The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAADLSARDVERAKFAFSIYDFEGKGTMDAFYVGDCLRALNLNPTLAVIEKVGGKTKKKE
KMLKVDDFLPIFAQVKKDKDAGSFEDFMEVLKLYDKTENGTMLYAELEHILLSLGERLEK
SELEPVLKDCCDEEDEDGFIPYEPFLKKLTQLL
Sequence Info Allergen Name Length Opt Bits Score E Value
A0A514C9K9 Scy p 3.0101 153 999 220.8 1.3e-59
J7HCX7 Pro c 5.0101 153 927 205.5 5.1e-55
A7L499 Art fr 5.0101 144 581 132.1 6.2e-33
AIO08852 Der f 26.0101 160 516 118.3 1e-28
QAT18638 Der p 26.0101 121 427 99.4 3.5e-23
P85100 Bos d 13.0201 199 381 89.5 5.5e-20
P02604 Gal d 7.0101 192 348 82.5 6.8e-18
A0JNJ5 Bos d 13.0101 192 347 82.3 7.9e-18
ADV17344 Pen m 6.0101 150 190 49.0 6.4e-08
Q9M7R0 Ole e 8 171 175 45.8 6.8e-07
QBF67841 Der f 39.0101 153 171 45.0 1.1e-06
AAF31152 Ole e 8 171 171 45.0 1.2e-06
ACL36923 Tyr p 24.0101 153 170 44.8 1.3e-06
QXY82447 Der p 39.0101 153 170 44.8 1.3e-06
D2DGW3 Tyr p 34.0101 153 170 44.8 1.3e-06
ABB89298 Bla g 6.0301 154 159 42.5 6.4e-06
Q2KN25 Amb a 10.0101 160 158 42.2 7.7e-06
P29291 Hom a 6.0101 150 156 41.8 9.6e-06
ABB89297 Bla g 6.0201 151 151 40.8 2e-05
Q1M0Y3 Per a 6.0101 151 147 39.9 3.6e-05
ABB89296 Bla g 6.0101 151 145 39.5 4.9e-05
O64943 Jun o 4 165 144 39.3 6.3e-05
ABP87672 Cup a 4.0101 177 133 36.9 0.00034
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Scy p 3.0101 Sequence ID: A0A514C9K9

 Score = 220.8 bits 999,  Expect = 1e-59
 Identities = 153/153 100%, Positives = 153/153 100%, Gaps = 0/153 0%
Query  1    MAADLSARDVERAKFAFSIYDFEGKGTMDAFYVGDCLRALNLNPTLAVIEKVGGKTKKKE 60
            MAADLSARDVERAKFAFSIYDFEGKGTMDAFYVGDCLRALNLNPTLAVIEKVGGKTKKKE
Sbjct  1    MAADLSARDVERAKFAFSIYDFEGKGTMDAFYVGDCLRALNLNPTLAVIEKVGGKTKKKE 60
Query  61   KMLKVDDFLPIFAQVKKDKDAGSFEDFMEVLKLYDKTENGTMLYAELEHILLSLGERLEK 120
            KMLKVDDFLPIFAQVKKDKDAGSFEDFMEVLKLYDKTENGTMLYAELEHILLSLGERLEK
Sbjct  61   KMLKVDDFLPIFAQVKKDKDAGSFEDFMEVLKLYDKTENGTMLYAELEHILLSLGERLEK 120
Query  121  SELEPVLKDCCDEEDEDGFIPYEPFLKKLTQLL 153
            SELEPVLKDCCDEEDEDGFIPYEPFLKKLTQLL
Sbjct  121  SELEPVLKDCCDEEDEDGFIPYEPFLKKLTQLL 153

