The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

LSSAKERFKCASLQKFGDRAFKAWSVARLSQRFPKADFAEISKVVTDLTKVHKECCHGDL
LECADDRADLAKYMCENQDSISTKLKECCDKPVLEKSQCLAEVERDELPGDLPSLAADFV
EDKEVCKNYQEAKDVFLGTFLYEYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCY
AKVLDEFKPLVDEPQNLVKTNCELFEKLGEYGFQNALLVRYTKKAPQVSTPTLVVEVSRK
LGKVGTKCCKKPESERMSCADDFLS
Sequence Info Allergen Name Length Opt Bits Score E Value
AAB30434 Can f 3 265 1794 495.4 8.2e-142
P49822 Can f 3 608 1777 490.3 6.7e-140
P49064 Fel d 2 608 1621 447.7 4.4e-127
P08835 Sus s 1.0101 607 1526 421.8 2.8e-119
P02769 Bos d 6 607 1488 411.4 3.7e-116
CAA41735 Bos d 6 607 1488 411.4 3.7e-116
CAA52194 Equ c 3 607 1465 405.2 2.8e-114
Q6WDN9 Cav p 4.0101 608 1434 396.7 1e-111
CAA43098 Gal d 5 615 1004 279.4 2.1e-76
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Can f 3 Sequence ID: AAB30434

 Score = 495.4 bits 1794,  Expect = 8e-142
 Identities = 265/265 100%, Positives = 265/265 100%, Gaps = 0/265 0%
Query  1    LSSAKERFKCASLQKFGDRAFKAWSVARLSQRFPKADFAEISKVVTDLTKVHKECCHGDL 60
            LSSAKERFKCASLQKFGDRAFKAWSVARLSQRFPKADFAEISKVVTDLTKVHKECCHGDL
Sbjct  1    LSSAKERFKCASLQKFGDRAFKAWSVARLSQRFPKADFAEISKVVTDLTKVHKECCHGDL 60
Query  61   LECADDRADLAKYMCENQDSISTKLKECCDKPVLEKSQCLAEVERDELPGDLPSLAADFV 120
            LECADDRADLAKYMCENQDSISTKLKECCDKPVLEKSQCLAEVERDELPGDLPSLAADFV
Sbjct  61   LECADDRADLAKYMCENQDSISTKLKECCDKPVLEKSQCLAEVERDELPGDLPSLAADFV 120
Query  121  EDKEVCKNYQEAKDVFLGTFLYEYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCY 180
            EDKEVCKNYQEAKDVFLGTFLYEYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCY
Sbjct  121  EDKEVCKNYQEAKDVFLGTFLYEYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCY 180
Query  181  AKVLDEFKPLVDEPQNLVKTNCELFEKLGEYGFQNALLVRYTKKAPQVSTPTLVVEVSRK 240
            AKVLDEFKPLVDEPQNLVKTNCELFEKLGEYGFQNALLVRYTKKAPQVSTPTLVVEVSRK
Sbjct  181  AKVLDEFKPLVDEPQNLVKTNCELFEKLGEYGFQNALLVRYTKKAPQVSTPTLVVEVSRK 240
Query  241  LGKVGTKCCKKPESERMSCADDFLS 265
            LGKVGTKCCKKPESERMSCADDFLS
Sbjct  241  LGKVGTKCCKKPESERMSCADDFLS 265

