0102 132 832 197.0 1.6e-52
ABO84970 Der f 5.0101 132 653 156.2 3.1e-40
O96870 Blo t 5 134 362 89.8 3e-20
Q9U5P2 Lep d 5.0101 110 257 66.1 3.4e-13
ABH06350 Blo t 21.0101 129 256 65.7 5.2e-13
ABH06348 Blo t 21.0101 129 252 64.8 9.9e-13
ABH06344 Blo t 21.0101 129 251 64.5 1.2e-12
B2GM84 Der f 21.0101 136 251 64.5 1.3e-12
ABH06347 Blo t 21.0101 129 250 64.3 1.4e-12
AAQ73494 Lep d 5.0103 169 251 64.4 1.7e-12
AAQ73493 Lep d 5.0102 171 251 64.4 1.7e-12
ABH06346 Blo t 21.0101 129 246 63.4 2.5e-12
ABC73706 Der p 21.0101 140 245 63.1 3.4e-12
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Der p 5.0101 Sequence ID: CAA35692

 Score = 222.0 bits 942,  Expect = 5e-60
 Identities = 148/148 100%, Positives = 148/148 100%, Gaps = 0/148 0%
Query  1    LFLENKDPKPLKKISIMKFIIAFFVATLAVMTVSGEDKKHDYQNEFDFLLMERIHEQIKK 60
            LFLENKDPKPLKKISIMKFIIAFFVATLAVMTVSGEDKKHDYQNEFDFLLMERIHEQIKK
Sbjct  1    LFLENKDPKPLKKISIMKFIIAFFVATLAVMTVSGEDKKHDYQNEFDFLLMERIHEQIKK 60
Query  61   GELALFYLQEQINHFEEKPTKEMKDKIVAEMDTIIAMIDGVRGVLDRLMQRKDLDIFEQY 120
            GELALFYLQEQINHFEEKPTKEMKDKIVAEMDTIIAMIDGVRGVLDRLMQRKDLDIFEQY
Sbjct  61   GELALFYLQEQINHFEEKPTKEMKDKIVAEMDTIIAMIDGVRGVLDRLMQRKDLDIFEQY 120
Query  121  NLEMAKKSGDILERDLKKEEARVKKIEV 148
            NLEMAKKSGDILERDLKKEEARVKKIEV
Sbjct  121  NLEMAKKSGDILERDLKKEEARVKKIEV 148

Sequence Alignment: 2. Allergen Name: Der p 5.0102 Sequence ID: P14004

 Score = 198.6 bits 839,  Expect = 5e-53
 Identities = 132/132 100%, Positives = 132/132 100%, Gaps = 0/132 0%
Query  17   MKFIIAFFVATLAVMTVSGEDKKHDYQNEFDFLLMERIHEQIKKGELALFYLQEQINHFE 76
            MKFIIAFFVATLAVMTVSGEDKKHDYQNEFDFLLMERIHEQIKKGELALFYLQEQINHFE
Sbjct  1    MKFIIAFFVATLAVMTVSGEDKKHDYQNEFDFLLMERIHEQIKKGELALFYLQEQINHFE 60
Query  77   EKPTKEMKDKIVAEMDTIIAMIDGVRGVLDRLMQRKDLDIFEQYNLEMAKKSGDILERDL 136
            EKPTKEMKDKIVAEMDTIIAMIDGVRGVLDRLMQRKDLDIFEQYNLEMAKKSGDILERDL
Sbjct  61   EKPTKEMKDKIVAEMDTIIAMIDGVRGVLDRLMQRKDLDIFEQYNLEMAKKSGDILERDL 120
Query  137  KKEEARVKKIEV 148
            KKEEARVKKIEV
Sbjct  121  KKEEARVKKIEV 132

Sequence Alignment: 3. Allergen Name: Der p 5.0102 Sequence ID: AAB32842

 Score = 197.0 bits 832,  Expect = 2e-52
 Identities = 131/132 99%, Positives = 131/132 99%, Gaps = 0/132 0%
Query  17   MKFIIAFFVATLAVMTVSGEDKKHDYQNEFDFLLMERIHEQIKKGELALFYLQEQINHFE 76
            MKFIIAFFVATLAVMTVSGEDKKHDYQNEFDFLLMERIHEQIKKGELALFYLQEQINHFE
Sbjct  1    MKFIIAFFVATLAVMTVSGEDKKHDYQNEFDFLLMERIHEQIKKGELALFYLQEQINHFE 60
Query  77   EKPTKEMKDKIVAEMDTIIAMIDGVRGVLDRLMQRKDLDIFEQYNLEMAKKSGDILERDL 136
             KPTKEMKDKIVAEMDTIIAMIDGVRGVLDRLMQRKDLDIFEQYNLEMAKKSGDILERDL
Sbjct  61   AKPTKEMKDKIVAEMDTIIAMIDGVRGVLDRLMQRKDLDIFEQYNLEMAKKSGDILERDL 120
Query  137  KKEEARVKKIEV 148
            KKEEARVKKIEV
Sbjct  121  KKEEARVKKIEV 132