Sequence Alignment: 2. Allergen Name: Pro c 5.0101 Sequence ID: J7HCX7

 Score = 205.5 bits 927,  Expect = 5e-55
 Identities = 135/153 88%, Positives = 150/153 98%, Gaps = 0/153 0%
Query  1    MAADLSARDVERAKFAFSIYDFEGKGTMDAFYVGDCLRALNLNPTLAVIEKVGGKTKKKE 60
            MAADLSARDVER KFAFSIYDFEG GTMDAFY+GDCLRALNLNPTLA+IEKVGGK K+KE
Sbjct  1    MAADLSARDVERVKFAFSIYDFEGNGTMDAFYIGDCLRALNLNPTLAIIEKVGGKEKRKE 60
Query  61   KMLKVDDFLPIFAQVKKDKDAGSFEDFMEVLKLYDKTENGTMLYAELEHILLSLGERLEK 120
            K++K+++F+PIFAQVKKDKDAGS+EDFMEVLKLYDK+ENGTM+YAELEHILLSLGERLEK
Sbjct  61   KIIKLEEFIPIFAQVKKDKDAGSYEDFMEVLKLYDKSENGTMMYAELEHILLSLGERLEK 120
Query  121  SELEPVLKDCCDEEDEDGFIPYEPFLKKLTQLL 153
            SELEPVLK+CC+EEDEDGFIPYEPFLKK+TQLL
Sbjct  121  SELEPVLKECCNEEDEDGFIPYEPFLKKMTQLL 153

Sequence Alignment: 3. Allergen Name: Art fr 5.0101 Sequence ID: A7L499

 Score = 132.1 bits 581,  Expect = 6e-33
 Identities = 87/133 65%, Positives = 113/133 84%, Gaps = 2/133 1%
Query  15   FAFSIYDFEGKGTMDAFYVGDCLRALNLNPTLAVIEKVGGKTKKKEKMLKVDDFLPIFAQ 74
            F+F+I   E +  M AFY+GDCLRALNLNPTLA IEK+GG  KK EK LKV++FLPIF+Q
Sbjct  3    FSFTIL-METRQLM-AFYLGDCLRALNLNPTLAQIEKLGGTKKKNEKKLKVEEFLPIFSQ 60
Query  75   VKKDKDAGSFEDFMEVLKLYDKTENGTMLYAELEHILLSLGERLEKSELEPVLKDCCDEE 134
            VKK+KD G++EDF+E +KLYDK+ENGTM+ AEL HILL+LGE+LE S+++ ++K+C D E
Sbjct  61   VKKEKDHGTLEDFIECMKLYDKSENGTMMLAELNHILLALGEKLEDSQVDSIFKECMDPE 120
Query  135  DEDGFIPYEPFLKKL 149
            D++G IPY PFLK+L
Sbjct  121  DDEGNIPYTPFLKRL 135

Sequence Alignment: 4. Allergen Name: Der f 26.0101 Sequence ID: AIO08852

 Score = 118.3 bits 516,  Expect = 1e-28
 Identities = 75/147 51%, Positives = 109/147 74%, Gaps = 0/147 0%
Query  3    ADLSARDVERAKFAFSIYDFEGKGTMDAFYVGDCLRALNLNPTLAVIEKVGGKTKKKEKM 62
            ADL   +VE+A++ F IYDF+G+  +D  Y+GD LR+L+L PT   + K G + KK +K 
Sbjct  2    ADLRPPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSVAKNGWEKKKGQKF 61
Query  63   LKVDDFLPIFAQVKKDKDAGSFEDFMEVLKLYDKTENGTMLYAELEHILLSLGERLEKSE 122
            +  ++FLPI++QVKKDKD G+FED++E LK+YDK ENGTM+ AEL H+LLSLGE+L  +E
Sbjct  62   MTFEEFLPIYSQVKKDKDCGAFEDLVEGLKVYDKAENGTMMEAELAHVLLSLGEKLTDAE 121
Query  123  LEPVLKDCCDEEDEDGFIPYEPFLKKL 149
            +E ++K C    D++GF+ YE F+K +
Sbjct  122  VEEIIKTCGGGCDDEGFMKYETFIKNV 148