Sequence Alignment: 2. Allergen Name: Can f 3 Sequence ID: P49822

 Score = 490.3 bits 1777,  Expect = 7e-140
 Identities = 264/264 100%, Positives = 264/264 100%, Gaps = 1/264 0%
Query  1    LSSAKERFKCASLQKFGDRAFKAWSVARLSQRFPKADFAEISKVVTDLTKVHKECCHGDL 60
            LSSAKERFKCASLQKFGDRAFKAWSVARLSQRFPKADFAEISKVVTDLTKVHKECCHGDL
Sbjct  215  LSSAKERFKCASLQKFGDRAFKAWSVARLSQRFPKADFAEISKVVTDLTKVHKECCHGDL 274
Query  61   LECADDRADLAKYMCENQDSISTKLKECCDKPVLEKSQCLAEVERDELPGDLPSLAADFV 120
            LECADDRADLAKYMCENQDSISTKLKECCDKPVLEKSQCLAEVERDELPGDLPSLAADFV
Sbjct  275  LECADDRADLAKYMCENQDSISTKLKECCDKPVLEKSQCLAEVERDELPGDLPSLAADFV 334
Query  121  EDKEVCKNYQEAKDVFLGTFLYEYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCY 180
            EDKEVCKNYQEAKDVFLGTFLYEYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCY
Sbjct  335  EDKEVCKNYQEAKDVFLGTFLYEYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCY 394
Query  181  AKVLDEFKPLVDEPQNLVKTNCELFEKLGEYGFQNALLVRYTKKAPQVSTPTLVVEVSRK 240
            AKVLDEFKPLVDEPQNLVKTNCELFEKLGEYGFQNALLVRYTKKAPQVSTPTLV EVSRK
Sbjct  395  AKVLDEFKPLVDEPQNLVKTNCELFEKLGEYGFQNALLVRYTKKAPQVSTPTLV-EVSRK 453
Query  241  LGKVGTKCCKKPESERMSCADDFLS 265
            LGKVGTKCCKKPESERMSCADDFLS
Sbjct  454  LGKVGTKCCKKPESERMSCADDFLS 478
 Score = 76.4 bits 260,  Expect = 3e-15
 Identities = 48/182 26%, Positives = 95/182 52%, Gaps = 13/182 7%
Query  5    KERFKCASLQKF---GDRAFKAWSVARLSQRFPKADFAEISKVVTDLTKVHKECCHGDL- 60
            +E +K    +++   G+  F+   +  +SQ + +  F +  K+  ++T+  K C   +  
Sbjct  24   REAYKSEIAHRYNDLGEEHFRGLVLVAFSQYLQQCPFEDHVKLAKEVTEFAKACAAEESG 83
Query  61   LECADDRADL-AKYMCENQDSISTK---LKECCDKPVLEKSQCLAEVERDELPGDLPSLA 116
              C      L    +C    S+  K   + +CC+K   ++++C+    +D+ PG +P L 
Sbjct  84   ANCDKSLHTLFGDKLC-TVASLRDKYGDMADCCEKQEPDRNECFL-AHKDDNPG-FPPLV 140
Query  117  ADFVEDKEVCKNYQEAKDVFLGTFLYEYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDP 176
            A   E   +C  +Q+ + +FLG +LYE +RRHP +    LL  A++Y+  + +CC   D 
Sbjct  141  AP--EPDALCAAFQDNEQLFLGKYLYEIARRHPYFYAPELLYYAQQYKGVFAECCQAADK 198
Query  177  PTCYAKVLDEFKPLV 191
              C    ++ ++  V
Sbjct  199  AACLGPKIEALREKV 213
 Score = 47.5 bits 154,  Expect = 1e-06
 Identities = 26/107 24%, Positives = 57/107 53%, Gaps = 6/107 5%
Query  74   MC--ENQDSISTKLKECCDKPVLEKSQCLAEVERDE--LPGDLPSLAADFVEDKEVCKNY 129
            +C    +  +S ++ +CC + ++ +  C++ +E DE  +P ++   A  F    ++C   
Sbjct  484  LCVLHEKTPVSERVTKCCSESLVNRRPCFSGLEVDETYVPKEFN--AETFTFHADLCTLP 541
Query  130  QEAKDVFLGTFLYEYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCYAK 182
            +  K V   T L E  +  P+ +   L  +  ++ A +EKCCA ++   C+++
Sbjct  542  EAEKQVKKQTALVELLKHKPKATDEQLKTVMGDFGAFVEKCCAAENKEGCFSE 594

