The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG
LNQGNAAALPGRCGVSIPYKISTSTNCATIKF
Sequence Info Allergen Name Length Opt Bits Score E Value
ABX75045 Ara h 9.0201 92 629 123.5 9.1e-31
ABX56711 Ara h 9.0101 116 568 112.5 2.4e-27
ADC80503 Pha v 3.0201 118 458 92.4 2.7e-21
A0AT29 Len c 3.0101 118 443 89.7 1.8e-20
Q4PLT9 Fra a 3.0102 117 442 89.5 2e-20
Q8VX12 Fra a 3.0101 117 434 88.0 5.5e-20
A0A161AT60 Pis s 3.0101 120 434 88.1 5.6e-20
ADC80502 Pha v 3.0101 115 433 87.9 6.1e-20
Q9M5X7 Mal d 3 115 428 87.0 1.2e-19
P85894 Mor n 3.0101 91 423 86.0 1.8e-19
Q4PLU0 Fra a 3.0201 117 422 85.9 2.5e-19
Q9M5X6 Pyr c 3 115 417 84.9 4.6e-19
P82534 Pru d 3 91 414 84.3 5.6e-19
Q0Z8V0 Rub i 3.0101 117 415 84.6 6e-19
AAL25839 Hev b 12 116 414 84.4 6.8e-19
XP_019446786 Lup an 3.0101 116 413 84.2 7.7e-19
Q4PLT6 Fra a 3.0202 117 413 84.2 7.8e-19
CAB96876 Pru p 3 91 411 83.8 8.2e-19
Q9M5X8 Pru av 3 117 412 84.0 8.8e-19
P81402 Pru p 3 91 409 83.4 1.1e-18
P19656-1 Zea m 14.0101 120 410 83.7 1.2e-18
P81651 Pru ar 3 91 405 82.7 1.8e-18
P19656-2 Zea m 14.0102 128 407 83.2 1.8e-18
A0A510A9S3 Ara h 17.0101 93 404 82.5 2e-18
AAB42069 Lyc e 3 114 404 82.6 2.4e-18
P93224 Sola l 3.0101 114 404 82.6 2.4e-18
W0U0V5 Can s 3.0101 91 401 82.0 2.9e-18
A0A059SSZ0 Pun g 1.0201 120 390 80.0 1.4e-17
ACV04796 Api g 2 118 375 77.3 9.5e-17
AAK28533 Cor a 8 115 370 76.4 1.8e-16
A0A059STC4 Pun g 1.0101 120 370 76.4 1.8e-16
CAH69206 Tri tu 14.0101 115 369 76.2 2e-16
CAL07989 Pla a 3.0101 118 362 74.9 4.9e-16
A0A059ST23 Pun g 1.0301 120 362 74.9 5e-16
ACN11576 Pru du 3.0101 123 361 74.8 5.8e-16
ABY21307 Pla or 3.0101 118 358 74.2 8.1e-16
ANC85018 Art an 3.0102 117 352 73.1 1.7e-15
AAA32970 Hor v 1 117 351 72.9 2e-15
ANC85021 Art ca 3.0101 117 348 72.4 2.9e-15
ANC85017 Art an 3.0101 117 348 72.4 2.9e-15
ANC85023 Art gm 3.0102 117 348 72.4 2.9e-15
ABU95411 Sin a 3.0101 92 345 71.8 3.5e-15
CAA42832 Hor v 1 134 347 72.2 3.6e-15
ANC85022 Art gm 3.0101 117 346 72.0 3.7e-15
NP_001316123 Sola l 7.0101 115 344 71.6 4.7e-15
QIN55516 Art ca 3.0102 117 344 71.6 4.7e-15
19846220 Tri a 14.0101 90 335 69.9 1.2e-14
ANC85027 Art si 3.0102 116 336 70.2 1.3e-14
ACE07187 Art v 3.0202 116 336 70.2 1.3e-14
ANC85020 Art ar 3.0102 116 336 70.2 1.3e-14
ANC85025 Art la 3.0102 115 327 68.5 4e-14
EU564847 Art v 3.0301 117 327 68.6 4.1e-14
EU564845 Art v 3.0201 114 321 67.4 8.5e-14
ANC85024 Art la 3.0101 116 321 67.5 8.6e-14
ANC85019 Art ar 3.0101 116 321 67.5 8.6e-14
ANC85026 Art si 3.0101 116 318 66.9 1.3e-13
P82007 Hel a 3.0101 116 293 62.4 3e-12
O04004 Amb a 6 118 203 46.0 2.6e-07
O04403 Par j 2 133 203 46.0 2.8e-07
Q40905 Par j 1 138 194 44.4 9.1e-07
P43217 Par j 1 139 191 43.8 1.3e-06
O04404 Par j 1 176 192 44.1 1.4e-06
P55958 Par j 2 133 189 43.4 1.7e-06
CAI94601 Par j 1.0103 139 189 43.5 1.7e-06
CAA54587 Par j 1.0101 133 172 40.3 1.4e-05
P80274 Vit v 1 37 137 33.6 0.00044
P0C088 Art v 3.0101 37 130 32.3 0.0011
10998016 Cas s 8 36 122 30.8 0.0028
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ara h 9.0201 Sequence ID: ABX75045

 Score = 123.5 bits 629,  Expect = 9e-31
 Identities = 92/92 100%, Positives = 92/92 100%, Gaps = 0/92 0%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG
Sbjct  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIKF 92
            LNQGNAAALPGRCGVSIPYKISTSTNCATIKF
Sbjct  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIKF 92

Sequence Alignment: 2. Allergen Name: Ara h 9.0101 Sequence ID: ABX56711

 Score = 112.5 bits 568,  Expect = 2e-27
 Identities = 83/92 90%, Positives = 85/92 92%, Gaps = 0/92 0%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            +SCGQVNSALAPCI FLTKGG P   CCSGVRGLLGA +TTADRQAACNCLKAAAGSL G
Sbjct  25   ISCGQVNSALAPCIPFLTKGGAPPPACCSGVRGLLGALRTTADRQAACNCLKAAAGSLRG 84
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIKF 92
            LNQGNAAALPGRCGVSIPYKISTSTNCATIKF
Sbjct  85   LNQGNAAALPGRCGVSIPYKISTSTNCATIKF 116

