The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAANTDRNSKPSVYLQEPNEVQGVFNRFDANGDGKISGDELACALKALGSNTSKEEIARM
MEEIDTDKDGFINVQEFAAFVKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKI
LTRLGERYAEHDCVEMIKSVDSDGDGYVSFEEFKKMMTNKSGNNSQAEPPK
Sequence Info Allergen Name Length Opt Bits Score E Value
AAF31152 Ole e 8 171 1125 228.0 1.1e-61
Q9M7R0 Ole e 8 171 1094 222.0 7.1e-60
Q2KN25 Amb a 10.0101 160 575 121.3 1.4e-29
ABP87672 Cup a 4.0101 177 398 86.9 3.4e-19
O64943 Jun o 4 165 393 85.9 6.2e-19
Q1M0Y3 Per a 6.0101 151 289 65.8 6.7e-13
ABB89298 Bla g 6.0301 154 289 65.8 6.8e-13
ABB89297 Bla g 6.0201 151 278 63.6 2.9e-12
ABB89296 Bla g 6.0101 151 275 63.1 4.4e-12
D2DGW3 Tyr p 34.0101 153 274 62.9 5.1e-12
ACL36923 Tyr p 24.0101 153 274 62.9 5.1e-12
QBF67841 Der f 39.0101 153 271 62.3 7.6e-12
QXY82447 Der p 39.0101 153 269 61.9 1e-11
ADV17344 Pen m 6.0101 150 268 61.7 1.1e-11
P29291 Hom a 6.0101 150 261 60.3 2.9e-11
O81092 Ole e 3 84 250 58.3 6.7e-11
P58171 Syr v 3 81 249 58.1 7.4e-11
CAA73147 Bet v 4 85 243 56.9 1.7e-10
ALE34025 Sal k 7.0101 86 243 56.9 1.8e-10
Q39419 Bet v 4 85 239 56.1 3e-10
O82040 Phl p 7 78 234 55.2 5.3e-10
P94092 Cyn d 7 80 234 55.2 5.5e-10
CAA62634 Cyn d 7 82 234 55.2 5.6e-10
CAP05019 Par j 4.0101 84 233 55.0 6.6e-10
O81701 Aln g 4 85 233 55.0 6.7e-10
BAA09633 Bra n 2 82 232 54.8 7.4e-10
Q39406 Bra n 2 83 232 54.8 7.5e-10
AAL92871 Che a 3 86 232 54.8 7.8e-10
AY904434 Art v 5.0101 82 208 50.1 1.9e-08
P69197 Bra r 5.0101 79 204 49.3 3.1e-08
J7HCX7 Pro c 5.0101 153 190 46.6 4.1e-07
AIO08852 Der f 26.0101 160 174 43.4 3.7e-06
A0A514C9K9 Scy p 3.0101 153 171 42.9 5.3e-06
CAQ72972 Clu h 1.0301 109 135 35.9 0.00047
CAQ72970 Clu h 1.0101 109 134 35.7 0.00053
QAT18638 Der p 26.0101 121 133 35.5 0.00068
P43187 Bet v 3 205 132 35.3 0.0014
CAC83658 Cyp c 1.01 109 121 33.2 0.0031
XP_019397705 Cro p 1.0101 109 120 33.0 0.0035
FM177701 Sar sa 1.0101 109 119 32.8 0.004
CAQ72967 Thu a 1.0101 109 119 32.8 0.004
XP_019400389 Cro p 2.0101 110 117 32.4 0.0053
H6WP59 Per a 8.0101 208 122 33.3 0.0054
A7L499 Art fr 5.0101 144 116 32.2 0.0081
XP_026772003 Pan h 1.0101 109 113 31.6 0.009
XP_026803769 Pan h 1.0201 109 113 31.6 0.009
ABD47458 Bla g 8.0101 195 117 32.4 0.0099
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ole e 8 Sequence ID: AAF31152

 Score = 228.0 bits 1125,  Expect = 1e-61
 Identities = 171/171 100%, Positives = 171/171 100%, Gaps = 0/171 0%
Query  1    MAANTDRNSKPSVYLQEPNEVQGVFNRFDANGDGKISGDELACALKALGSNTSKEEIARM 60
            MAANTDRNSKPSVYLQEPNEVQGVFNRFDANGDGKISGDELACALKALGSNTSKEEIARM
Sbjct  1    MAANTDRNSKPSVYLQEPNEVQGVFNRFDANGDGKISGDELACALKALGSNTSKEEIARM 60
Query  61   MEEIDTDKDGFINVQEFAAFVKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKI 120
            MEEIDTDKDGFINVQEFAAFVKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKI
Sbjct  61   MEEIDTDKDGFINVQEFAAFVKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKI 120
Query  121  LTRLGERYAEHDCVEMIKSVDSDGDGYVSFEEFKKMMTNKSGNNSQAEPPK 171
            LTRLGERYAEHDCVEMIKSVDSDGDGYVSFEEFKKMMTNKSGNNSQAEPPK
Sbjct  121  LTRLGERYAEHDCVEMIKSVDSDGDGYVSFEEFKKMMTNKSGNNSQAEPPK 171