Sequence Alignment: 3. Allergen Name: Fel d 2 Sequence ID: P49064

 Score = 447.7 bits 1621,  Expect = 4e-127
 Identities = 234/263 88%, Positives = 252/263 95%, Gaps = 1/263 0%
Query  2    SSAKERFKCASLQKFGDRAFKAWSVARLSQRFPKADFAEISKVVTDLTKVHKECCHGDLL 61
            SSAKER+KCASLQKFG+RAFKAWSVARLSQ+FPKA+FAEISK+VTDL K+HKECCHGDLL
Sbjct  216  SSAKERLKCASLQKFGERAFKAWSVARLSQKFPKAEFAEISKLVTDLAKIHKECCHGDLL 275
Query  62   ECADDRADLAKYMCENQDSISTKLKECCDKPVLEKSQCLAEVERDELPGDLPSLAADFVE 121
            ECADDRADLAKY+CENQDSISTKLKECC KPVLEKS+C++EVERDELP DLP LA DFVE
Sbjct  276  ECADDRADLAKYICENQDSISTKLKECCGKPVLEKSHCISEVERDELPADLPPLAVDFVE 335
Query  122  DKEVCKNYQEAKDVFLGTFLYEYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCYA 181
            DKEVCKNYQEAKDVFLGTFLYEYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPP CYA
Sbjct  336  DKEVCKNYQEAKDVFLGTFLYEYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPPACYA 395
Query  182  KVLDEFKPLVDEPQNLVKTNCELFEKLGEYGFQNALLVRYTKKAPQVSTPTLVVEVSRKL 241
             V+DEFKPLV+EP+NLVKTNCELFEKLGEYGFQNALLVRYTKK PQVSTPTLV EVSR L
Sbjct  396  HVFDEFKPLVEEPHNLVKTNCELFEKLGEYGFQNALLVRYTKKVPQVSTPTLV-EVSRSL 454
Query  242  GKVGTKCCKKPESERMSCADDFLS 265
            GKVG+KCC  PE+ER+SCA+D+LS
Sbjct  455  GKVGSKCCTHPEAERLSCAEDYLS 478
 Score = 76.4 bits 260,  Expect = 3e-15
 Identities = 48/168 28%, Positives = 89/168 52%, Gaps = 16/168 9%
Query  16   FGDRAFKAWSVARLSQRFPKADFAEISKVVTDLTKVHKEC--------CHGDLLECADDR 67
            +G+  F+   +  +SQ + +  F +  K+V ++T+  K C        C   L E   D+
Sbjct  38   LGEEHFRGLVLVAFSQYLQQCPFEDHVKLVNEVTEFAKGCVADQSAANCEKSLHELLGDK 97
Query  68   ADLAKYMCENQDSISTKLKECCDKPVLEKSQCLAEVERDELPGDLPSLAADFVEDKEVCK 127
                  +   +D    ++ +CC+K   E+++C+ +  +D+ PG +  L     E   +C 
Sbjct  98   LCTVASL---RDKYG-EMADCCEKKEPERNECFLQ-HKDDNPG-FGQLVTP--EADAMCT 149
Query  128  NYQEAKDVFLGTFLYEYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCYAKVLDEF 187
             ++E +  FLG +LYE +RRHP +    LL  A+EY+  + +CC   D   C    +D +
Sbjct  150  AFHENEQRFLGKYLYEIARRHPYFYAPELLYYAEEYKGVFTECCEAADKAACLTPKVDAL 209
Query  188  KPLV 191
            +  V
Sbjct  210  REKV 213
 Score = 47.2 bits 153,  Expect = 2e-06
 Identities = 23/107 21%, Positives = 57/107 53%, Gaps = 6/107 5%
Query  74   MC--ENQDSISTKLKECCDKPVLEKSQCLAEVERDE--LPGDLPSLAADFVEDKEVCKNY 129
            +C    +  +S ++ +CC + ++ +  C++ ++ DE  +P ++   A  F    ++C   
Sbjct  484  LCVLHEKTPVSERVTKCCTESLVNRRPCFSALQVDETYVPKEFS--AETFTFHADLCTLP 541
Query  130  QEAKDVFLGTFLYEYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCYAK 182
            +  K +   + L E  +  P+ +   L  +  ++ + ++KCCA +D   C+A+
Sbjct  542  EAEKQIKKQSALVELLKHKPKATEEQLKTVMGDFGSFVDKCCAAEDKEACFAE 594