Sequence Alignment: 3. Allergen Name: Pha v 3.0201 Sequence ID: ADC80503

 Score = 92.4 bits 458,  Expect = 3e-21
 Identities = 67/92 72%, Positives = 74/92 80%, Gaps = 0/92 0%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            +SCGQV S+LA CI FLTKGG     CCSGVR L  AAKTT DRQA CNCLK+AAG++ G
Sbjct  27   ISCGQVTSSLASCIPFLTKGGPVPASCCSGVRSLNAAAKTTPDRQAVCNCLKSAAGAIPG 86
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIKF 92
            +N  NA  LPG+CGVSIPYKISTSTNCATIKF
Sbjct  87   FNANNAGILPGKCGVSIPYKISTSTNCATIKF 118

Sequence Alignment: 4. Allergen Name: Len c 3.0101 Sequence ID: A0AT29

 Score = 89.7 bits 443,  Expect = 2e-20
 Identities = 63/92 68%, Positives = 74/92 80%, Gaps = 0/92 0%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            +SCG V S L+PC+T+LT G  PS  CC GV+ LL AA TT DRQAACNCLK+AAGS+  
Sbjct  27   ISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITK 86
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIKF 92
            LN  NAAALPG+CGV+IPYKIST+TNC T+KF
Sbjct  87   LNTNNAAALPGKCGVNIPYKISTTTNCNTVKF 118

Sequence Alignment: 5. Allergen Name: Fra a 3.0102 Sequence ID: Q4PLT9

 Score = 89.5 bits 442,  Expect = 2e-20
 Identities = 58/91 63%, Positives = 71/91 78%, Gaps = 0/91 0%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            ++CGQV S ++PC+T++  GG    PCCSG+R L G AKTTADRQA CNCLK AAG + G
Sbjct  27   ITCGQVASNISPCVTYVKSGGAVPAPCCSGIRNLNGMAKTTADRQATCNCLKQAAGGIKG 86
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
            LN   AA LPG+CGVS+PYKIST+TNCA +K
Sbjct  87   LNPNLAAGLPGKCGVSVPYKISTTTNCAAVK 117

Sequence Alignment: 6. Allergen Name: Fra a 3.0101 Sequence ID: Q8VX12

 Score = 88.0 bits 434,  Expect = 5e-20
 Identities = 58/91 63%, Positives = 71/91 78%, Gaps = 0/91 0%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            ++CGQV S ++PC+T++  GG     CCSG+R L G AKTTADRQAACNCLK AAG + G
Sbjct  27   ITCGQVASNISPCLTYVKSGGAVPAACCSGIRNLNGMAKTTADRQAACNCLKQAAGGIKG 86
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
            LN   AA LPG+CGVS+PYKIST+TNCA +K
Sbjct  87   LNPNLAAGLPGKCGVSVPYKISTTTNCAAVK 117

Sequence Alignment: 7. Allergen Name: Pis s 3.0101 Sequence ID: A0A161AT60

 Score = 88.1 bits 434,  Expect = 6e-20
 Identities = 62/92 67%, Positives = 74/92 80%, Gaps = 2/92 2%
Query  1    LSCGQVNSALAPCITFLT--KGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSL 58
            LSCG V++ +APC+T+L       P  PCC+GV+ LL AA TT DRQAACNCLK+AAGS+
Sbjct  27   LSCGTVSADMAPCVTYLQAPNNASPPPPCCAGVKKLLAAATTTPDRQAACNCLKSAAGSI 86
Query  59   HGLNQGNAAALPGRCGVSIPYKISTSTNCATIKF 92
              LN  NAAALPG+CGVSIPYKISTSTNC T++F
Sbjct  87   PKLNTNNAAALPGKCGVSIPYKISTSTNCNTVRF 120

Sequence Alignment: 8. Allergen Name: Pha v 3.0101 Sequence ID: ADC80502

 Score = 87.9 bits 433,  Expect = 6e-20
 Identities = 59/89 66%, Positives = 75/89 84%, Gaps = 2/89 2%
Query  1    LSCGQVNSALAPCITFLTKGG-VPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLH 59
            ++CGQV S L PC+TFL  GG VP+G CC+GVR ++ +A++TADR+  CNCLK AAG++ 
Sbjct  25   MTCGQVQSNLVPCVTFLQNGGFVPAG-CCNGVRNIMNSARSTADRRGICNCLKTAAGAVR 83
Query  60   GLNQGNAAALPGRCGVSIPYKISTSTNCATI 90
            GLN  NA ALPG+CGV+IPYKISTSTNCA+I
Sbjct  84   GLNPNNAQALPGKCGVNIPYKISTSTNCASI 114

Sequence Alignment: 9. Allergen Name: Mal d 3 Sequence ID: Q9M5X7

 Score = 87.0 bits 428,  Expect = 1e-19
 Identities = 57/91 62%, Positives = 72/91 79%, Gaps = 0/91 0%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            ++CGQV S+LAPCI ++  GG     CC+G+R + G A+TTADRQ ACNCLK  AGS+ G
Sbjct  25   ITCGQVTSSLAPCIGYVRSGGAVPPACCNGIRTINGLARTTADRQTACNCLKNLAGSISG 84
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
            +N  NAA LPG+CGV++PYKISTSTNCAT+K
Sbjct  85   VNPNNAAGLPGKCGVNVPYKISTSTNCATVK 115

Sequence Alignment: 10. Allergen Name: Mor n 3.0101 Sequence ID: P85894

 Score = 86.0 bits 423,  Expect = 2e-19
 Identities = 59/91 64%, Positives = 72/91 79%, Gaps = 0/91 0%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            ++CGQV+S+LAPCI +L  GGV    CC+GVR L  AAKTTADRQAACNCLK+A  S+ G
Sbjct  1    ITCGQVSSSLAPCINYLRAGGVVPANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKG 60
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
            LN   AA LPG+CGVS+PYKIS ST+C ++K
Sbjct  61   LNLNLAAGLPGKCGVSVPYKISPSTDCKSVK 91

Sequence Alignment: 11. Allergen Name: Fra a 3.0201 Sequence ID: Q4PLU0

 Score = 85.9 bits 422,  Expect = 2e-19
 Identities = 55/91 60%, Positives = 71/91 78%, Gaps = 0/91 0%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            ++CGQV S+++PC+ ++  GG     CC+G+R L  AAKTTADRQA CNCLK A+G++ G
Sbjct  27   ITCGQVASSISPCVNYVKSGGAVPAACCNGIRSLNSAAKTTADRQATCNCLKQASGAIKG 86
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
            LN   AA LPG+CGVS+PYKISTSTNCA +K
Sbjct  87   LNPSLAAGLPGKCGVSVPYKISTSTNCAAVK 117