Sequence Alignment: 2. Allergen Name: Ole e 8 Sequence ID: Q9M7R0

 Score = 222.0 bits 1094,  Expect = 7e-60
 Identities = 167/171 97%, Positives = 168/171 98%, Gaps = 0/171 0%
Query  1    MAANTDRNSKPSVYLQEPNEVQGVFNRFDANGDGKISGDELACALKALGSNTSKEEIARM 60
            MAANTDRNSKPSVYLQEPNEVQGVFNRFDANGDGKISGDELA  LKALGSNTSKEEI R+
Sbjct  1    MAANTDRNSKPSVYLQEPNEVQGVFNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRI 60
Query  61   MEEIDTDKDGFINVQEFAAFVKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKI 120
            MEEIDTDKDGFINVQEFAAFVKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKI
Sbjct  61   MEEIDTDKDGFINVQEFAAFVKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKI 120
Query  121  LTRLGERYAEHDCVEMIKSVDSDGDGYVSFEEFKKMMTNKSGNNSQAEPPK 171
            LTRLGERYAEHDCVEMIKSVDSDGDGYVSFEEFKKMMTNKSGNNSQAEPPK
Sbjct  121  LTRLGERYAEHDCVEMIKSVDSDGDGYVSFEEFKKMMTNKSGNNSQAEPPK 171

Sequence Alignment: 3. Allergen Name: Amb a 10.0101 Sequence ID: Q2KN25

 Score = 121.3 bits 575,  Expect = 1e-29
 Identities = 89/154 57%, Positives = 117/154 75%, Gaps = 5/154 3%
Query  8    NSKPSVYLQEPNEVQGVFNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTD 67
            N+K S++  +  EV  +FNRFD NGDG+IS DEL   LK+LGS+TS +E+ R+M EID D
Sbjct  5    NNKHSIFPTDKEEVTKIFNRFDTNGDGQISEDELFAILKSLGSDTSPDEVKRVMAEIDAD 64
Query  68   KDGFINVQEFAAFVKAETDPYPSSGGE-NELKEAFELYDQDHNGLISSVELHKILTRLGE 126
             DGFI++ EF  F K       S G E N+LKEAF++YDQ++NG+IS+ ELH+IL RLGE
Sbjct  65   GDGFISLDEFILFCKG----IESEGDEINDLKEAFKFYDQNNNGVISANELHQILGRLGE 120
Query  127  RYAEHDCVEMIKSVDSDGDGYVSFEEFKKMMTNKSGNNS 165
             Y+   C +MIKSVDSDGDG+V FEEF+KMM+ K G+ +
Sbjct  121  NYSVESCADMIKSVDSDGDGFVDFEEFRKMMSRKGGDGA 159

Sequence Alignment: 4. Allergen Name: Cup a 4.0101 Sequence ID: ABP87672

 Score = 86.9 bits 398,  Expect = 3e-19
 Identities = 67/151 44%, Positives = 100/151 66%, Gaps = 9/151 5%
Query  8    NSKPSVYLQEPNEVQGVFNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTD 67
            +S   V  Q  +E++ VF +FDANGDGKISG ELA  L+++GS   + E+  MMEE DTD
Sbjct  26   SSGKRVLEQSVHELEEVFKKFDANGDGKISGSELADILRSMGSEVDEAEVKAMMEEADTD 85
Query  68   KDGFINVQEFAAF-VKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGE 126
             DG++++QEF  + +K  T          +LK AF+++D+D NG IS  EL + L  +GE
Sbjct  86   GDGYVSLQEFVDLNIKGAT--------VKDLKNAFKVFDRDCNGTISPAELCQTLKSMGE 137
Query  127  RYAEHDCVEMIKSVDSDGDGYVSFEEFKKMMTNKSGNNSQ 166
                 +   +I +VD +GDG +S EEF+ MMT++  + S+
Sbjct  138  PCTIEESKNIIHNVDKNGDGLISVEEFQTMMTSEMTDKSK 177