Sequence Alignment: 4. Allergen Name: Sus s 1.0101 Sequence ID: P08835

 Score = 421.8 bits 1526,  Expect = 3e-119
 Identities = 215/263 81%, Positives = 245/263 93%, Gaps = 1/263 0%
Query  2    SSAKERFKCASLQKFGDRAFKAWSVARLSQRFPKADFAEISKVVTDLTKVHKECCHGDLL 61
            S+AK+R+KCAS+QKFG+RAFKAWS+ARLSQRFPKADF EISK+VTDL KVHKECCHGDLL
Sbjct  215  SAAKQRLKCASIQKFGERAFKAWSLARLSQRFPKADFTEISKIVTDLAKVHKECCHGDLL 274
Query  62   ECADDRADLAKYMCENQDSISTKLKECCDKPVLEKSQCLAEVERDELPGDLPSLAADFVE 121
            ECADDRADLAKY+CENQD+ISTKLKECCDKP+LEKS+C+AE +RDELP DL  L  DFVE
Sbjct  275  ECADDRADLAKYICENQDTISTKLKECCDKPLLEKSHCIAEAKRDELPADLNPLEHDFVE 334
Query  122  DKEVCKNYQEAKDVFLGTFLYEYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCYA 181
            DKEVCKNY+EAK VFLGTFLYEYSRRHP+YSVSLLLR+AK YEATLE CCA +DPP CYA
Sbjct  335  DKEVCKNYKEAKHVFLGTFLYEYSRRHPDYSVSLLLRIAKIYEATLEDCCAKEDPPACYA 394
Query  182  KVLDEFKPLVDEPQNLVKTNCELFEKLGEYGFQNALLVRYTKKAPQVSTPTLVVEVSRKL 241
             V+D+F+PLVDEP+NL+K NCELFEKLGEYGFQNAL+VRYTKK PQVSTPTLV EV+RKL
Sbjct  395  TVFDKFQPLVDEPKNLIKQNCELFEKLGEYGFQNALIVRYTKKVPQVSTPTLV-EVARKL 453
Query  242  GKVGTKCCKKPESERMSCADDFLS 265
            G VG++CCK+PE ER+SCA+D+LS
Sbjct  454  GLVGSRCCKRPEEERLSCAEDYLS 477
 Score = 75.8 bits 258,  Expect = 4e-15
 Identities = 49/173 28%, Positives = 90/173 52%, Gaps = 11/173 6%
Query  13   LQKFGDRAFKAWSVARLSQRFPKADFAEISKVVTDLTKVHKECCHGDLLECADDRAD--L 70
            ++ +G++ FK   +  +SQ + +  + E  K+V ++T+  K C   +  E  D      +
Sbjct  35   FKDLGEQYFKGLVLIAFSQHLQQCPYEEHVKLVREVTEFAKTCVADESAENCDKSIHTLF 94
Query  71   AKYMCENQDSISTK---LKECCDKPVLEKSQCLAEVERDELPGDLPSLAADFVEDKEVCK 127
               +C    S+      L +CC+K   E+++C+ + + D  P D+P L  D V    +C 
Sbjct  95   GDKLCAIP-SLREHYGDLADCCEKEEPERNECFLQHKNDN-P-DIPKLKPDPV---ALCA 148
Query  128  NYQEAKDVFLGTFLYEYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCYAKVLDEF 187
            ++QE +  F G +LYE +RRHP +    LL  A  Y+  + +CC   D   C    ++ +
Sbjct  149  DFQEDEQKFWGKYLYEIARRHPYFYAPELLYYAIIYKDVFSECCQAADKAACLLPKIEHL 208
Query  188  KPLV 191
            +  V
Sbjct  209  REKV 212
 Score = 47.7 bits 155,  Expect = 1e-06
 Identities = 24/108 22%, Positives = 49/108 45%, Gaps = 2/108 1%
Query  74   MC--ENQDSISTKLKECCDKPVLEKSQCLAEVERDELPGDLPSLAADFVEDKEVCKNYQE 131
            +C    +  +S K+ +CC + ++ +  C++ +  DE       +   F    ++C   ++
Sbjct  483  LCVLHEKTPVSEKVTKCCTESLVNRRPCFSALTPDETYKPKEFVEGTFTFHADLCTLPED 542
Query  132  AKDVFLGTFLYEYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCYA 181
             K +   T L E  +  P  +   L  +   + A ++KCCA  D   C+A
Sbjct  543  EKQIKKQTALVELLKHKPHATEEQLRTVLGNFAAFVQKCCAAPDHEACFA 592

Sequence Alignment: 5. Allergen Name: Bos d 6 Sequence ID: P02769

 Score = 411.4 bits 1488,  Expect = 4e-116
 Identities = 206/263 78%, Positives = 244/263 92%, Gaps = 1/263 0%
Query  2    SSAKERFKCASLQKFGDRAFKAWSVARLSQRFPKADFAEISKVVTDLTKVHKECCHGDLL 61
            SSA++R++CAS+QKFG+RA+KAWSVARLSQ+FPKA+F E++K+VTDLTKVHKECCHGDLL
Sbjct  215  SSARQRLRCASIQKFGERALKAWSVARLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDLL 274
Query  62   ECADDRADLAKYMCENQDSISTKLKECCDKPVLEKSQCLAEVERDELPGDLPSLAADFVE 121
            ECADDRADLAKY+C+NQD+IS+KLKECCDKP+LEKS+C+AEVE+D +P +LP L ADF E
Sbjct  275  ECADDRADLAKYICDNQDTISSKLKECCDKPLLEKSHCIAEVEKDAIPENLPPLTADFAE 334
Query  122  DKEVCKNYQEAKDVFLGTFLYEYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCYA 181
            DK+VCKNYQEAKD FLG+FLYEYSRRHPEY+VS+LLRLAKEYEATLE+CCA DDP  CY+
Sbjct  335  DKDVCKNYQEAKDAFLGSFLYEYSRRHPEYAVSVLLRLAKEYEATLEECCAKDDPHACYS 394
Query  182  KVLDEFKPLVDEPQNLVKTNCELFEKLGEYGFQNALLVRYTKKAPQVSTPTLVVEVSRKL 241
             V+D++K LVDEPQNL+K NC+ FEKLGEYGFQNAL+VRYT+K PQVSTPTLV EVSR L
Sbjct  395  TVFDKLKHLVDEPQNLIKQNCDQFEKLGEYGFQNALIVRYTRKVPQVSTPTLV-EVSRSL 453
Query  242  GKVGTKCCKKPESERMSCADDFLS 265
            GKVGT+CC KPESERM C +D+LS
Sbjct  454  GKVGTRCCTKPESERMPCTEDYLS 477
 Score = 76.7 bits 261,  Expect = 2e-15
 Identities = 47/162 29%, Positives = 82/162 50%, Gaps = 9/162 5%
Query  13   LQKFGDRAFKAWSVARLSQRFPKADFAEISKVVTDLTKVHKECCHGDLLE-CADDRADL- 70
            ++ +G+  FK   +  +SQ + +  F E  K+V +LT+  K C   +    C      L 
Sbjct  35   FKDLGEEHFKGLVLIAFSQYLQQCPFDEHVKLVNELTEFAKTCVADESHAGCEKSLHTLF 94
Query  71   AKYMCENQDSIST--KLKECCDKPVLEKSQCLAEVERDELPGDLPSLAADFVEDKEVCKN 128
               +C+      T   + +CC+K   E+++C+    +D+ P DLP L  D      +C  
Sbjct  95   GDELCKVASLRETYGDMADCCEKQEPERNECFLS-HKDDSP-DLPKLKPD---PNTLCDE 149
Query  129  YQEAKDVFLGTFLYEYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPPTC 179
            ++  +  F G +LYE +RRHP +    LL  A +Y   +++CC  +D   C
Sbjct  150  FKADEKKFWGKYLYEIARRHPYFYAPELLYYANKYNGVFQECCQAEDKGAC 200
 Score = 48.0 bits 156,  Expect = 9e-07
 Identities = 28/105 26%, Positives = 53/105 50%, Gaps = 8/105 7%
Query  74   MC--ENQDSISTKLKECCDKPVLEKSQCLAEVERDELPGDLPSLAAD---FVEDKEVCKN 128
            +C    +  +S K+ +CC + ++ +  C++ +  DE    +P  A D   F    ++C  
Sbjct  483  LCVLHEKTPVSEKVTKCCTESLVNRRPCFSALTPDETY--VPK-AFDEKLFTFHADICTL 539
Query  129  YQEAKDVFLGTFLYEYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCYA 181
                K +   T L E  +  P+ +   L  + + + A ++KCCA DD   C+A
Sbjct  540  PDTEKQIKKQTALVELLKHKPKATEEQLKTVMENFVAFVDKCCAADDKEACFA 592