Sequence Alignment: 12. Allergen Name: Pyr c 3 Sequence ID: Q9M5X6

 Score = 84.9 bits 417,  Expect = 5e-19
 Identities = 55/91 60%, Positives = 72/91 79%, Gaps = 0/91 0%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            ++C QV++ LAPCI ++  GG     CC+G++ + G AKTT DRQAACNCLK  AGS+ G
Sbjct  25   ITCSQVSANLAPCINYVRSGGAVPPACCNGIKTINGLAKTTPDRQAACNCLKNLAGSVSG 84
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
            +N GNA +LPG+CGV++PYKISTSTNCAT+K
Sbjct  85   VNPGNAESLPGKCGVNVPYKISTSTNCATVK 115

Sequence Alignment: 13. Allergen Name: Pru d 3 Sequence ID: P82534

 Score = 84.3 bits 414,  Expect = 6e-19
 Identities = 55/91 60%, Positives = 72/91 79%, Gaps = 0/91 0%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            ++CGQV+S LAPCI ++  GG     CC+G+R +   A+TTADR+AACNCLK  +GS+ G
Sbjct  1    ITCGQVSSNLAPCINYVKGGGAVPPACCNGIRNVNNLARTTADRRAACNCLKQLSGSIPG 60
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
            +N  NAAALPG+CGV++PYKIS STNCAT+K
Sbjct  61   VNPNNAAALPGKCGVNVPYKISASTNCATVK 91

Sequence Alignment: 14. Allergen Name: Rub i 3.0101 Sequence ID: Q0Z8V0

 Score = 84.6 bits 415,  Expect = 6e-19
 Identities = 57/91 62%, Positives = 67/91 73%, Gaps = 0/91 0%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            ++CGQV   +APC  ++  GG     CC+GVR L   AKTTADRQ  CNCLK AAGS+ G
Sbjct  27   ITCGQVTQNVAPCFNYVKNGGAVPAACCNGVRNLNSQAKTTADRQQTCNCLKNAAGSIPG 86
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
            LN   AA LPG+CGVS+PYKISTSTNCAT+K
Sbjct  87   LNPSLAAGLPGKCGVSVPYKISTSTNCATVK 117

Sequence Alignment: 15. Allergen Name: Hev b 12 Sequence ID: AAL25839

 Score = 84.4 bits 414,  Expect = 7e-19
 Identities = 58/91 63%, Positives = 71/91 78%, Gaps = 1/91 1%
Query  1    LSCGQVNSALAPCITFL-TKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLH 59
            ++CGQV SAL PC+++L T G  P   CC+GVR +  AAKTTADR+ AC CLK+AAGS+ 
Sbjct  25   ITCGQVQSALVPCLSYLKTTGPTPPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVK 84
Query  60   GLNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
            GLN    A LPG+CGV+IPYKIS STNCAT+K
Sbjct  85   GLNPTTVAGLPGKCGVNIPYKISLSTNCATVK 116

Sequence Alignment: 16. Allergen Name: Lup an 3.0101 Sequence ID: XP_019446786

 Score = 84.2 bits 413,  Expect = 8e-19
 Identities = 55/91 60%, Positives = 70/91 76%, Gaps = 0/91 0%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            ++CGQV + LA C+ +L  GG    PCC+G++ +L  AKTT DR+ ACNCLKAAA +  G
Sbjct  26   ITCGQVTANLAQCLNYLRSGGAVPAPCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPG 85
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
            LN  NA +LPG+CGV+IPYKISTSTNCA+IK
Sbjct  86   LNPSNAGSLPGKCGVNIPYKISTSTNCASIK 116

Sequence Alignment: 17. Allergen Name: Fra a 3.0202 Sequence ID: Q4PLT6

 Score = 84.2 bits 413,  Expect = 8e-19
 Identities = 53/91 58%, Positives = 70/91 76%, Gaps = 0/91 0%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            ++CGQV S+++PC+ ++  GG     CC+G+R L  AAKTTADRQ  CNCLK A+G++ G
Sbjct  27   ITCGQVASSISPCVNYVKSGGAVPAACCNGIRSLNSAAKTTADRQTTCNCLKQASGAIKG 86
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
            LN   AA LPG+CGV++PYKISTSTNCA +K
Sbjct  87   LNPNLAAGLPGKCGVNVPYKISTSTNCAAVK 117

Sequence Alignment: 18. Allergen Name: Pru p 3 Sequence ID: CAB96876

 Score = 83.8 bits 411,  Expect = 8e-19
 Identities = 56/91 61%, Positives = 71/91 78%, Gaps = 0/91 0%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            ++CGQV+S+LAPCI ++  GG     CC+G+R +   A+TT DRQAACNCLK  + S+ G
Sbjct  1    ITCGQVSSSLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
            +N  NAAALPG+CGVSIPYKIS STNCAT+K
Sbjct  61   VNPNNAAALPGKCGVSIPYKISASTNCATVK 91

Sequence Alignment: 19. Allergen Name: Pru av 3 Sequence ID: Q9M5X8

 Score = 84.0 bits 412,  Expect = 9e-19
 Identities = 56/91 61%, Positives = 70/91 76%, Gaps = 0/91 0%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            L+CGQV+S LAPCI ++  GG     CC+G+R +   AKTTADRQ ACNCLK  + S+ G
Sbjct  27   LTCGQVSSNLAPCIAYVRGGGAVPPACCNGIRNINNLAKTTADRQTACNCLKQLSASVPG 86
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
            +N  NAAALPG+CGV++PYKIS STNCAT+K
Sbjct  87   VNANNAAALPGKCGVNVPYKISPSTNCATVK 117

Sequence Alignment: 20. Allergen Name: Pru p 3 Sequence ID: P81402

 Score = 83.4 bits 409,  Expect = 1e-18
 Identities = 56/91 61%, Positives = 70/91 76%, Gaps = 0/91 0%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            ++CGQV+SALAPCI ++  GG     CC+G+R +   A+TT DRQAACNCLK  + S+ G
Sbjct  1    ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPG 60
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
            +N  NAAALPG+CGV IPYKIS STNCAT+K
Sbjct  61   VNPNNAAALPGKCGVHIPYKISASTNCATVK 91