Sequence Alignment: 4. Allergen Name: Der f 5.0101 Sequence ID: ABO84970

 Score = 156.2 bits 653,  Expect = 3e-40
 Identities = 102/132 77%, Positives = 118/132 89%, Gaps = 0/132 0%
Query  17   MKFIIAFFVATLAVMTVSGEDKKHDYQNEFDFLLMERIHEQIKKGELALFYLQEQINHFE 76
            MKFIIA  V TLAV+ VSGE KKHDYQNEFDFLLM+RIHEQ++KGE AL++LQ QIN FE
Sbjct  1    MKFIIAIAVCTLAVVCVSGEPKKHDYQNEFDFLLMQRIHEQMRKGEEALLHLQHQINTFE 60
Query  77   EKPTKEMKDKIVAEMDTIIAMIDGVRGVLDRLMQRKDLDIFEQYNLEMAKKSGDILERDL 136
            E PTKEMK++I+ EMDTIIA+IDGVRGVL+RLM+R DLDIFE+YN+E+A KS +ILERDL
Sbjct  61   ENPTKEMKEQILGEMDTIIALIDGVRGVLNRLMKRTDLDIFERYNVEIALKSNEILERDL 120
Query  137  KKEEARVKKIEV 148
            KKEE RVKKIEV
Sbjct  121  KKEEQRVKKIEV 132

Sequence Alignment: 5. Allergen Name: Blo t 5 Sequence ID: O96870

 Score = 89.8 bits 362,  Expect = 3e-20
 Identities = 58/129 44%, Positives = 93/129 72%, Gaps = 5/129 3%
Query  17   MKF---IIAFFVATLAVMTVSGEDKKHDYQNEFDFLLMERIHEQIKKGELALFYLQEQIN 73
            MKF   +IA F A+  V+    + KK D++NEFD LL+E+ +  I+KGE  L+YLQ Q++
Sbjct  1    MKFAIVLIACFAAS--VLAQEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLD 58
Query  74   HFEEKPTKEMKDKIVAEMDTIIAMIDGVRGVLDRLMQRKDLDIFEQYNLEMAKKSGDILE 133
             + E  +KE+++KI+ E+D + AMI+G +G L+R ++R DL+I+E++N E A+    IL 
Sbjct  59   ELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLSKILL 118
Query  134  RDLKKEEARVKKIE 147
            +DLK+ E +VK I+
Sbjct  119  KDLKETEQKVKDIQ 132

Sequence Alignment: 6. Allergen Name: Lep d 5.0101 Sequence ID: Q9U5P2

 Score = 66.1 bits 257,  Expect = 3e-13
 Identities = 40/107 37%, Positives = 67/107 62%, Gaps = 0/107 0%
Query  41   DYQNEFDFLLMERIHEQIKKGELALFYLQEQINHFEEKPTKEMKDKIVAEMDTIIAMIDG 100
            D++NEFD LL+    EQ  K E AL +L  Q+  +E+  +KE+K +I+ E+   +  ID 
Sbjct  2    DFRNEFDRLLIHMTEEQFAKLEQALAHLSHQVTELEKSKSKELKAQILREISIGLDFIDS 61
Query  101  VRGVLDRLMQRKDLDIFEQYNLEMAKKSGDILERDLKKEEARVKKIE 147
             +G ++R ++R DL++ E++N+E A  +G +L +DL     +VK IE
Sbjct  62   AKGHFERELKRADLNLAEKFNFESALSTGAVLHKDLTALATKVKAIE 108

Sequence Alignment: 7. Allergen Name: Blo t 21.0101 Sequence ID: ABH06350

 Score = 65.7 bits 256,  Expect = 5e-13
 Identities = 43/127 33%, Positives = 82/127 64%, Gaps = 6/127 4%
Query  17   MKFIIAF--FVATLAVMTVSGEDKKHDYQNEFDFLLMERIHEQIKKGELALFYLQEQINH 74
            MKFIIA+  ++A    + VS ++ +H    EFD +++    ++  + E  L+++  +++ 
Sbjct  1    MKFIIALAALIAVACALPVSNDNFRH----EFDHMIVNTATQRFHEIEKFLLHITHEVDD 56
Query  75   FEEKPTKEMKDKIVAEMDTIIAMIDGVRGVLDRLMQRKDLDIFEQYNLEMAKKSGDILER 134
            +EE   K+ K +++ E+    A I+G RG + R ++R DLD++E++N+E A  +GD+L +
Sbjct  57   LEETGNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLK 116
Query  135  DLKKEEARVKKIE 147
            DLK  + RV+  E
Sbjct  117  DLKALQKRVQDSE 129