Sequence Alignment: 6. Allergen Name: Bos d 6 Sequence ID: CAA41735

 Score = 411.4 bits 1488,  Expect = 4e-116
 Identities = 206/263 78%, Positives = 244/263 92%, Gaps = 1/263 0%
Query  2    SSAKERFKCASLQKFGDRAFKAWSVARLSQRFPKADFAEISKVVTDLTKVHKECCHGDLL 61
            SSA++R++CAS+QKFG+RA+KAWSVARLSQ+FPKA+F E++K+VTDLTKVHKECCHGDLL
Sbjct  215  SSARQRLRCASIQKFGERALKAWSVARLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDLL 274
Query  62   ECADDRADLAKYMCENQDSISTKLKECCDKPVLEKSQCLAEVERDELPGDLPSLAADFVE 121
            ECADDRADLAKY+C+NQD+IS+KLKECCDKP+LEKS+C+AEVE+D +P +LP L ADF E
Sbjct  275  ECADDRADLAKYICDNQDTISSKLKECCDKPLLEKSHCIAEVEKDAIPENLPPLTADFAE 334
Query  122  DKEVCKNYQEAKDVFLGTFLYEYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCYA 181
            DK+VCKNYQEAKD FLG+FLYEYSRRHPEY+VS+LLRLAKEYEATLE+CCA DDP  CY+
Sbjct  335  DKDVCKNYQEAKDAFLGSFLYEYSRRHPEYAVSVLLRLAKEYEATLEECCAKDDPHACYS 394
Query  182  KVLDEFKPLVDEPQNLVKTNCELFEKLGEYGFQNALLVRYTKKAPQVSTPTLVVEVSRKL 241
             V+D++K LVDEPQNL+K NC+ FEKLGEYGFQNAL+VRYT+K PQVSTPTLV EVSR L
Sbjct  395  TVFDKLKHLVDEPQNLIKQNCDQFEKLGEYGFQNALIVRYTRKVPQVSTPTLV-EVSRSL 453
Query  242  GKVGTKCCKKPESERMSCADDFLS 265
            GKVGT+CC KPESERM C +D+LS
Sbjct  454  GKVGTRCCTKPESERMPCTEDYLS 477
 Score = 76.7 bits 261,  Expect = 2e-15
 Identities = 47/162 29%, Positives = 82/162 50%, Gaps = 9/162 5%
Query  13   LQKFGDRAFKAWSVARLSQRFPKADFAEISKVVTDLTKVHKECCHGDLLE-CADDRADL- 70
            ++ +G+  FK   +  +SQ + +  F E  K+V +LT+  K C   +    C      L 
Sbjct  35   FKDLGEEHFKGLVLIAFSQYLQQCPFDEHVKLVNELTEFAKTCVADESHAGCEKSLHTLF 94
Query  71   AKYMCENQDSIST--KLKECCDKPVLEKSQCLAEVERDELPGDLPSLAADFVEDKEVCKN 128
               +C+      T   + +CC+K   E+++C+    +D+ P DLP L  D      +C  
Sbjct  95   GDELCKVASLRETYGDMADCCEKQEPERNECFLS-HKDDSP-DLPKLKPD---PNTLCDE 149
Query  129  YQEAKDVFLGTFLYEYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPPTC 179
            ++  +  F G +LYE +RRHP +    LL  A +Y   +++CC  +D   C
Sbjct  150  FKADEKKFWGKYLYEIARRHPYFYAPELLYYANKYNGVFQECCQAEDKGAC 200
 Score = 48.0 bits 156,  Expect = 9e-07
 Identities = 28/105 26%, Positives = 53/105 50%, Gaps = 8/105 7%
Query  74   MC--ENQDSISTKLKECCDKPVLEKSQCLAEVERDELPGDLPSLAAD---FVEDKEVCKN 128
            +C    +  +S K+ +CC + ++ +  C++ +  DE    +P  A D   F    ++C  
Sbjct  483  LCVLHEKTPVSEKVTKCCTESLVNRRPCFSALTPDETY--VPK-AFDEKLFTFHADICTL 539
Query  129  YQEAKDVFLGTFLYEYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCYA 181
                K +   T L E  +  P+ +   L  + + + A ++KCCA DD   C+A
Sbjct  540  PDTEKQIKKQTALVELLKHKPKATEEQLKTVMENFVAFVDKCCAADDKEACFA 592