Sequence Alignment: 5. Allergen Name: Der p 26.0101 Sequence ID: QAT18638

 Score = 99.4 bits 427,  Expect = 4e-23
 Identities = 63/114 55%, Positives = 88/114 77%, Gaps = 0/114 0%
Query  3    ADLSARDVERAKFAFSIYDFEGKGTMDAFYVGDCLRALNLNPTLAVIEKVGGKTKKKEKM 62
            ADL   +VE+A++ F IYDFEG+G +D   +GD LR+L+L PT  ++ K G + KK +K 
Sbjct  2    ADLRPPEVEKARLHFDIYDFEGQGKVDYHLLGDLLRSLDLRPTQEMVAKNGWEKKKGQKY 61
Query  63   LKVDDFLPIFAQVKKDKDAGSFEDFMEVLKLYDKTENGTMLYAELEHILLSLGE 116
            +  ++FLPI++QVKKDKD G++ED++E LK+YDK ENGTM+ AEL H+LLSLGE
Sbjct  62   MTFEEFLPIYSQVKKDKDCGAYEDLVEGLKVYDKAENGTMMEAELAHVLLSLGE 115

Sequence Alignment: 6. Allergen Name: Bos d 13.0201 Sequence ID: P85100

 Score = 89.5 bits 381,  Expect = 6e-20
 Identities = 62/143 43%, Positives = 98/143 68%, Gaps = 8/143 5%
Query  4    DLSARDVERAKFAFSIYDFEGKGTMDAFY--VGDCLRALNLNPTLAVIEKVGGKTKKKE- 60
            +++   +E  K AF+++D   K  M   Y   GD LRAL  NPT A + +V GK K++E 
Sbjct  49   EFTPEQIEEFKEAFTLFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEEL 108
Query  61   --KMLKVDDFLPIFAQVKKDKDAGSFEDFMEVLKLYDKTENGTMLYAELEHILLSLGERL 118
              KM+  D FLP++ ++ K+KD G++EDF+E L+++DK  NGT++ AEL H+L +LGE+L
Sbjct  109  NSKMMDFDTFLPMLQHISKNKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKL 168
Query  119  EKSELEPVLKDCCDEEDEDGFIPYEPFLKKL 149
             + E+E ++     +ED +G I YE F+K +
Sbjct  169  TEDEVEKLM---AGQEDSNGCINYEAFVKHI 196

Sequence Alignment: 7. Allergen Name: Gal d 7.0101 Sequence ID: P02604

 Score = 82.5 bits 348,  Expect = 7e-18
 Identities = 58/143 40%, Positives = 92/143 64%, Gaps = 6/143 4%
Query  4    DLSARDVERAKFAFSIYDFEGKGTMDAFYVGDCLRALNLNPTLAVIEKVGGKTKKKE--- 60
            ++S    +  K AF ++D  G   +    VGD +RAL  NPT A I K+ G   K+E   
Sbjct  44   EFSKEQQDDFKEAFLLFDRTGDAKITLSQVGDIVRALGQNPTNAEINKILGNPSKEEMNA 103
Query  61   KMLKVDDFLPIFAQVKKDKDAGSFEDFMEVLKLYDKTENGTMLYAELEHILLSLGERLEK 120
            K +  ++FLP++     +KD G+FEDF+E L+++DK  NGT++ AEL H+L +LGE++ +
Sbjct  104  KKITFEEFLPMLQAAANNKDQGTFEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMTE 163
Query  121  SELEPVLKDCCDEEDEDGFIPYEPFLKKL 149
             E+E ++K    +ED +G I YE F+K +
Sbjct  164  EEVEELMKG---QEDSNGCINYEAFVKHI 189