Sequence Alignment: 8. Allergen Name: Blo t 21.0101 Sequence ID: ABH06348

 Score = 64.8 bits 252,  Expect = 1e-12
 Identities = 42/127 33%, Positives = 82/127 64%, Gaps = 6/127 4%
Query  17   MKFIIAF--FVATLAVMTVSGEDKKHDYQNEFDFLLMERIHEQIKKGELALFYLQEQINH 74
            MKFIIA+  ++A    + VS ++ +H    EFD +++    ++  + E  L+++  +++ 
Sbjct  1    MKFIIALAALIAVACALPVSNDNFRH----EFDHMIINTATQRFHEIEKFLLHITHEVDD 56
Query  75   FEEKPTKEMKDKIVAEMDTIIAMIDGVRGVLDRLMQRKDLDIFEQYNLEMAKKSGDILER 134
            +E+   K+ K +++ E+    A I+G RG + R ++R DLD++E++N+E A  +GD+L +
Sbjct  57   LEKTGNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLK 116
Query  135  DLKKEEARVKKIE 147
            DLK  + RV+  E
Sbjct  117  DLKALQKRVQDSE 129

Sequence Alignment: 9. Allergen Name: Blo t 21.0101 Sequence ID: ABH06344

 Score = 64.5 bits 251,  Expect = 1e-12
 Identities = 42/127 33%, Positives = 82/127 64%, Gaps = 6/127 4%
Query  17   MKFIIAF--FVATLAVMTVSGEDKKHDYQNEFDFLLMERIHEQIKKGELALFYLQEQINH 74
            MKFIIA+  ++A    + VS ++ +H    EFD +++    ++  + E  L+++  +++ 
Sbjct  1    MKFIIALAALIAVACALPVSNDNFRH----EFDHMIVNTATQRFHEIEKFLLHITHEVDD 56
Query  75   FEEKPTKEMKDKIVAEMDTIIAMIDGVRGVLDRLMQRKDLDIFEQYNLEMAKKSGDILER 134
            +E+   K+ K +++ E+    A I+G RG + R ++R DLD++E++N+E A  +GD+L +
Sbjct  57   LEKTGNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLK 116
Query  135  DLKKEEARVKKIE 147
            DLK  + RV+  E
Sbjct  117  DLKALQKRVQDSE 129

Sequence Alignment: 10. Allergen Name: Der f 21.0101 Sequence ID: B2GM84

 Score = 64.5 bits 251,  Expect = 1e-12
 Identities = 45/129 34%, Positives = 79/129 61%, Gaps = 6/129 4%
Query  17   MKFIIAFFVATLAVMTVSGE----DKKHDYQNEFDFLLMERIHEQIKKGELALFYLQEQI 72
            MKFII  F A +  ++VSG     D +  ++N FD +LME   E++ + E  L+ L EQ 
Sbjct  1    MKFII--FCAIVMAVSVSGFIVDVDTEDKWRNAFDHMLMEEFEEKMDQIEHGLLMLSEQY 58
Query  73   NHFEEKPTKEMKDKIVAEMDTIIAMIDGVRGVLDRLMQRKDLDIFEQYNLEMAKKSGDIL 132
              +E+  +KE+K++I+ E+      + G    + +  +R DL++FE+YN+E A  + +IL
Sbjct  59   KELEKTKSKELKEQILRELTIAENYLRGALKFMQQEAKRTDLNMFERYNFETAVSTIEIL 118
Query  133  ERDLKKEEARVKKIE 147
             +DL +   +VK ++
Sbjct  119  VKDLAELAKKVKAVK 133

Sequence Alignment: 11. Allergen Name: Blo t 21.0101 Sequence ID: ABH06347

 Score = 64.3 bits 250,  Expect = 1e-12
 Identities = 42/127 33%, Positives = 82/127 64%, Gaps = 6/127 4%
Query  17   MKFIIAF--FVATLAVMTVSGEDKKHDYQNEFDFLLMERIHEQIKKGELALFYLQEQINH 74
            MKFIIA+  ++A    + VS ++ +H    EFD +++    ++  + E  L+++  +++ 
Sbjct  1    MKFIIALAALIAVACALPVSNDNFRH----EFDHMIVNAATQRFHEIEKFLLHITHEVDD 56
Query  75   FEEKPTKEMKDKIVAEMDTIIAMIDGVRGVLDRLMQRKDLDIFEQYNLEMAKKSGDILER 134
            +E+   K+ K +++ E+    A I+G RG + R ++R DLD++E++N+E A  +GD+L +
Sbjct  57   LEKTGNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLK 116
Query  135  DLKKEEARVKKIE 147
            DLK  + RV+  E
Sbjct  117  DLKALQKRVQDSE 129