Sequence Alignment: 21. Allergen Name: Zea m 14.0101 Sequence ID: P19656-1

 Score = 83.7 bits 410,  Expect = 1e-18
 Identities = 58/90 64%, Positives = 72/90 80%, Gaps = 1/90 1%
Query  1    LSCGQVNSALAPCITFLT-KGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLH 59
            +SCGQV SA+APCI++   +G  PS  CCSGVR L  AA+TTADR+AACNCLK AA  + 
Sbjct  29   ISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVS 88
Query  60   GLNQGNAAALPGRCGVSIPYKISTSTNCATI 90
            GLN GNAA++P +CGVSIPY ISTST+C+ +
Sbjct  89   GLNAGNAASIPSKCGVSIPYTISTSTDCSRV 119

Sequence Alignment: 22. Allergen Name: Pru ar 3 Sequence ID: P81651

 Score = 82.7 bits 405,  Expect = 2e-18
 Identities = 54/91 59%, Positives = 71/91 78%, Gaps = 0/91 0%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            ++CGQV+S+LAPCI ++  GG     CC+G+R +   A+TT DR+ ACNCLK  +GS+ G
Sbjct  1    ITCGQVSSSLAPCIGYVRGGGAVPPACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISG 60
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
            +N  NAAALPG+CGV+IPYKIS STNCAT+K
Sbjct  61   VNPNNAAALPGKCGVNIPYKISASTNCATVK 91

Sequence Alignment: 23. Allergen Name: Zea m 14.0102 Sequence ID: P19656-2

 Score = 83.2 bits 407,  Expect = 2e-18
 Identities = 58/88 65%, Positives = 71/88 80%, Gaps = 1/88 1%
Query  1    LSCGQVNSALAPCITFLT-KGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLH 59
            +SCGQV SA+APCI++   +G  PS  CCSGVR L  AA+TTADR+AACNCLK AA  + 
Sbjct  29   ISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVS 88
Query  60   GLNQGNAAALPGRCGVSIPYKISTSTNCA 88
            GLN GNAA++P +CGVSIPY ISTST+C+
Sbjct  89   GLNAGNAASIPSKCGVSIPYTISTSTDCS 117

Sequence Alignment: 24. Allergen Name: Ara h 17.0101 Sequence ID: A0A510A9S3

 Score = 82.5 bits 404,  Expect = 2e-18
 Identities = 56/91 61%, Positives = 70/91 76%, Gaps = 1/91 1%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            + C  V  ++APC  +L  GG  SGPCCSG++ + G AKTT+DRQA CNCLK+AA SL  
Sbjct  2    IQCSFVTKSIAPCFGYLKSGGTVSGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGS 61
Query  61   -LNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
             +N  NAA+LPG+CGVSIPYKISTS NC++IK
Sbjct  62   QINPNNAASLPGKCGVSIPYKISTSINCSSIK 93

Sequence Alignment: 25. Allergen Name: Lyc e 3 Sequence ID: AAB42069

 Score = 82.6 bits 404,  Expect = 2e-18
 Identities = 56/90 62%, Positives = 71/90 78%, Gaps = 1/90 1%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            LSCG+V S LAPC+ +L +G  P G CC GV+GLLGAAKT  DR+ AC CLK+AA S+ G
Sbjct  25   LSCGEVTSGLAPCLPYL-EGRGPLGGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKG 83
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
            ++ G AA LPG CGV+IPYKIS ST+C+T++
Sbjct  84   IDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114

Sequence Alignment: 26. Allergen Name: Sola l 3.0101 Sequence ID: P93224

 Score = 82.6 bits 404,  Expect = 2e-18
 Identities = 56/90 62%, Positives = 71/90 78%, Gaps = 1/90 1%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            LSCG+V S LAPC+ +L +G  P G CC GV+GLLGAAKT  DR+ AC CLK+AA S+ G
Sbjct  25   LSCGEVTSGLAPCLPYL-EGRGPLGGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKG 83
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
            ++ G AA LPG CGV+IPYKIS ST+C+T++
Sbjct  84   IDTGKAAGLPGVCGVNIPYKISPSTDCSTVQ 114

Sequence Alignment: 27. Allergen Name: Can s 3.0101 Sequence ID: W0U0V5

 Score = 82.0 bits 401,  Expect = 3e-18
 Identities = 56/90 62%, Positives = 74/90 82%, Gaps = 2/90 2%
Query  1    LSCGQVNSALAPCITFLTKGG-VPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLH 59
            ++CGQV S+LAPC+++L  GG VP G CC+ ++ L GAAKT ADRQAAC CLK+AA S+ 
Sbjct  1    ITCGQVASSLAPCLSYLKVGGAVPDG-CCNDIKSLSGAAKTPADRQAACKCLKSAASSIK 59
Query  60   GLNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
            G+N   A+ LPG+CGVSIPYKIS ST+C+++K
Sbjct  60   GVNFNLASGLPGKCGVSIPYKISPSTDCSSVK 91

Sequence Alignment: 28. Allergen Name: Pun g 1.0201 Sequence ID: A0A059SSZ0

 Score = 80.0 bits 390,  Expect = 1e-17
 Identities = 57/90 63%, Positives = 68/90 75%, Gaps = 3/90 3%
Query  1    LSCGQVNSALAPCITFLTKGGV--PSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSL 58
            ++CGQV S+L PCI +  +G V  PS  CCSGVR L  AAKTT DRQ ACNCLK  A S+
Sbjct  29   VTCGQVTSSLTPCIPY-ARGVVAAPSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSI 87
Query  59   HGLNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
             G+N G   ALPG+CGVSIPYKIS ST+C+ +K
Sbjct  88   TGINYGRVGALPGKCGVSIPYKISPSTDCSRVK 120

Sequence Alignment: 29. Allergen Name: Api g 2 Sequence ID: ACV04796

 Score = 77.3 bits 375,  Expect = 1e-16
 Identities = 50/90 55%, Positives = 63/90 70%, Gaps = 0/90 0%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            L+CGQV   L  C+ +L  GG PS  CC GV+GL   AKT ADR+ AC CLK  AGS+ G
Sbjct  28   LTCGQVTGKLGGCLGYLKGGGYPSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKG 87
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCATI 90
            +N G A+ALPG+CG+ IPY IS ST+C+ +
Sbjct  88   INYGAASALPGKCGIRIPYPISPSTDCSRV 117