Sequence Alignment: 8. Allergen Name: Bos d 13.0101 Sequence ID: A0JNJ5

 Score = 82.3 bits 347,  Expect = 8e-18
 Identities = 56/143 39%, Positives = 95/143 66%, Gaps = 6/143 4%
Query  4    DLSARDVERAKFAFSIYDFEGKGTMDAFYVGDCLRALNLNPTLAVIEKVGGKTKKKE--- 60
            ++S +  +  K AF ++D  G+  +    VGD LRAL  NPT A ++KV G    +E   
Sbjct  44   EFSKQQQDEFKEAFLLFDRTGECKITLSQVGDVLRALGTNPTNAEVKKVLGNPSNEEMNA 103
Query  61   KMLKVDDFLPIFAQVKKDKDAGSFEDFMEVLKLYDKTENGTMLYAELEHILLSLGERLEK 120
            K ++ + FLP++  +  +KD G++EDF+E L+++DK  NGT++ AEL H+L +LGE++++
Sbjct  104  KKIEFEQFLPMLQAISNNKDQGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKE 163
Query  121  SELEPVLKDCCDEEDEDGFIPYEPFLKKL 149
             E+E ++     +ED +G I YE F+K +
Sbjct  164  EEVEALM---AGQEDSNGCINYEAFVKHI 189

Sequence Alignment: 9. Allergen Name: Pen m 6.0101 Sequence ID: ADV17344

 Score = 49.0 bits 190,  Expect = 6e-08
 Identities = 38/143 26%, Positives = 85/143 59%, Gaps = 6/143 4%
Query  5    LSARDVERAKFAFSIYDFEGKGTMDAFYVGDCLRALNLNPTLAVIEKVGGKTKKKEK-ML 63
            L    +E  + AF+ +D EG G+++A  VG  LR + +  +   +++V  +T +    ML
Sbjct  4    LDEEQIETLRKAFNSFDTEGAGSINAETVGVILRMMGVKISEKNLQEVIAETDEDGSGML 63
Query  64   KVDDFLPIFAQ--VKKDKDAGSFEDFMEVLKLYDKTENGTMLYAELEHILLSLGERLEKS 121
            + ++F  + A+  +++D++A   E + E +++YDK   G +    L+ IL+ L  +L  +
Sbjct  64   EFEEFAELAAKFLIEEDEEALKAE-LREAFRIYDKDCQGYITTDILKEILVELDPKLTPT 122
Query  122  ELEPVLKDCCDEEDEDGFIPYEPFLKKLT 150
            +LE ++++   +ED  G + ++ F++ ++
Sbjct  123  DLEGIIEEV--DEDGSGTLDFDEFMEMMS 149

Sequence Alignment: 10. Allergen Name: Ole e 8 Sequence ID: Q9M7R0

 Score = 45.8 bits 175,  Expect = 7e-07
 Identities = 37/131 28%, Positives = 67/131 51%, Gaps = 6/131 4%
Query  17   FSIYDFEGKGTMDAFYVGDCLRALNLNPTLAVIEKVGGKTKK-KEKMLKVDDFLPIFAQV 75
            F+ +D  G G +    +   L+AL  N +   I ++  +    K+  + V +F   F + 
Sbjct  25   FNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGFINVQEF-AAFVKA 83
Query  76   KKDK--DAGSFEDFMEVLKLYDKTENGTMLYAELEHILLSLGERLEKSELEPVLKDCCDE 133
            + D    +G   ++ E ++LYD+  NG +   EL  IL  LGER  + +   ++K    +
Sbjct  84   ETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERYAEHDCVEMIKSV--D 141
Query  134  EDEDGFIPYEPFLKKLT 150
             D DG++ +E F K +T
Sbjct  142  SDGDGYVSFEEFKKMMT 158

Sequence Alignment: 11. Allergen Name: Der f 39.0101 Sequence ID: QBF67841

 Score = 45.0 bits 171,  Expect = 1e-06
 Identities = 37/145 25%, Positives = 77/145 53%, Gaps = 4/145 2%
Query  4    DLSARDVERAKFAFSIYDFEGKGTMDAFYVGDCLRALNLNPTLAVIEKVGGKTKKKEK-M 62
            +L+   V+  + AF ++D E KG +    V   LR L        ++++  +        
Sbjct  5    ELTKEQVQMLRKAFDMFDREKKGHIHTNMVSTILRTLGQTFEEKDLQQLITEIDADGSGE 64
Query  63   LKVDDFLPIFAQVKKDKDAGSF-EDFMEVLKLYDKTENGTMLYAELEHILLSLGERLEKS 121
            L+ D+FL + A+   ++DA +  E++ E +++YDK  NG +  + L  IL +L ++L   
Sbjct  65   LEFDEFLTLTARFLVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTND 124
Query  122  ELEPVLKDCCDEEDEDGFIPYEPFLKKLT 150
            EL+ ++ +   + D  G + ++ F++ +T
Sbjct  125  ELDEMIAEI--DTDGSGTVDFDEFMEMMT 151