Sequence Alignment: 5. Allergen Name: Jun o 4 Sequence ID: O64943

 Score = 85.9 bits 393,  Expect = 6e-19
 Identities = 65/147 44%, Positives = 95/147 64%, Gaps = 7/147 4%
Query  13   VYLQEPNEVQGVFNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFI 72
            V  Q  +E++ VF +FDANGDGKISG ELA  L++LGS+  + E+  MMEE D D DG++
Sbjct  19   VMEQSVHELEEVFKKFDANGDGKISGSELADILRSLGSDVGEAEVKAMMEEADADGDGYV 78
Query  73   NVQEFAAFVKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERYAEHD 132
            ++QEF        D         +LK AF+++D+D NG IS+ EL   L  +GE     +
Sbjct  79   SLQEFV-------DLNNKGASVKDLKNAFKVFDRDCNGSISAAELCHTLESVGEPCTIEE 131
Query  133  CVEMIKSVDSDGDGYVSFEEFKKMMTNKSGNNSQ 166
               +I +VD +GDG +S EEF+ MMT++  + S+
Sbjct  132  SKNIIHNVDKNGDGLISVEEFQTMMTSEMTDKSK 165

Sequence Alignment: 6. Allergen Name: Per a 6.0101 Sequence ID: Q1M0Y3

 Score = 65.8 bits 289,  Expect = 7e-13
 Identities = 47/140 33%, Positives = 75/140 53%, Gaps = 0/140 0%
Query  21   VQGVFNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFINVQEFAAF 80
            ++  F+ FD   +G IS D +   L+ LG     + +  ++ E+D D  G +  QEF  +
Sbjct  12   LKKAFDAFDREKNGFISTDMVGTILEMLGHPLDDDMLEEIIAEVDADGSGELEFQEFVTL 71
Query  81   VKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERYAEHDCVEMIKSV 140
                     +   + ELKEAF LYD++ NG I++  L +IL  L ++    D   MI+ +
Sbjct  72   AARFLVEEDAEAMQQELKEAFRLYDKEGNGYITTTVLREILKELDDKLTNEDLDAMIEEI 131
Query  141  DSDGDGYVSFEEFKKMMTNK 160
            DSDG G V F+EF ++MT +
Sbjct  132  DSDGSGTVDFDEFMEVMTGE 151

Sequence Alignment: 7. Allergen Name: Bla g 6.0301 Sequence ID: ABB89298

 Score = 65.8 bits 289,  Expect = 7e-13
 Identities = 50/144 34%, Positives = 78/144 54%, Gaps = 4/144 2%
Query  15   LQEPNE----VQGVFNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDG 70
            LQ P E    ++  F+ FD    G IS + +   L+ +G   ++  +  +++E+D DK G
Sbjct  6    LQLPPEQISVLRKAFDAFDREKSGSISTNMVEEILRLMGQPFNRRTLEELIDEVDADKSG 65
Query  71   FINVQEFAAFVKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERYAE 130
             +   EF  +         S   E EL+EAF LYD++ NG I +  L +IL  L E+   
Sbjct  66   RLEFDEFVTLAAKFIIEEDSEAMEKELREAFRLYDKEGNGYIPTSCLREILRELDEQLTS 125
Query  131  HDCVEMIKSVDSDGDGYVSFEEFKKMMT 158
             +   MI+ +D+DG G V F+EF +MMT
Sbjct  126  DELDMMIEEIDADGSGTVDFDEFMEMMT 153

Sequence Alignment: 8. Allergen Name: Bla g 6.0201 Sequence ID: ABB89297

 Score = 63.6 bits 278,  Expect = 3e-12
 Identities = 44/140 31%, Positives = 77/140 55%, Gaps = 0/140 0%
Query  21   VQGVFNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFINVQEFAAF 80
            ++  F+ FD    G IS + +   L+ LG+   ++ +  ++ E+D D  G +  +EF  +
Sbjct  12   LKKAFDAFDREKKGCISTEMVGTILEMLGTRLDQDMLDEIIAEVDADGSGELEFEEFCTL 71
Query  81   VKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERYAEHDCVEMIKSV 140
                     +   ++EL+EAF LYD++ NG I++  L +IL  L ++    D   MI+ +
Sbjct  72   ASRFLVEEDAEAMQHELREAFRLYDKEGNGYITTAVLREILKELDDKITAEDLDMMIEEI 131
Query  141  DSDGDGYVSFEEFKKMMTNK 160
            DSDG G V F+EF ++MT +
Sbjct  132  DSDGSGTVDFDEFMEVMTGE 151

Sequence Alignment: 9. Allergen Name: Bla g 6.0101 Sequence ID: ABB89296

 Score = 63.1 bits 275,  Expect = 4e-12
 Identities = 46/143 32%, Positives = 77/143 53%, Gaps = 3/143 2%
Query  18   PNEVQ---GVFNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFINV 74
            P ++Q     F+ FD    G IS + +   L+ LG     + +  ++ E+D D  G +  
Sbjct  6    PEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDMLQEIIAEVDADGSGELEF 65
Query  75   QEFAAFVKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERYAEHDCV 134
            +EF ++         +   + EL+EAF LYD++ NG I++  L +IL  L ++    D  
Sbjct  66   EEFVSLASRFLVEEDAEAMQQELREAFRLYDKEGNGYITTNVLREILKELDDKITAEDLD 125
Query  135  EMIKSVDSDGDGYVSFEEFKKMMTNK 160
             MI+ +DSDG G V F+EF ++MT +
Sbjct  126  MMIEEIDSDGSGTVDFDEFMEVMTGE 151