Sequence Alignment: 30. Allergen Name: Cor a 8 Sequence ID: AAK28533

 Score = 76.4 bits 370,  Expect = 2e-16
 Identities = 50/91 54%, Positives = 63/91 69%, Gaps = 0/91 0%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            L+C Q+   L PC+ +L  GGV    CC GVR +  A++TT+DRQ+ACNCLK  A  + G
Sbjct  25   LTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVNDASRTTSDRQSACNCLKDTAKGIAG 84
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
            LN   AA LPG+CGV+IPYKIS STNC  +K
Sbjct  85   LNPNLAAGLPGKCGVNIPYKISPSTNCNNVK 115

Sequence Alignment: 31. Allergen Name: Pun g 1.0101 Sequence ID: A0A059STC4

 Score = 76.4 bits 370,  Expect = 2e-16
 Identities = 51/91 56%, Positives = 68/91 74%, Gaps = 1/91 1%
Query  1    LSCGQVNSALAPCITFL-TKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLH 59
            ++CGQV S+LAPCI +  + GG     CCSG++ L G A+TT DRQA C CLK+A+ S+ 
Sbjct  29   VTCGQVASSLAPCIPYARSAGGAVPPACCSGIKTLDGMARTTPDRQATCKCLKSASTSIS 88
Query  60   GLNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
            G+N G  A+LP +CGV+IPYKIS ST+CA +K
Sbjct  89   GINYGLVASLPAKCGVNIPYKISPSTDCARVK 120

Sequence Alignment: 32. Allergen Name: Tri tu 14.0101 Sequence ID: CAH69206

 Score = 76.2 bits 369,  Expect = 2e-16
 Identities = 51/88 57%, Positives = 69/88 78%, Gaps = 4/88 4%
Query  1    LSCGQVNSALAPCITFLTKGGV-PSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLH 59
            +SCGQV+SAL+PCI++    G  PS  CCSGVR L  +A++TAD+QAAC C+K+AA    
Sbjct  27   VSCGQVSSALSPCISYARGNGASPSAACCSGVRSLASSARSTADKQAACKCIKSAAA--- 83
Query  60   GLNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
            GLN G AA +P +CGVS+PY IS+S +C+ I+
Sbjct  84   GLNAGKAAGIPTKCGVSVPYAISSSVDCSKIR 115

Sequence Alignment: 33. Allergen Name: Pla a 3.0101 Sequence ID: CAL07989

 Score = 74.9 bits 362,  Expect = 5e-16
 Identities = 48/91 52%, Positives = 66/91 72%, Gaps = 0/91 0%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            ++CG V + L PC+TFL  GG  +  CC+GV+ L   AKTT DRQAAC CLK A+ S+ G
Sbjct  28   ITCGTVVTRLTPCLTFLRSGGAVAPACCNGVKALNNDAKTTPDRQAACGCLKTASTSISG 87
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
            +  GNAA+L G+CGV++PYKIS + +C+ +K
Sbjct  88   IQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118

Sequence Alignment: 34. Allergen Name: Pun g 1.0301 Sequence ID: A0A059ST23

 Score = 74.9 bits 362,  Expect = 5e-16
 Identities = 52/91 57%, Positives = 65/91 71%, Gaps = 2/91 2%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGP--CCSGVRGLLGAAKTTADRQAACNCLKAAAGSL 58
            ++CGQV+S+LA CI +    G    P  CC+G+R L  AAKTT DRQAAC CLK+ A S+
Sbjct  28   ITCGQVSSSLAGCIQYARGNGAGPVPQACCNGIRSLNSAAKTTPDRQAACRCLKSLASSI 87
Query  59   HGLNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
             G+N G  A  PG+CGVSIPYKI+ STNC  +K
Sbjct  88   SGINYGLVAGAPGKCGVSIPYKIAPSTNCDNVK 120

Sequence Alignment: 35. Allergen Name: Pru du 3.0101 Sequence ID: ACN11576

 Score = 74.8 bits 361,  Expect = 6e-16
 Identities = 52/91 57%, Positives = 64/91 70%, Gaps = 2/91 2%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLH- 59
            +SCGQV + L PCI ++  GG  +  CC+GVR L   A+TTADRQ+ CNCLK A   +  
Sbjct  31   VSCGQVVNNLTPCINYVANGGALNPSCCTGVRSLYSLAQTTADRQSICNCLKQAVNGIPY 90
Query  60   -GLNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
               N G AA LPG+CGV+IPYKIS ST+C TIK
Sbjct  91   TNANAGLAAGLPGKCGVNIPYKISPSTDCKTIK 123

Sequence Alignment: 36. Allergen Name: Pla or 3.0101 Sequence ID: ABY21307

 Score = 74.2 bits 358,  Expect = 8e-16
 Identities = 47/91 51%, Positives = 66/91 72%, Gaps = 0/91 0%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            ++CG V + L PC+T+L  GG  +  CC+GV+ L   AKTT DRQAAC CLK A+ S+ G
Sbjct  28   ITCGTVVTRLTPCLTYLRSGGAVAPACCNGVKALNNDAKTTPDRQAACGCLKTASTSISG 87
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
            +  GNAA+L G+CGV++PYKIS + +C+ +K
Sbjct  88   IQLGNAASLAGKCGVNLPYKISPTIDCSKVK 118

Sequence Alignment: 37. Allergen Name: Art an 3.0102 Sequence ID: ANC85018

 Score = 73.1 bits 352,  Expect = 2e-15
 Identities = 49/91 53%, Positives = 63/91 69%, Gaps = 0/91 0%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            L+C  V   ++PC +FL KGG     CC+GV+GL  AAKTT DRQAACNCLK +  S + 
Sbjct  27   LTCNDVTKKISPCTSFLEKGGEVPVDCCTGVKGLNDAAKTTPDRQAACNCLKTSFKSSNN 86
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
            + + NAA LP +CGV+IPYKIS  T+C  +K
Sbjct  87   FKEENAAVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 38. Allergen Name: Hor v 1 Sequence ID: AAA32970

 Score = 72.9 bits 351,  Expect = 2e-15
 Identities = 44/90 48%, Positives = 62/90 68%, Gaps = 0/90 0%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            L+CGQV+S + PC+T++  G  PSG CC+GVR L   A+++ DRQ  CNCLK  A  +H 
Sbjct  27   LNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHN 86
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCATI 90
            LN  NAA++P +C V++PY IS   +C+ I
Sbjct  87   LNLNNAASIPSKCNVNVPYTISPDIDCSRI 116