Sequence Alignment: 12. Allergen Name: Ole e 8 Sequence ID: AAF31152

 Score = 45.0 bits 171,  Expect = 1e-06
 Identities = 37/131 28%, Positives = 67/131 51%, Gaps = 6/131 4%
Query  17   FSIYDFEGKGTMDAFYVGDCLRALNLNPTLAVIEKVGGKTKK-KEKMLKVDDFLPIFAQV 75
            F+ +D  G G +    +   L+AL  N +   I ++  +    K+  + V +F   F + 
Sbjct  25   FNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFINVQEF-AAFVKA 83
Query  76   KKDK--DAGSFEDFMEVLKLYDKTENGTMLYAELEHILLSLGERLEKSELEPVLKDCCDE 133
            + D    +G   ++ E ++LYD+  NG +   EL  IL  LGER  + +   ++K    +
Sbjct  84   ETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERYAEHDCVEMIKSV--D 141
Query  134  EDEDGFIPYEPFLKKLT 150
             D DG++ +E F K +T
Sbjct  142  SDGDGYVSFEEFKKMMT 158

Sequence Alignment: 13. Allergen Name: Tyr p 24.0101 Sequence ID: ACL36923

 Score = 44.8 bits 170,  Expect = 1e-06
 Identities = 40/141 28%, Positives = 80/141 56%, Gaps = 12/141 8%
Query  4    DLSARDVERAKFAFSIYDFEGKGTMDAFYVGDCLRALNL----NPTLAVIEKVGGKTKKK 59
            +LS   V+  + AF ++D + KG +    V   LR L      N    +I ++      +
Sbjct  5    ELSKEQVQMLRKAFDMFDRDKKGYIHTNMVSTILRTLGQTFEENDLQQLIIEIDADGSGE 64
Query  60   EKMLKVDDFLPIFAQ--VKKDKDAGSFEDFMEVLKLYDKTENGTMLYAELEHILLSLGER 117
               L+ D+FL + A+  V++D +A   E++ E +++YDK  NG +  + L  IL +L ++
Sbjct  65   ---LEFDEFLTLTARFLVEEDTEAMQ-EELREAFRMYDKEGNGYIPTSALREILRALDDK 120
Query  118  LEKSELEPVLKDCCDEEDEDGFIPYEPFLKKLT 150
            L + EL+ ++ +   + D  G + ++ F++ +T
Sbjct  121  LTEDELDEMIAEI--DTDGSGTVDFDEFMEMMT 151

Sequence Alignment: 14. Allergen Name: Der p 39.0101 Sequence ID: QXY82447

 Score = 44.8 bits 170,  Expect = 1e-06
 Identities = 38/142 26%, Positives = 77/142 54%, Gaps = 10/142 7%
Query  4    DLSARDVERAKFAFSIYDFEGKGTMDAFYVGDCLRALNLN----PTLAVIEKVGGKTKKK 59
            +L+   V+  + AF ++D E KG +    V   LR L           +I ++      +
Sbjct  5    ELTKEQVQMLRKAFDMFDREKKGHIHTNMVSTILRTLGQTFEEKDLQTLITEIDADGSGE 64
Query  60   EKMLKVDDFLPIFAQVKKDKDAGSF-EDFMEVLKLYDKTENGTMLYAELEHILLSLGERL 118
               L+ D+FL + A+   ++DA +  E++ E +++YDK  NG +  + L  IL +L ++L
Sbjct  65   ---LEFDEFLTLTARFLVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKL 121
Query  119  EKSELEPVLKDCCDEEDEDGFIPYEPFLKKLT 150
               EL+ ++ +   + D  G + ++ F++ +T
Sbjct  122  TNDELDEMIAEI--DTDGSGTVDFDEFMEMMT 151