Sequence Alignment: 10. Allergen Name: Tyr p 34.0101 Sequence ID: D2DGW3

 Score = 62.9 bits 274,  Expect = 5e-12
 Identities = 44/134 32%, Positives = 73/134 54%, Gaps = 0/134 0%
Query  25   FNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFINVQEFAAFVKAE 84
            F+ FD +  G I  + ++  L+ LG    + ++ +++ EID D  G +   EF  +    
Sbjct  18   FDMFDRDKKGYIHTNMVSTILRTLGQTFEENDLQQLIIEIDADGSGELEFDEFLTLTARF 77
Query  85   TDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERYAEHDCVEMIKSVDSDG 144
                 +   + EL+EAF +YD++ NG I +  L +IL  L ++  E +  EMI  +D+DG
Sbjct  78   LVEEDTEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTEDELDEMIAEIDTDG 137
Query  145  DGYVSFEEFKKMMT 158
             G V F+EF +MMT
Sbjct  138  SGTVDFDEFMEMMT 151

Sequence Alignment: 11. Allergen Name: Tyr p 24.0101 Sequence ID: ACL36923

 Score = 62.9 bits 274,  Expect = 5e-12
 Identities = 44/134 32%, Positives = 73/134 54%, Gaps = 0/134 0%
Query  25   FNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFINVQEFAAFVKAE 84
            F+ FD +  G I  + ++  L+ LG    + ++ +++ EID D  G +   EF  +    
Sbjct  18   FDMFDRDKKGYIHTNMVSTILRTLGQTFEENDLQQLIIEIDADGSGELEFDEFLTLTARF 77
Query  85   TDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERYAEHDCVEMIKSVDSDG 144
                 +   + EL+EAF +YD++ NG I +  L +IL  L ++  E +  EMI  +D+DG
Sbjct  78   LVEEDTEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTEDELDEMIAEIDTDG 137
Query  145  DGYVSFEEFKKMMT 158
             G V F+EF +MMT
Sbjct  138  SGTVDFDEFMEMMT 151

Sequence Alignment: 12. Allergen Name: Der f 39.0101 Sequence ID: QBF67841

 Score = 62.3 bits 271,  Expect = 8e-12
 Identities = 43/134 32%, Positives = 72/134 53%, Gaps = 0/134 0%
Query  25   FNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFINVQEFAAFVKAE 84
            F+ FD    G I  + ++  L+ LG    ++++ +++ EID D  G +   EF  +    
Sbjct  18   FDMFDREKKGHIHTNMVSTILRTLGQTFEEKDLQQLITEIDADGSGELEFDEFLTLTARF 77
Query  85   TDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERYAEHDCVEMIKSVDSDG 144
                 +   + EL+EAF +YD++ NG I +  L +IL  L ++    +  EMI  +D+DG
Sbjct  78   LVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTNDELDEMIAEIDTDG 137
Query  145  DGYVSFEEFKKMMT 158
             G V F+EF +MMT
Sbjct  138  SGTVDFDEFMEMMT 151

Sequence Alignment: 13. Allergen Name: Der p 39.0101 Sequence ID: QXY82447

 Score = 61.9 bits 269,  Expect = 1e-11
 Identities = 43/134 32%, Positives = 71/134 52%, Gaps = 0/134 0%
Query  25   FNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFINVQEFAAFVKAE 84
            F+ FD    G I  + ++  L+ LG    ++++  ++ EID D  G +   EF  +    
Sbjct  18   FDMFDREKKGHIHTNMVSTILRTLGQTFEEKDLQTLITEIDADGSGELEFDEFLTLTARF 77
Query  85   TDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERYAEHDCVEMIKSVDSDG 144
                 +   + EL+EAF +YD++ NG I +  L +IL  L ++    +  EMI  +D+DG
Sbjct  78   LVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTNDELDEMIAEIDTDG 137
Query  145  DGYVSFEEFKKMMT 158
             G V F+EF +MMT
Sbjct  138  SGTVDFDEFMEMMT 151