Sequence Alignment: 39. Allergen Name: Art ca 3.0101 Sequence ID: ANC85021

 Score = 72.4 bits 348,  Expect = 3e-15
 Identities = 48/91 52%, Positives = 61/91 67%, Gaps = 0/91 0%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            L+C  V++ + PC +FL +GG  S  CC+GV+GL  AAKTT DRQAACNCLK    S   
Sbjct  27   LTCSDVSNKILPCTSFLKQGGEVSADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKD 86
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
            +   NA  LP +CGV+IPYKIS  T+C  +K
Sbjct  87   FKSDNAVVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 40. Allergen Name: Art an 3.0101 Sequence ID: ANC85017

 Score = 72.4 bits 348,  Expect = 3e-15
 Identities = 48/91 52%, Positives = 61/91 67%, Gaps = 0/91 0%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            L+C  V++ + PC +FL +GG  S  CC+GV+GL  AAKTT DRQAACNCLK    S   
Sbjct  27   LTCSDVSNKILPCTSFLKQGGEVSADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKD 86
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
            +   NA  LP +CGV+IPYKIS  T+C  +K
Sbjct  87   FKSDNAVVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 41. Allergen Name: Art gm 3.0102 Sequence ID: ANC85023

 Score = 72.4 bits 348,  Expect = 3e-15
 Identities = 47/91 51%, Positives = 62/91 68%, Gaps = 0/91 0%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            L+C  V++ ++PC++FL +GG     CC+GV+GL  AAKTT DRQ ACNCLK +  S   
Sbjct  27   LTCSDVSNKISPCLSFLKQGGEVPADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKD 86
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
            L   NA  LP +CGV+IPYKIS  T+C  +K
Sbjct  87   LKSDNAVVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 42. Allergen Name: Sin a 3.0101 Sequence ID: ABU95411

 Score = 71.8 bits 345,  Expect = 3e-15
 Identities = 53/90 58%, Positives = 63/90 70%, Gaps = 2/90 2%
Query  1    LSCGQVNSALAPCITFLTKGG-VPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLH 59
            LSCG VNS LA CI +LT+   +P G CC+GV  L   A+TT DRQ AC CL  AA S+ 
Sbjct  2    LSCGTVNSNLAACIGYLTQNAPLPKG-CCTGVTNLNNMARTTPDRQQACRCLVGAANSFP 60
Query  60   GLNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
             LN   AAALP  CGV+IPYKIS STNC +++
Sbjct  61   SLNAARAAALPKACGVNIPYKISKSTNCNSVR 92

Sequence Alignment: 43. Allergen Name: Hor v 1 Sequence ID: CAA42832

 Score = 72.2 bits 347,  Expect = 4e-15
 Identities = 43/88 48%, Positives = 61/88 69%, Gaps = 0/88 0%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            L+CGQV+S + PC+T++  G  PSG CC+GVR L   A+++ DRQ  CNCLK  A  +H 
Sbjct  27   LNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHN 86
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCA 88
            LN  NAA++P +C V++PY IS   +C+
Sbjct  87   LNLNNAASIPSKCNVNVPYTISPDIDCS 114

Sequence Alignment: 44. Allergen Name: Art gm 3.0101 Sequence ID: ANC85022

 Score = 72.0 bits 346,  Expect = 4e-15
 Identities = 47/91 51%, Positives = 62/91 68%, Gaps = 0/91 0%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            L+C  V++ ++PC +FL +GG     CC+GV+GL  AAKTT DRQ ACNCLK +  S   
Sbjct  27   LTCSDVSNKISPCTSFLKQGGEVPADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKD 86
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
            +   NAA LP +CGV+IPYKIS  T+C  +K
Sbjct  87   FKSDNAAVLPSKCGVNIPYKISLETDCNKVK 117

Sequence Alignment: 45. Allergen Name: Sola l 7.0101 Sequence ID: NP_001316123

 Score = 71.6 bits 344,  Expect = 5e-15
 Identities = 45/90 50%, Positives = 61/90 67%, Gaps = 0/90 0%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            ++CGQV++ LAPC+ FLT+GG P   CCSGVR L G  +++ DR+ ACNC+KAAA     
Sbjct  25   ITCGQVDANLAPCVPFLTQGGEPGAACCSGVRTLNGNTQSSDDRRTACNCVKAAANRYPN 84
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCATI 90
            L    A +LP +CG+S+   IS + NC TI
Sbjct  85   LKDDAAQSLPSKCGISLTVPISRTVNCDTI 114

Sequence Alignment: 46. Allergen Name: Art ca 3.0102 Sequence ID: QIN55516

 Score = 71.6 bits 344,  Expect = 5e-15
 Identities = 47/91 51%, Positives = 60/91 65%, Gaps = 0/91 0%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            L+C  V++ + PC++FL +GG     CC+GV+GL  AAKT  DRQ ACNCLK    S   
Sbjct  27   LTCSDVSNKITPCLSFLKQGGEVPADCCTGVKGLNDAAKTGPDRQKACNCLKTTFKSNKD 86
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
            L   NA  LP +CGV+IPYKIS  T+C T+K
Sbjct  87   LKSDNAVVLPSKCGVNIPYKISLETDCNTVK 117

Sequence Alignment: 47. Allergen Name: Tri a 14.0101 Sequence ID: 19846220

 Score = 69.9 bits 335,  Expect = 1e-14
 Identities = 40/90 44%, Positives = 64/90 71%, Gaps = 0/90 0%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            + CG+V+S + PC++++  G  PSG CC GV+ L   A++ +DRQ+ACNCLK  A  +H 
Sbjct  1    IDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN 60
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCATI 90
            LN+ NA ++P +CGV++PY IS + +C+ +
Sbjct  61   LNEDNARSIPPKCGVNLPYTISLNIDCSRV 90

Sequence Alignment: 48. Allergen Name: Art si 3.0102 Sequence ID: ANC85027

 Score = 70.2 bits 336,  Expect = 1e-14
 Identities = 46/91 50%, Positives = 61/91 67%, Gaps = 0/91 0%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            L+C  V++ + PC+ +L +GG     CC+GV+GL  AAKTT DRQ ACNCLK +  S   
Sbjct  26   LTCSDVSNKITPCLNYLKQGGEVPADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKD 85
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
            L    AA+LP +CGV+IPYKIS  T+C  +K
Sbjct  86   LKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 49. Allergen Name: Art v 3.0202 Sequence ID: ACE07187