Sequence Alignment: 15. Allergen Name: Tyr p 34.0101 Sequence ID: D2DGW3

 Score = 44.8 bits 170,  Expect = 1e-06
 Identities = 40/141 28%, Positives = 80/141 56%, Gaps = 12/141 8%
Query  4    DLSARDVERAKFAFSIYDFEGKGTMDAFYVGDCLRALNL----NPTLAVIEKVGGKTKKK 59
            +LS   V+  + AF ++D + KG +    V   LR L      N    +I ++      +
Sbjct  5    ELSKEQVQMLRKAFDMFDRDKKGYIHTNMVSTILRTLGQTFEENDLQQLIIEIDADGSGE 64
Query  60   EKMLKVDDFLPIFAQ--VKKDKDAGSFEDFMEVLKLYDKTENGTMLYAELEHILLSLGER 117
               L+ D+FL + A+  V++D +A   E++ E +++YDK  NG +  + L  IL +L ++
Sbjct  65   ---LEFDEFLTLTARFLVEEDTEAMQ-EELREAFRMYDKEGNGYIPTSALREILRALDDK 120
Query  118  LEKSELEPVLKDCCDEEDEDGFIPYEPFLKKLT 150
            L + EL+ ++ +   + D  G + ++ F++ +T
Sbjct  121  LTEDELDEMIAEI--DTDGSGTVDFDEFMEMMT 151

Sequence Alignment: 16. Allergen Name: Bla g 6.0301 Sequence ID: ABB89298

 Score = 42.5 bits 159,  Expect = 6e-06
 Identities = 35/133 26%, Positives = 72/133 54%, Gaps = 4/133 3%
Query  16   AFSIYDFEGKGTMDAFYVGDCLRALNLNPTLAVIEKVGGKTKK-KEKMLKVDDFLPIFAQ 74
            AF  +D E  G++    V + LR +        +E++  +    K   L+ D+F+ + A+
Sbjct  19   AFDAFDREKSGSISTNMVEEILRLMGQPFNRRTLEELIDEVDADKSGRLEFDEFVTLAAK 78
Query  75   VKKDKDAGSFE-DFMEVLKLYDKTENGTMLYAELEHILLSLGERLEKSELEPVLKDCCDE 133
               ++D+ + E ++ E ++LYDK  NG +  + L  IL  L E+L   EL+ ++++   +
Sbjct  79   FIIEEDSEAMEKELREAFRLYDKEGNGYIPTSCLREILRELDEQLTSDELDMMIEEI--D 136
Query  134  EDEDGFIPYEPFLKKLT 150
             D  G + ++ F++ +T
Sbjct  137  ADGSGTVDFDEFMEMMT 153

Sequence Alignment: 17. Allergen Name: Amb a 10.0101 Sequence ID: Q2KN25

 Score = 42.2 bits 158,  Expect = 8e-06
 Identities = 34/139 24%, Positives = 68/139 48%, Gaps = 5/139 3%
Query  9    DVERAKFAFSIYDFEGKGTMDAFYVGDCLRALNLNPTLAVIEKVGGKTKKK-EKMLKVDD 67
            D E     F+ +D  G G +    +   L++L  + +   +++V  +     +  + +D+
Sbjct  14   DKEEVTKIFNRFDTNGDGQISEDELFAILKSLGSDTSPDEVKRVMAEIDADGDGFISLDE 73
Query  68   FLPIFAQVKKDKDAGSFEDFMEVLKLYDKTENGTMLYAELEHILLSLGERLEKSELEPVL 127
            F+     ++ + D     D+ E +K+YD+  NG +   EL +IL  LGE         ++
Sbjct  74   FILFCKGIESEGDE--INDLKEAFKFYDQNNNGVISANELHQILGRLGENYSVESCADMI 131
Query  128  KDCCDEEDEDGFIPYEPFLKKLTQ 151
            K    + D DGF+ +E F K +++
Sbjct  132  KSV--DSDGDGFVDFEEFRKMMSR 153