Sequence Alignment: 7. Allergen Name: Equ c 3 Sequence ID: CAA52194

 Score = 405.2 bits 1465,  Expect = 3e-114
 Identities = 204/264 77%, Positives = 243/264 92%, Gaps = 1/264 0%
Query  1    LSSAKERFKCASLQKFGDRAFKAWSVARLSQRFPKADFAEISKVVTDLTKVHKECCHGDL 60
            LSSAKER+KC+S+Q FG+RA KAWSVARLSQ+FPKADFAE+SK+VTDLTKVHKECCHGDL
Sbjct  214  LSSAKERLKCSSFQNFGERAVKAWSVARLSQKFPKADFAEVSKIVTDLTKVHKECCHGDL 273
Query  61   LECADDRADLAKYMCENQDSISTKLKECCDKPVLEKSQCLAEVERDELPGDLPSLAADFV 120
            LECADDRADLAKY+CE+QDSIS KLK CCDKP+L+KS+C+AEV+ D+LP DLP+LAADF 
Sbjct  274  LECADDRADLAKYICEHQDSISGKLKACCDKPLLQKSHCIAEVKEDDLPSDLPALAADFA 333
Query  121  EDKEVCKNYQEAKDVFLGTFLYEYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCY 180
            EDKE+CK+Y++AKDVFLGTFLYEYSRRHP+YSVSLLLR+AK YEATLEKCCA  DPP CY
Sbjct  334  EDKEICKHYKDAKDVFLGTFLYEYSRRHPDYSVSLLLRIAKTYEATLEKCCAEADPPACY 393
Query  181  AKVLDEFKPLVDEPQNLVKTNCELFEKLGEYGFQNALLVRYTKKAPQVSTPTLVVEVSRK 240
              V+D+F PLV+EP++LVK NC+LFE++GEY FQNAL+VRYTKKAPQVSTPTLV E+ R 
Sbjct  394  RTVFDQFTPLVEEPKSLVKKNCDLFEEVGEYDFQNALIVRYTKKAPQVSTPTLV-EIGRT 452
Query  241  LGKVGTKCCKKPESERMSCADDFLS 265
            LGKVG++CCK PESER+ C+++ L+
Sbjct  453  LGKVGSRCCKLPESERLPCSENHLA 477
 Score = 87.3 bits 300,  Expect = 1e-18
 Identities = 55/168 32%, Positives = 91/168 54%, Gaps = 9/168 5%
Query  16   FGDRAFKAWSVARLSQRFPKADFAEISKVVTDLTKVHKECCHGDLLECADDRAD--LAKY 73
            +G++ FK   +  +SQ + +  F +  K+V ++T+  K+C   +  E  D      +   
Sbjct  38   LGEKHFKGLVLVAFSQYLQQCPFEDHVKLVNEVTEFAKKCAADESAENCDKSLHTLFGDK 97
Query  74   MCENQDSIST--KLKECCDKPVLEKSQCLAEVERDELPGDLPSLAADFVEDKEVCKNYQE 131
            +C      +T  +L +CC+K   E+++C+    +D+ P +LP L     E    C  +QE
Sbjct  98   LCTVATLRATYGELADCCEKQEPERNECFL-THKDDHP-NLPKLKP---EPDAQCAAFQE 152
Query  132  AKDVFLGTFLYEYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCYAKVLDEFK 188
              D FLG +LYE +RRHP +    LL  A+EY+A + +CC  DD   C    LD +K
Sbjct  153  DPDKFLGKYLYEVARRHPYFYGPELLFHAEEYKADFTECCPADDKLACLIPKLDALK 209
 Score = 50.2 bits 164,  Expect = 2e-07
 Identities = 27/107 25%, Positives = 53/107 49%, Gaps = 6/107 5%
Query  74   MC--ENQDSISTKLKECCDKPVLEKSQCLAEVERDELPGDLPSL--AADFVEDKEVCKNY 129
            +C    +  +S K+ +CC   + E+  C++ +E DE  G +P    A  F    ++C   
Sbjct  483  LCVLHEKTPVSEKITKCCTDSLAERRPCFSALELDE--GYVPKEFKAETFTFHADICTLP 540
Query  130  QEAKDVFLGTFLYEYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCYAK 182
            ++ K +   + L E  +  P+ +   L  +   + A + KCC  +D   C+A+
Sbjct  541  EDEKQIKKQSALAELVKHKPKATKEQLKTVLGNFSAFVAKCCGREDKEACFAE 593