Sequence Alignment: 14. Allergen Name: Pen m 6.0101 Sequence ID: ADV17344

 Score = 61.7 bits 268,  Expect = 1e-11
 Identities = 43/134 32%, Positives = 70/134 52%, Gaps = 0/134 0%
Query  25   FNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFINVQEFAAFVKAE 84
            FN FD  G G I+ + +   L+ +G   S++ +  ++ E D D  G +  +EFA +    
Sbjct  16   FNSFDTEGAGSINAETVGVILRMMGVKISEKNLQEVIAETDEDGSGMLEFEEFAELAAKF 75
Query  85   TDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERYAEHDCVEMIKSVDSDG 144
                     + EL+EAF +YD+D  G I++  L +IL  L  +    D   +I+ VD DG
Sbjct  76   LIEEDEEALKAELREAFRIYDKDCQGYITTDILKEILVELDPKLTPTDLEGIIEEVDEDG 135
Query  145  DGYVSFEEFKKMMT 158
             G + F+EF +MM+
Sbjct  136  SGTLDFDEFMEMMS 149

Sequence Alignment: 15. Allergen Name: Hom a 6.0101 Sequence ID: P29291

 Score = 60.3 bits 261,  Expect = 3e-11
 Identities = 44/146 30%, Positives = 75/146 51%, Gaps = 0/146 0%
Query  12   SVYLQEPNEVQGVFNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGF 71
            S+  ++ + +Q  F+ FD +  G I+ + +   L+ +G   S++ +  ++ E D D  G 
Sbjct  3    SLDAEQLSALQKAFDSFDTDSKGFITPETVGVILRMMGVKISEKNLQEVISETDEDGSGE 62
Query  72   INVQEFAAFVKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERYAEH 131
            +  +EF  +             + EL+EAF +YD+  NG I++  L +IL  L  R  E 
Sbjct  63   LEFEEFVELAAKFLIEEDEEALKAELREAFRVYDRGGNGYITTDVLKEILRELDNRLTEE 122
Query  132  DCVEMIKSVDSDGDGYVSFEEFKKMM 157
            D   +I+ VD DG G + F EF +MM
Sbjct  123  DLDSIIEEVDEDGSGTLDFNEFMQMM 148

Sequence Alignment: 16. Allergen Name: Ole e 3 Sequence ID: O81092

 Score = 58.3 bits 250,  Expect = 7e-11
 Identities = 42/67 62%, Positives = 47/67 70%, Gaps = 1/67 1%
Query  16   QEPNEVQGVFNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFINVQ 75
            QE  E + +F RFDANGDGKIS  EL   LK LGS T  EEI RMM EIDTD DGFI+ +
Sbjct  6    QEVAEHERIFKRFDANGDGKISSSELGETLKTLGSVTP-EEIQRMMAEIDTDGDGFISFE 64
Query  76   EFAAFVKA 83
            EF  F +A
Sbjct  65   EFTVFARA 72

Sequence Alignment: 17. Allergen Name: Syr v 3 Sequence ID: P58171

 Score = 58.1 bits 249,  Expect = 7e-11
 Identities = 41/69 59%, Positives = 49/69 71%, Gaps = 1/69 1%
Query  16   QEPNEVQGVFNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFINVQ 75
            +E  E++ +F RFDANGDGKIS  EL   LK LGS T  EEI RMM EIDTD DGFI+ +
Sbjct  3    EEVAELERIFKRFDANGDGKISSSELGETLKTLGSVTP-EEIQRMMAEIDTDGDGFISFE 61
Query  76   EFAAFVKAET 85
            EF  F +A +
Sbjct  62   EFKDFARANS 71

Sequence Alignment: 18. Allergen Name: Bet v 4 Sequence ID: CAA73147

 Score = 56.9 bits 243,  Expect = 2e-10
 Identities = 40/67 59%, Positives = 47/67 70%, Gaps = 1/67 1%
Query  16   QEPNEVQGVFNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFINVQ 75
            Q+  E + +F RFDANGDGKIS  EL  ALK LGS T  +E+  MM EIDTD DGFI+ Q
Sbjct  7    QDKAERERIFKRFDANGDGKISAAELGEALKTLGSITP-DEVKHMMAEIDTDGDGFISFQ 65
Query  76   EFAAFVKA 83
            EF  F +A
Sbjct  66   EFTDFARA 73

Sequence Alignment: 19. Allergen Name: Sal k 7.0101 Sequence ID: ALE34025

 Score = 56.9 bits 243,  Expect = 2e-10
 Identities = 40/67 59%, Positives = 48/67 71%, Gaps = 1/67 1%
Query  16   QEPNEVQGVFNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFINVQ 75
            Q+  + + +F RFD NGDGKIS  EL  ALK LGS TS +EI RMM EIDTD DGFI+ +
Sbjct  8    QDLADRERIFKRFDTNGDGKISSSELGDALKTLGSVTS-DEIVRMMAEIDTDGDGFISFE 66
Query  76   EFAAFVKA 83
            EF  F +A
Sbjct  67   EFTEFARA 74