 Score = 70.2 bits 336,  Expect = 1e-14
 Identities = 46/91 50%, Positives = 61/91 67%, Gaps = 0/91 0%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            L+C  V++ + PC+ +L +GG     CC+GV+GL  AAKTT DRQ ACNCLK +  S   
Sbjct  26   LTCSDVSNKITPCLNYLKQGGEVPADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKD 85
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
            L    AA+LP +CGV+IPYKIS  T+C  +K
Sbjct  86   LKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 50. Allergen Name: Art ar 3.0102 Sequence ID: ANC85020

 Score = 70.2 bits 336,  Expect = 1e-14
 Identities = 46/91 50%, Positives = 61/91 67%, Gaps = 0/91 0%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            L+C  V++ + PC+ +L +GG     CC+GV+GL  AAKTT DRQ ACNCLK +  S   
Sbjct  26   LTCSDVSNKITPCLNYLKQGGEVPADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKD 85
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
            L    AA+LP +CGV+IPYKIS  T+C  +K
Sbjct  86   LKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 51. Allergen Name: Art la 3.0102 Sequence ID: ANC85025

 Score = 68.5 bits 327,  Expect = 4e-14
 Identities = 43/91 47%, Positives = 61/91 67%, Gaps = 0/91 0%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            L+C  V++ ++PC+++L KGG     CC+GV+GL  A KTT DRQ ACNCLKA+  S   
Sbjct  25   LTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKD 84
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
            L    A  LP +CG+++PYK+S  T+C  +K
Sbjct  85   LKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 115

Sequence Alignment: 52. Allergen Name: Art v 3.0301 Sequence ID: EU564847

 Score = 68.6 bits 327,  Expect = 4e-14
 Identities = 43/91 47%, Positives = 61/91 67%, Gaps = 0/91 0%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            L+C  V++ ++PC+++L KGG     CC+GV+GL  A KTT DRQ ACNCLKA+  S   
Sbjct  27   LTCSDVSTKISPCLSYLKKGGEVPADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKD 86
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
            L    A  LP +CG+++PYK+S  T+C  +K
Sbjct  87   LKSDFAVPLPSKCGLNLPYKLSLETDCNKVK 117

Sequence Alignment: 53. Allergen Name: Art v 3.0201 Sequence ID: EU564845

 Score = 67.4 bits 321,  Expect = 8e-14
 Identities = 44/91 48%, Positives = 60/91 65%, Gaps = 0/91 0%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            L C  V++ ++ C+++L +GG     CC+GV+GL  AAKTT DRQ ACNCLK    S   
Sbjct  24   LKCSDVSNKISACLSYLKQGGEVPADCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKD 83
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
            +    AA+LP +CGV+IPYKIS  T+C  +K
Sbjct  84   FKSDFAASLPSKCGVNIPYKISLETDCNKVK 114

Sequence Alignment: 54. Allergen Name: Art la 3.0101 Sequence ID: ANC85024

 Score = 67.5 bits 321,  Expect = 9e-14
 Identities = 44/91 48%, Positives = 60/91 65%, Gaps = 0/91 0%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            L C  V++ ++ C+++L +GG     CC+GV+GL  AAKTT DRQ ACNCLK    S   
Sbjct  26   LKCSDVSNKISACLSYLKQGGEVPADCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKD 85
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
            +    AA+LP +CGV+IPYKIS  T+C  +K
Sbjct  86   FKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 55. Allergen Name: Art ar 3.0101 Sequence ID: ANC85019

 Score = 67.5 bits 321,  Expect = 9e-14
 Identities = 44/91 48%, Positives = 60/91 65%, Gaps = 0/91 0%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            L C  V++ ++ C+++L +GG     CC+GV+GL  AAKTT DRQ ACNCLK    S   
Sbjct  26   LKCSDVSNKISACLSYLKQGGEVPADCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKD 85
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
            +    AA+LP +CGV+IPYKIS  T+C  +K
Sbjct  86   FKSDFAASLPSKCGVNIPYKISLETDCNKVK 116

Sequence Alignment: 56. Allergen Name: Art si 3.0101 Sequence ID: ANC85026

 Score = 66.9 bits 318,  Expect = 1e-13
 Identities = 44/90 48%, Positives = 62/90 68%, Gaps = 2/90 2%
Query  1    LSCGQVNSALAPCITFLTKGG-VPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLH 59
            L+C  V++ ++PC+ +L +GG VP+  CC+GV+GL  AAKTT DRQ AC CLK +  +  
Sbjct  26   LTCSDVSNKISPCLNYLKQGGEVPAN-CCAGVKGLNDAAKTTPDRQTACTCLKNSFKTNK 84
Query  60   GLNQGNAAALPGRCGVSIPYKISTSTNCATIK 91
             L    A  LP +CGV+IPYK+S  T+C  +K
Sbjct  85   DLKSDYAVPLPSKCGVTIPYKLSMETDCNKVK 116

Sequence Alignment: 57. Allergen Name: Hel a 3.0101 Sequence ID: P82007

 Score = 62.4 bits 293,  Expect = 3e-12
 Identities = 39/89 43%, Positives = 55/89 61%, Gaps = 1/89 1%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            ++C  V   L PC+ +L  GG P+  CC+G + LLGA +T ADR+ AC C K AA  L  
Sbjct  27   ITCNDVTGNLTPCLPYLRSGGKPTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK- 85
Query  61   LNQGNAAALPGRCGVSIPYKISTSTNCATI 90
            +    A++LPG+CG+S    I+ + NC TI
Sbjct  86   VRPDMASSLPGKCGISTSIPINPNVNCNTI 115

Sequence Alignment: 58. Allergen Name: Amb a 6 Sequence ID: O04004

 Score = 46.0 bits 203,  Expect = 3e-07
 Identities = 33/87 37%, Positives = 47/87 54%, Gaps = 3/87 3%
Query  2    SCGQVNSALAPCITFLTKGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHGL 61
            +C  V + LAPC  FLT G  PS  CC+GV  L  + KT ADR A CNC+K    S+   
Sbjct  29   TCDTVQNILAPCAGFLT-GQEPSKACCTGVNNLNNSRKTKADRVAVCNCIKELTKSI-AY 86
Query  62   NQGNAAALPGRCGVSIPYK-ISTSTNCATI 90
            +      L  +CGV   +  +  + +C+ +
Sbjct  87   DPKRMPLLSTKCGVKPDFPAVDKNLDCSKL 116