Sequence Alignment: 12. Allergen Name: Lep d 5.0103 Sequence ID: AAQ73494

 Score = 64.4 bits 251,  Expect = 2e-12
 Identities = 39/107 36%, Positives = 67/107 62%, Gaps = 0/107 0%
Query  41   DYQNEFDFLLMERIHEQIKKGELALFYLQEQINHFEEKPTKEMKDKIVAEMDTIIAMIDG 100
            +++NEFD LL+    EQ  K E AL +L  Q+  +E+  +KE+K +I+ E+   +  ID 
Sbjct  61   EFRNEFDRLLIHMTEEQFAKLEQALAHLSHQVTELEKSKSKELKAQILREISIGLDFIDS 120
Query  101  VRGVLDRLMQRKDLDIFEQYNLEMAKKSGDILERDLKKEEARVKKIE 147
             +G ++R ++R DL++ E++N+E A  +G +L +DL     +VK IE
Sbjct  121  AKGHFERELKRADLNLAEKFNFESALSTGAVLHKDLTALATKVKAIE 167

Sequence Alignment: 13. Allergen Name: Lep d 5.0102 Sequence ID: AAQ73493

 Score = 64.4 bits 251,  Expect = 2e-12
 Identities = 39/107 36%, Positives = 67/107 62%, Gaps = 0/107 0%
Query  41   DYQNEFDFLLMERIHEQIKKGELALFYLQEQINHFEEKPTKEMKDKIVAEMDTIIAMIDG 100
            +++NEFD LL+    EQ  K E AL +L  Q+  +E+  +KE+K +I+ E+   +  ID 
Sbjct  63   EFRNEFDRLLIHMTEEQFAKLEQALAHLSHQVTELEKSKSKELKAQILREISIGLDFIDS 122
Query  101  VRGVLDRLMQRKDLDIFEQYNLEMAKKSGDILERDLKKEEARVKKIE 147
             +G ++R ++R DL++ E++N+E A  +G +L +DL     +VK IE
Sbjct  123  AKGHFERELKRADLNLAEKFNFESALSTGAVLHKDLTALATKVKAIE 169

Sequence Alignment: 14. Allergen Name: Blo t 21.0101 Sequence ID: ABH06346

 Score = 63.4 bits 246,  Expect = 3e-12
 Identities = 42/127 33%, Positives = 81/127 63%, Gaps = 6/127 4%
Query  17   MKFIIAF--FVATLAVMTVSGEDKKHDYQNEFDFLLMERIHEQIKKGELALFYLQEQINH 74
            MKFIIA+  ++A    + VS ++ +H    EFD +++    ++  + E  L+++  +++ 
Sbjct  1    MKFIIALAALIAVACALPVSNDNFRH----EFDHMIVNTATQRFHEIEKFLLHITHEVDD 56
Query  75   FEEKPTKEMKDKIVAEMDTIIAMIDGVRGVLDRLMQRKDLDIFEQYNLEMAKKSGDILER 134
            +E+   K+ K + + E+    A I+G RG + R ++R DLD++E++N+E A  +GD+L +
Sbjct  57   LEKTGNKDEKARPLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLK 116
Query  135  DLKKEEARVKKIE 147
            DLK  + RV+  E
Sbjct  117  DLKALQKRVQDSE 129

Sequence Alignment: 15. Allergen Name: Der p 21.0101 Sequence ID: ABC73706

 Score = 63.1 bits 245,  Expect = 3e-12
 Identities = 46/130 35%, Positives = 77/130 59%, Gaps = 4/130 3%
Query  17   MKFIIAFFVATLAVMTVSGE---DKKHD-YQNEFDFLLMERIHEQIKKGELALFYLQEQI 72
            MKFII +F A +    VSG    DKK D ++  FD L+ME +  +I + E  L++L EQ 
Sbjct  1    MKFIITLFAAIVMAAAVSGFIVGDKKEDEWRMAFDRLMMEELETKIDQVEKGLLHLSEQY 60
Query  73   NHFEEKPTKEMKDKIVAEMDTIIAMIDGVRGVLDRLMQRKDLDIFEQYNLEMAKKSGDIL 132
              +E+  +KE+K++I+ E+      + G    ++   +R DL++FE+YN E A +S  +L
Sbjct  61   KELEKTKSKELKEQILRELTIGENFMKGALKFFEMEAKRTDLNMFERYNYEFALESIKLL 120
Query  133  ERDLKKEEARVKKI 146
             + L +   +VK +
Sbjct  121  IKKLDELAKKVKAV 134

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.