Sequence Alignment: 20. Allergen Name: Bet v 4 Sequence ID: Q39419

 Score = 56.1 bits 239,  Expect = 3e-10
 Identities = 40/67 59%, Positives = 47/67 70%, Gaps = 1/67 1%
Query  16   QEPNEVQGVFNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFINVQ 75
            Q+  E + +F RFDANGDGKIS  EL  ALK LGS T  +E+  MM EIDTD DGFI+ Q
Sbjct  7    QDKAERERIFKRFDANGDGKISAAELGEALKTLGSITP-DEVKHMMAEIDTDGDGFISFQ 65
Query  76   EFAAFVKA 83
            EF  F +A
Sbjct  66   EFTDFGRA 73

Sequence Alignment: 21. Allergen Name: Phl p 7 Sequence ID: O82040

 Score = 55.2 bits 234,  Expect = 5e-10
 Identities = 37/64 57%, Positives = 47/64 73%, Gaps = 1/64 1%
Query  19   NEVQGVFNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFINVQEFA 78
            ++++ +F RFD NGDGKIS  EL  AL+ LGS TS +E+ RMM EIDTD DGFI+  EF 
Sbjct  3    DDMERIFKRFDTNGDGKISLSELTDALRTLGS-TSADEVQRMMAEIDTDGDGFIDFNEFI 61
Query  79   AFVKA 83
            +F  A
Sbjct  62   SFCNA 66

Sequence Alignment: 22. Allergen Name: Cyn d 7 Sequence ID: P94092

 Score = 55.2 bits 234,  Expect = 5e-10
 Identities = 37/68 54%, Positives = 48/68 70%, Gaps = 1/68 1%
Query  15   LQEPNEVQGVFNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFINV 74
            + +  +++ +F RFD NGDGKIS  EL  AL+ LGS TS +E+ RMM EIDTD DGFI+ 
Sbjct  1    MADTGDMEHIFKRFDTNGDGKISLAELTDALRTLGS-TSADEVQRMMAEIDTDGDGFIDF 59
Query  75   QEFAAFVKA 83
             EF +F  A
Sbjct  60   DEFISFCNA 68

Sequence Alignment: 23. Allergen Name: Cyn d 7 Sequence ID: CAA62634

 Score = 55.2 bits 234,  Expect = 6e-10
 Identities = 37/68 54%, Positives = 48/68 70%, Gaps = 1/68 1%
Query  15   LQEPNEVQGVFNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFINV 74
            + +  +++ +F RFD NGDGKIS  EL  AL+ LGS TS +E+ RMM EIDTD DGFI+ 
Sbjct  3    MADTGDMEHIFKRFDTNGDGKISLAELTDALRTLGS-TSADEVQRMMAEIDTDGDGFIDF 61
Query  75   QEFAAFVKA 83
             EF +F  A
Sbjct  62   DEFISFCNA 70

Sequence Alignment: 24. Allergen Name: Par j 4.0101 Sequence ID: CAP05019

 Score = 55.0 bits 233,  Expect = 7e-10
 Identities = 38/63 60%, Positives = 49/63 77%, Gaps = 1/63 1%
Query  20   EVQGVFNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFINVQEFAA 79
            E + +F RFD+NGDGKIS  EL  ALKALGS T+ +E+ RMM EIDTD DG I+++EF++
Sbjct  10   EQERIFKRFDSNGDGKISSSELGEALKALGSVTA-DEVHRMMAEIDTDGDGAISLEEFSS 68
Query  80   FVKA 83
            F  A
Sbjct  69   FADA 72

Sequence Alignment: 25. Allergen Name: Aln g 4 Sequence ID: O81701

 Score = 55.0 bits 233,  Expect = 7e-10
 Identities = 39/67 58%, Positives = 46/67 68%, Gaps = 1/67 1%
Query  16   QEPNEVQGVFNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFINVQ 75
            Q+  E + +F  FDANGDGKIS  EL  ALK LGS T  +E+  MM EIDTD DGFI+ Q
Sbjct  7    QDQAEHERIFKCFDANGDGKISASELGDALKTLGSVTP-DEVKHMMAEIDTDGDGFISFQ 65
Query  76   EFAAFVKA 83
            EF  F +A
Sbjct  66   EFTNFARA 73

Sequence Alignment: 26. Allergen Name: Bra n 2 Sequence ID: BAA09633

 Score = 54.8 bits 232,  Expect = 7e-10
 Identities = 38/66 57%, Positives = 46/66 69%, Gaps = 1/66 1%
Query  17   EPNEVQGVFNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFINVQE 76
            E  E   +F +FDANGDGKIS  EL  ALK LGS  + ++I RMM EIDTD DG+I+ QE
Sbjct  5    EKAEHDRIFKKFDANGDGKISASELGDALKNLGS-VTHDDIKRMMAEIDTDGDGYISYQE 63
Query  77   FAAFVKA 83
            F+ F  A
Sbjct  64   FSDFASA 70