Sequence Alignment: 59. Allergen Name: Par j 2 Sequence ID: O04403

 Score = 46.0 bits 203,  Expect = 3e-07
 Identities = 32/87 36%, Positives = 51/87 58%, Gaps = 6/87 6%
Query  3    CGQVNSALAPCITFLTKG--GVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            CG+V   + PC+ F+ KG    PS  CCSG + L    KTT  ++ AC C+ AA   + G
Sbjct  35   CGKVVHHIMPCLKFV-KGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISG 93
Query  61   LNQGNAAALPGRCGVS--IPYKISTSTNCATIK 91
            +     A +P +CG++  +P  I+   +C+ I+
Sbjct  94   IKNELVAEVPKKCGITTTLP-PITADFDCSKIE 125

Sequence Alignment: 60. Allergen Name: Par j 1 Sequence ID: Q40905

 Score = 44.4 bits 194,  Expect = 9e-07
 Identities = 31/88 35%, Positives = 47/88 53%, Gaps = 5/88 5%
Query  2    SCGQVNSALAPCITFLT-KGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            +CG V  AL PC+ F+  K   PS  CCSG + L G  KT   R  AC C++ A  +   
Sbjct  39   TCGTVVGALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 98
Query  61   LNQGNAAALPGRCGV---SIPYKISTSTNCATI 90
            ++    + +P  CG+    +P  I  + +C T+
Sbjct  99   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 130

Sequence Alignment: 61. Allergen Name: Par j 1 Sequence ID: P43217

 Score = 43.8 bits 191,  Expect = 1e-06
 Identities = 30/88 34%, Positives = 47/88 53%, Gaps = 5/88 5%
Query  2    SCGQVNSALAPCITFLT-KGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            +CG +  AL PC+ F+  K   PS  CCSG + L G  KT   R  AC C++ A  +   
Sbjct  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
Query  61   LNQGNAAALPGRCGV---SIPYKISTSTNCATI 90
            ++    + +P  CG+    +P  I  + +C T+
Sbjct  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTV 94

Sequence Alignment: 62. Allergen Name: Par j 1 Sequence ID: O04404

 Score = 44.1 bits 192,  Expect = 1e-06
 Identities = 31/88 35%, Positives = 47/88 53%, Gaps = 5/88 5%
Query  2    SCGQVNSALAPCITFLT-KGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            +CG V  AL PC+ F+  K   PS  CCSG + L G  KT   R  AC C++ A  +   
Sbjct  40   TCGTVVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSD 99
Query  61   LNQGNAAALPGRCGV---SIPYKISTSTNCATI 90
            ++    + +P  CG+    +P  I  + +C T+
Sbjct  100  IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 131

Sequence Alignment: 63. Allergen Name: Par j 2 Sequence ID: P55958

 Score = 43.4 bits 189,  Expect = 2e-06
 Identities = 30/88 34%, Positives = 50/88 56%, Gaps = 6/88 6%
Query  2    SCGQVNSALAPCITFLTKG--GVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLH 59
            +CG+V   + PC+ F+ KG    PS  CCSG + L    KTT  ++ AC C+  A   + 
Sbjct  34   ACGKVVQDIMPCLHFV-KGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGIS 92
Query  60   GLNQGNAAALPGRCGV--SIPYKISTSTNCATIK 91
            G+     A +P +C +  ++P  I+   +C+ I+
Sbjct  93   GIKNELVAEVPKKCDIKTTLP-PITADFDCSKIQ 125

Sequence Alignment: 64. Allergen Name: Par j 1.0103 Sequence ID: CAI94601

 Score = 43.5 bits 189,  Expect = 2e-06
 Identities = 30/88 34%, Positives = 47/88 53%, Gaps = 5/88 5%
Query  2    SCGQVNSALAPCITFLT-KGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHG 60
            +CG +  AL PC+ F+  K   PS  CCSG + L G  KT   R  AC C++ A  +   
Sbjct  3    TCGTMVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSD 62
Query  61   LNQGNAAALPGRCGV---SIPYKISTSTNCATI 90
            ++    + +P  CG+    +P  I  + +C T+
Sbjct  63   IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTL 94

Sequence Alignment: 65. Allergen Name: Par j 1.0101 Sequence ID: CAA54587

 Score = 40.3 bits 172,  Expect = 1e-05
 Identities = 28/81 34%, Positives = 43/81 53%, Gaps = 5/81 6%
Query  9    ALAPCITFLT-KGGVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHGLNQGNAA 67
            AL PC+ F+  K   PS  CCSG + L G  KT   R  AC C++ A  +   ++    +
Sbjct  4    ALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVS 63
Query  68   ALPGRCGV---SIPYKISTSTNCATI 90
             +P  CG+    +P  I  + +C T+
Sbjct  64   EVPKHCGIVDSKLP-PIDVNMDCKTV 88

Sequence Alignment: 66. Allergen Name: Vit v 1 Sequence ID: P80274

 Score = 33.6 bits 137,  Expect = 0.0004
 Identities = 18/28 64%, Positives = 23/28 82%, Gaps = 1/28 3%
Query  1    LSCGQVNSALAPCITFLTK-GGVPSGPCC 28
            ++CGQV SAL+PCI +L K G VP+G CC
Sbjct  2    VTCGQVASALSPCIDYLQKDGAVPAGSCC 30

Sequence Alignment: 67. Allergen Name: Art v 3.0101 Sequence ID: P0C088

 Score = 32.3 bits 130,  Expect = 0.001
 Identities = 14/34 41%, Positives = 25/34 73%, Gaps = 0/34 0%
Query  1    LSCGQVNSALAPCITFLTKGGVPSGPCCSGVRGL 34
            L+C  V++ ++PC+++L +GG     CC+GV+GL
Sbjct  2    LTCSDVSNKISPCLSYLKQGGEVPADCCAGVKGL 35

Sequence Alignment: 68. Allergen Name: Cas s 8 Sequence ID: 10998016

 Score = 30.8 bits 122,  Expect = 0.003
 Identities = 16/32 50%, Positives = 24/32 75%, Gaps = 2/32 6%
Query  1    LSCGQVNSALAPCITFL-TKGGVPS-GPCCSGVR 32
            ++C QV+ +L PC+T+L + GG P  G CC GV+
Sbjct  2    ITCTQVSKSLMPCLTYLKSNGGSPPPGTCCQGVK 35

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.