Sequence Alignment: 8. Allergen Name: Cav p 4.0101 Sequence ID: Q6WDN9

 Score = 396.7 bits 1434,  Expect = 1e-111
 Identities = 201/264 76%, Positives = 238/264 90%, Gaps = 1/264 0%
Query  1    LSSAKERFKCASLQKFGDRAFKAWSVARLSQRFPKADFAEISKVVTDLTKVHKECCHGDL 60
            +SSA++R+KCASLQKFG+RAFKAWSVARLSQ+FPKA+FAEIS +VT LTKV KECCHGDL
Sbjct  215  VSSAQQRLKCASLQKFGERAFKAWSVARLSQKFPKAEFAEISTIVTSLTKVTKECCHGDL 274
Query  61   LECADDRADLAKYMCENQDSISTKLKECCDKPVLEKSQCLAEVERDELPGDLPSLAADFV 120
            LECADDR +LAKYMCE+QDSIS+KLKECC KP L+K++C+ E++RDELP +LP LA DFV
Sbjct  275  LECADDRQELAKYMCEHQDSISSKLKECCVKPTLQKAHCILEIQRDELPTELPDLAVDFV 334
Query  121  EDKEVCKNYQEAKDVFLGTFLYEYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCY 180
            EDKEVCKN+ EAKDVFLGTFLYEYSRRHPEYS+ +LLR+AK YEA LEKCCA  DP  CY
Sbjct  335  EDKEVCKNFAEAKDVFLGTFLYEYSRRHPEYSIGMLLRIAKGYEAKLEKCCAEADPHACY 394
Query  181  AKVLDEFKPLVDEPQNLVKTNCELFEKLGEYGFQNALLVRYTKKAPQVSTPTLVVEVSRK 240
            AKV+DE++PL+DEP+ LV+ NCELF+KLGEYGFQNAL VRYT+KAPQVSTPTLV E +RK
Sbjct  395  AKVFDELQPLIDEPKKLVQQNCELFDKLGEYGFQNALAVRYTQKAPQVSTPTLV-EYARK 453
Query  241  LGKVGTKCCKKPESERMSCADDFLS 265
            LG VGTKCC  PE+ER+SC +++L+
Sbjct  454  LGSVGTKCCSLPETERLSCTENYLA 478
 Score = 82.9 bits 284,  Expect = 3e-17
 Identities = 54/169 31%, Positives = 87/169 51%, Gaps = 8/169 4%
Query  16   FGDRAFKAWSVARLSQRFPKADFAEISKVVTDLTKVHKECCHGDLLE-CADDRADL-AKY 73
            +G+  FK   +  LSQ + K+ F E  K+V ++T   K C   +  + C    A L    
Sbjct  38   LGEGHFKGLVLITLSQHLQKSPFEEHVKLVNEVTDFAKACVADESAQNCGKAIATLFGDK 97
Query  74   MCENQDSIST--KLKECCDKPVLEKSQCLAEVERDELPGDLPSLAADFVEDKEVCKNYQE 131
            +C       T  +L +CC K   ++ +C+ +  +D+ P +LP +     E + +C  ++E
Sbjct  98   VCAIPSLRETYGELADCCAKEDPDRVECFLQ-HKDDNP-NLPPFERP--EPEALCTAFKE 153
Query  132  AKDVFLGTFLYEYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCYAKVLDEFK 188
              D F+G +LYE SRRHP +    LL  A++Y+  L +CC   D   C    LD  K
Sbjct  154  NNDRFIGHYLYEVSRRHPYFYAPELLYYAEKYKNALTECCEAADKAACLTPKLDAIK 210
 Score = 49.7 bits 162,  Expect = 3e-07
 Identities = 24/109 22%, Positives = 51/109 46%, Gaps = 2/109 1%
Query  74   MC--ENQDSISTKLKECCDKPVLEKSQCLAEVERDELPGDLPSLAADFVEDKEVCKNYQE 131
            +C    +  +S ++ +CC + ++ +  C++ +  DE     P  A  F    ++C   ++
Sbjct  484  LCILHEKTPVSERVTKCCTESLVNRRPCFSALHVDETYVPKPFHADSFTFHADICTLPEK 543
Query  132  AKDVFLGTFLYEYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCYAK 182
             K V     L E  +  P+ S   +  +  ++ A L+KCC  D+   C+ +
Sbjct  544  EKQVKKQMALVELVKHKPKASEEQMKTVMGDFAAFLKKCCDADNKEACFTE 594