Sequence Alignment: 18. Allergen Name: Hom a 6.0101 Sequence ID: P29291

 Score = 41.8 bits 156,  Expect = 1e-05
 Identities = 35/142 24%, Positives = 79/142 55%, Gaps = 6/142 4%
Query  5    LSARDVERAKFAFSIYDFEGKGTMDAFYVGDCLRALNLNPTLAVIEKVGGKTKKKEK-ML 63
            L A  +   + AF  +D + KG +    VG  LR + +  +   +++V  +T +     L
Sbjct  4    LDAEQLSALQKAFDSFDTDSKGFITPETVGVILRMMGVKISEKNLQEVISETDEDGSGEL 63
Query  64   KVDDFLPIFAQ--VKKDKDAGSFEDFMEVLKLYDKTENGTMLYAELEHILLSLGERLEKS 121
            + ++F+ + A+  +++D++A   E + E +++YD+  NG +    L+ IL  L  RL + 
Sbjct  64   EFEEFVELAAKFLIEEDEEALKAE-LREAFRVYDRGGNGYITTDVLKEILRELDNRLTEE 122
Query  122  ELEPVLKDCCDEEDEDGFIPYEPFLKKL 149
            +L+ ++++   +ED  G + +  F++ +
Sbjct  123  DLDSIIEEV--DEDGSGTLDFNEFMQMM 148

Sequence Alignment: 19. Allergen Name: Bla g 6.0201 Sequence ID: ABB89297

 Score = 40.8 bits 151,  Expect = 2e-05
 Identities = 34/145 23%, Positives = 75/145 51%, Gaps = 4/145 2%
Query  4    DLSARDVERAKFAFSIYDFEGKGTMDAFYVGDCLRALNLNPTLAVIEKVGGKTKKKEK-M 62
            ++ A  V   K AF  +D E KG +    VG  L  L       +++++  +        
Sbjct  3    EIPAEQVVLLKKAFDAFDREKKGCISTEMVGTILEMLGTRLDQDMLDEIIAEVDADGSGE 62
Query  63   LKVDDFLPIFAQVKKDKDAGSFE-DFMEVLKLYDKTENGTMLYAELEHILLSLGERLEKS 121
            L+ ++F  + ++   ++DA + + ++ E ++LYDK  NG +  A L  IL  L +++   
Sbjct  63   LEFEEFCTLASRFLVEEDAEAMQHELREAFRLYDKEGNGYITTAVLREILKELDDKITAE 122
Query  122  ELEPVLKDCCDEEDEDGFIPYEPFLKKLT 150
            +L+ ++++   + D  G + ++ F++ +T
Sbjct  123  DLDMMIEEI--DSDGSGTVDFDEFMEVMT 149

Sequence Alignment: 20. Allergen Name: Per a 6.0101 Sequence ID: Q1M0Y3

 Score = 39.9 bits 147,  Expect = 4e-05
 Identities = 34/145 23%, Positives = 73/145 50%, Gaps = 4/145 2%
Query  4    DLSARDVERAKFAFSIYDFEGKGTMDAFYVGDCLRALNLNPTLAVIEKVGGKTKKKEK-M 62
            +L    ++  K AF  +D E  G +    VG  L  L       ++E++  +        
Sbjct  3    ELPDEQIQLLKKAFDAFDREKNGFISTDMVGTILEMLGHPLDDDMLEEIIAEVDADGSGE 62
Query  63   LKVDDFLPIFAQVKKDKDAGSFE-DFMEVLKLYDKTENGTMLYAELEHILLSLGERLEKS 121
            L+  +F+ + A+   ++DA + + ++ E ++LYDK  NG +    L  IL  L ++L   
Sbjct  63   LEFQEFVTLAARFLVEEDAEAMQQELKEAFRLYDKEGNGYITTTVLREILKELDDKLTNE 122
Query  122  ELEPVLKDCCDEEDEDGFIPYEPFLKKLT 150
            +L+ ++++   + D  G + ++ F++ +T
Sbjct  123  DLDAMIEEI--DSDGSGTVDFDEFMEVMT 149