Sequence Alignment: 27. Allergen Name: Bra n 2 Sequence ID: Q39406

 Score = 54.8 bits 232,  Expect = 7e-10
 Identities = 38/66 57%, Positives = 46/66 69%, Gaps = 1/66 1%
Query  17   EPNEVQGVFNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFINVQE 76
            E  E   +F +FDANGDGKIS  EL  ALK LGS  + ++I RMM EIDTD DG+I+ QE
Sbjct  6    EKAEHDRIFKKFDANGDGKISASELGDALKNLGS-VTHDDIKRMMAEIDTDGDGYISYQE 64
Query  77   FAAFVKA 83
            F+ F  A
Sbjct  65   FSDFASA 71

Sequence Alignment: 28. Allergen Name: Che a 3 Sequence ID: AAL92871

 Score = 54.8 bits 232,  Expect = 8e-10
 Identities = 38/67 56%, Positives = 46/67 68%, Gaps = 1/67 1%
Query  16   QEPNEVQGVFNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFINVQ 75
            Q+  + + +F RFD NGDGKIS  EL  ALK LGS T  +E+ RMM EIDTD DGFI+  
Sbjct  8    QDIADRERIFKRFDTNGDGKISSSELGDALKTLGSVTP-DEVRRMMAEIDTDGDGFISFD 66
Query  76   EFAAFVKA 83
            EF  F +A
Sbjct  67   EFTDFARA 74

Sequence Alignment: 29. Allergen Name: Art v 5.0101 Sequence ID: AY904434

 Score = 50.1 bits 208,  Expect = 2e-08
 Identities = 34/67 50%, Positives = 43/67 64%, Gaps = 1/67 1%
Query  16   QEPNEVQGVFNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFINVQ 75
            ++  E   +F  FD NGDGKIS  EL  +L  LGS  S EE+  MM+E+DTD DG+I+  
Sbjct  4    EDKAECDRIFGAFDKNGDGKISAAELGESLTKLGS-VSPEEVQTMMDELDTDGDGYISYD 62
Query  76   EFAAFVKA 83
            EFA F  A
Sbjct  63   EFAEFFNA 70

Sequence Alignment: 30. Allergen Name: Bra r 5.0101 Sequence ID: P69197

 Score = 49.3 bits 204,  Expect = 3e-08
 Identities = 33/63 52%, Positives = 43/63 68%, Gaps = 1/63 1%
Query  20   EVQGVFNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFINVQEFAA 79
            E + +F +FD +GDGKIS  EL  ALK LGS  + +++ RMM +IDTD DG I+ QEF  
Sbjct  5    EHERIFKKFDTDGDGKISAAELEEALKKLGS-VTPDDVTRMMAKIDTDGDGNISFQEFTE 63
Query  80   FVKA 83
            F  A
Sbjct  64   FASA 67

Sequence Alignment: 31. Allergen Name: Pro c 5.0101 Sequence ID: J7HCX7

 Score = 46.6 bits 190,  Expect = 4e-07
 Identities = 40/135 29%, Positives = 72/135 53%, Gaps = 6/135 4%
Query  21   VQGVFNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFINVQEFAA- 79
            V+  F+ +D  G+G +    +   L+AL  N +   I ++  + +  K+  I ++EF   
Sbjct  13   VKFAFSIYDFEGNGTMDAFYIGDCLRALNLNPTLAIIEKVGGK-EKRKEKIIKLEEFIPI 71
Query  80   FVKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERYAEHDCVEMIKS 139
            F + + D    +G   ++ E ++LYD+  NG +   EL  IL  LGER  + +   ++K 
Sbjct  72   FAQVKKDK--DAGSYEDFMEVLKLYDKSENGTMMYAELEHILLSLGERLEKSELEPVLKE 129
Query  140  V--DSDGDGYVSFEEFKKMMT 158
               + D DG++ +E F K MT
Sbjct  130  CCNEEDEDGFIPYEPFLKKMT 150

Sequence Alignment: 32. Allergen Name: Der f 26.0101 Sequence ID: AIO08852

 Score = 43.4 bits 174,  Expect = 4e-06
 Identities = 36/136 26%, Positives = 70/136 51%, Gaps = 7/136 5%
Query  18   PNEVQGV---FNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFINV 74
            P EV+     F+ +D +G  K+    L   L++L    +++ +A+   E    +  F+  
Sbjct  6    PPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSVAKNGWEKKKGQK-FMTF 64
Query  75   QEFAAFVKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERYAEHDCV 134
            +EF   + ++       G   +L E +++YD+  NG +   EL  +L  LGE+  + +  
Sbjct  65   EEFLP-IYSQVKKDKDCGAFEDLVEGLKVYDKAENGTMMEAELAHVLLSLGEKLTDAEVE 123
Query  135  EMIKSVDS--DGDGYVSFEEFKK 155
            E+IK+     D +G++ +E F K
Sbjct  124  EIIKTCGGGCDDEGFMKYETFIK 146