Sequence Alignment: 9. Allergen Name: Gal d 5 Sequence ID: CAA43098

 Score = 279.4 bits 1004,  Expect = 2e-76
 Identities = 131/262 50%, Positives = 188/262 71%, Gaps = 1/262 0%
Query  3    SAKERFKCASLQKFGDRAFKAWSVARLSQRFPKADFAEISKVVTDLTKVHKECCHGDLLE 62
            S K+++ C  L++FGDR F+A  +  LSQ++PKA F+E+SK V D   VHKECC GD++E
Sbjct  221  SVKQQYFCGILKQFGDRVFQARQLIYLSQKYPKAPFSEVSKFVHDSIGVHKECCEGDMVE 280
Query  63   CADDRADLAKYMCENQDSISTKLKECCDKPVLEKSQCLAEVERDELPGDLPSLAADFVED 122
            C DD A +   +C  QD  S K+K+CC+KP++E+SQC+ E E DE P DLPSL   ++ED
Sbjct  281  CMDDMARMMSNLCSQQDVFSGKIKDCCEKPIVERSQCIMEAEFDEKPADLPSLVEKYIED 340
Query  123  KEVCKNYQEAKDVFLGTFLYEYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCYAK 182
            KEVCK+++   D F+  F+YEYSRRHPE+S+ L++R+AK YE+ LEKCC TD+P  CYA 
Sbjct  341  KEVCKSFEAGHDAFMAEFVYEYSRRHPEFSIQLIMRIAKGYESLLEKCCKTDNPAECYAN 400
Query  183  VLDEFKPLVDEPQNLVKTNCELFEKLGEYGFQNALLVRYTKKAPQVSTPTLVVEVSRKLG 242
              +++   + E Q++VKTNC+L+   GE  F  ++L+RYTKK PQV T  L++E  +K+ 
Sbjct  401  AQEQLNQHIKETQDVVKTNCDLLHDHGEADFLKSILIRYTKKMPQVPTD-LLLETGKKMT 459
Query  243  KVGTKCCKKPESERMSCADDFLS 265
             +GTKCC+  E  RM+C++ +LS
Sbjct  460  TIGTKCCQLGEDRRMACSEGYLS 482
 Score = 70.9 bits 240,  Expect = 1e-13
 Identities = 43/156 27%, Positives = 84/156 53%, Gaps = 13/156 8%
Query  18   DRAFKAWSVARLSQRFPKADFAEISKVVTDLTKVHKECCHG-DLLECADDRADLA-KYMC 75
            +  FKA ++  ++Q + +  +  +SK+V D+  + ++C    D  EC+     +    +C
Sbjct  43   EETFKAVAMITFAQYLQRCSYEGLSKLVKDVVDLAQKCVANEDAPECSKPLPSIILDEIC 102
Query  76   ENQ---DSISTKLKECCDKPVLEKSQCLA--EVERDELPGDLPSLAADFVEDKEVCKNYQ 130
            + +   DS    + +CC K   E+++C+   +V + ++       A+D +     C+ YQ
Sbjct  103  QVEKLRDSYGA-MADCCSKADPERNECFLSFKVSQPDFVQPYQRPASDVI-----CQEYQ 156
Query  131  EAKDVFLGTFLYEYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPPTC 179
            + +  FLG F+Y  +RRHP      +L +A ++E  L+ CC   D   C
Sbjct  157  DNRVSFLGHFIYSVARRHPFLYAPAILSFAVDFEHALQSCCKESDVGAC 205
 Score = 47.5 bits 154,  Expect = 1e-06
 Identities = 26/105 24%, Positives = 53/105 50%, Gaps = 8/105 7%
Query  75   CENQDS--ISTKLKECCDKPVLEKSQCLAE--VERDELPGDLPSLAAD-FVEDKEVCKNY 129
            C  Q++  I+  + +CC +    +  C+    V+   +P   P +  D F  D+++C   
Sbjct  489  CRKQETTPINDNVSQCCSQLYANRRPCFTAMGVDTKYVP---PPFNPDMFSFDEKLCSAP 545
Query  130  QEAKDVFLGTFLYEYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCYAK 182
             E ++V    +L    +R P+ +   +  +A  + A ++KCC   D  TC+ +
Sbjct  546  AEEREVGQMKLLINLIKRKPQMTEEQIKTIADGFTAMVDKCCKQSDINTCFGE 598

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.