Sequence Alignment: 21. Allergen Name: Bla g 6.0101 Sequence ID: ABB89296

 Score = 39.5 bits 145,  Expect = 5e-05
 Identities = 32/145 22%, Positives = 75/145 51%, Gaps = 4/145 2%
Query  4    DLSARDVERAKFAFSIYDFEGKGTMDAFYVGDCLRALNLNPTLAVIEKVGGKTKKKEK-M 62
            +L    ++  K AF  +D E KG +    VG  L  L       +++++  +        
Sbjct  3    ELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDMLQEIIAEVDADGSGE 62
Query  63   LKVDDFLPIFAQVKKDKDAGSFE-DFMEVLKLYDKTENGTMLYAELEHILLSLGERLEKS 121
            L+ ++F+ + ++   ++DA + + ++ E ++LYDK  NG +    L  IL  L +++   
Sbjct  63   LEFEEFVSLASRFLVEEDAEAMQQELREAFRLYDKEGNGYITTNVLREILKELDDKITAE 122
Query  122  ELEPVLKDCCDEEDEDGFIPYEPFLKKLT 150
            +L+ ++++   + D  G + ++ F++ +T
Sbjct  123  DLDMMIEEI--DSDGSGTVDFDEFMEVMT 149

Sequence Alignment: 22. Allergen Name: Jun o 4 Sequence ID: O64943

 Score = 39.3 bits 144,  Expect = 6e-05
 Identities = 35/136 25%, Positives = 66/136 48%, Gaps = 7/136 5%
Query  8    RDVERAKFAFSIYDFEGKGTMDAFYVGDCLRALNLNPTLAVIEKVGGKTKKKEKMLKVDD 67
            + V   +  F  +D  G G +    + D LR+L  +   A +     K   +E     D 
Sbjct  22   QSVHELEEVFKKFDANGDGKISGSELADILRSLGSDVGEAEV-----KAMMEEADADGDG 76
Query  68   FLPIFAQVKKDKDAGSFEDFMEVLKLYDKTENGTMLYAELEHILLSLGERLEKSELEPVL 127
            ++ +   V  +    S +D+   +K++D+  NG++  AEL H L S+GE     E + ++
Sbjct  77   YVSLQEFVDLNNKGASVKDLKNAFKVFDRDCNGSISAAELCHTLESVGEPCTIEESKNII 136
Query  128  KDCCDEEDEDGFIPYEPFLKKLT 150
             +   +++ DG+I  E F   +T
Sbjct  137  HNV--DKNGDGLISVEEFQTMMT 157

Sequence Alignment: 23. Allergen Name: Cup a 4.0101 Sequence ID: ABP87672

 Score = 36.9 bits 133,  Expect = 0.0003
 Identities = 32/136 23%, Positives = 67/136 49%, Gaps = 7/136 5%
Query  8    RDVERAKFAFSIYDFEGKGTMDAFYVGDCLRALNLNPTLAVIEKVGGKTKKKEKMLKVDD 67
            + V   +  F  +D  G G +    + D LR++      + +++   K   +E     D 
Sbjct  34   QSVHELEEVFKKFDANGDGKISGSELADILRSMG-----SEVDEAEVKAMMEEADTDGDG 88
Query  68   FLPIFAQVKKDKDAGSFEDFMEVLKLYDKTENGTMLYAELEHILLSLGERLEKSELEPVL 127
            ++ +   V  +    + +D+   +K++D+  NGT+  AEL + L S+GE     E + ++
Sbjct  89   YVSLQEFVDLNIKGATVKDLKNAFKVFDRDCNGTISPAELCQTLKSMGEPCTIEESKNII 148
Query  128  KDCCDEEDEDGFIPYEPFLKKLT 150
             +   +++ DG+I  E F   +T
Sbjct  149  HNV--DKNGDGLISVEEFQTMMT 169

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.