Sequence Alignment: 33. Allergen Name: Scy p 3.0101 Sequence ID: A0A514C9K9

 Score = 42.9 bits 171,  Expect = 5e-06
 Identities = 37/131 28%, Positives = 67/131 51%, Gaps = 6/131 4%
Query  25   FNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFINVQEF-AAFVKA 83
            F+ +D  G G +    +   L+AL  N +   I ++  +    K+  + V +F   F + 
Sbjct  17   FSIYDFEGKGTMDAFYVGDCLRALNLNPTLAVIEKVGGKTKK-KEKMLKVDDFLPIFAQV 75
Query  84   ETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERYAEHDCVEMIKSV--D 141
            + D    +G   ++ E ++LYD+  NG +   EL  IL  LGER  + +   ++K    +
Sbjct  76   KKD--KDAGSFEDFMEVLKLYDKTENGTMLYAELEHILLSLGERLEKSELEPVLKDCCDE 133
Query  142  SDGDGYVSFEEFKKMMT 158
             D DG++ +E F K +T
Sbjct  134  EDEDGFIPYEPFLKKLT 150

Sequence Alignment: 34. Allergen Name: Clu h 1.0301 Sequence ID: CAQ72972

 Score = 35.9 bits 135,  Expect = 0.0005
 Identities = 24/65 36%, Positives = 40/65 61%, Gaps = 3/65 4%
Query  95   NELKEAFELYDQDHNGLISSVELHKILTRL--GER-YAEHDCVEMIKSVDSDGDGYVSFE 151
            +ELK+AFE+ DQD +G+I   EL   L  +  G R   + +  + +K+ DSD DG +  +
Sbjct  42   DELKKAFEIIDQDKSGFIEEEELKLFLQNFCKGARALTDGETKKFLKAGDSDNDGKIGID 101
Query  152  EFKKMMTN 159
            EF  ++ +
Sbjct  102  EFAALINH 109

Sequence Alignment: 35. Allergen Name: Clu h 1.0101 Sequence ID: CAQ72970

 Score = 35.7 bits 134,  Expect = 0.0005
 Identities = 24/62 38%, Positives = 38/62 61%, Gaps = 3/62 4%
Query  96   ELKEAFELYDQDHNGLISSVELHKILT--RLGER-YAEHDCVEMIKSVDSDGDGYVSFEE 152
            +LK+AFE+ DQD +G+I   EL   L   + G R   + +    +K+ D+DGDG +  +E
Sbjct  43   DLKKAFEIIDQDKSGFIEEEELKLFLQNFKAGARALTDAETKAFLKAGDADGDGMIGVDE 102
Query  153  FKKMM 157
            F  M+
Sbjct  103  FAVMI 107

Sequence Alignment: 36. Allergen Name: Der p 26.0101 Sequence ID: QAT18638

 Score = 35.5 bits 133,  Expect = 0.0007
 Identities = 29/109 26%, Positives = 54/109 49%, Gaps = 5/109 4%
Query  18   PNEVQGV---FNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFINV 74
            P EV+     F+ +D  G GK+    L   L++L    ++E +A+   E    +  ++  
Sbjct  6    PPEVEKARLHFDIYDFEGQGKVDYHLLGDLLRSLDLRPTQEMVAKNGWEKKKGQK-YMTF 64
Query  75   QEFAAFVKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERY 128
            +EF   + ++       G   +L E +++YD+  NG +   EL  +L  LGE +
Sbjct  65   EEFLP-IYSQVKKDKDCGAYEDLVEGLKVYDKAENGTMMEAELAHVLLSLGENW 117

Sequence Alignment: 37. Allergen Name: Bet v 3 Sequence ID: P43187

 Score = 35.3 bits 132,  Expect = 0.001
 Identities = 55/134 41%, Positives = 85/134 63%, Gaps = 20/134 14%
Query  24   VFNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFINVQEFAAFVKA 83
            +F+ FD N DG I+ DEL+ AL  LG  T   E+   ++    + +  +  ++F ++ ++
Sbjct  44   IFDLFDKNSDGIITVDELSRALNLLGLETDLSELESTVKSFTREGNIGLQFEDFISLHQS 103
Query  84   ETDPYPSSGGENE-------------LKEA-----FELYDQDHNGLISSVELHKILTRLG 125
              D Y + GGE+E              +EA     F+++D+D +G IS+ EL+ +L +LG
Sbjct  104  LNDSYFAYGGEDEDDNEEDMRKSILSQEEADSFGGFKVFDEDGDGYISARELQMVLGKLG 163
Query  126  -ERYAEHDCVE-MIKSVDSDGDGYVSFEEFKKMM 157
                +E D VE MI SVDS+ DG V F EFK MM
Sbjct  164  FSEGSEIDRVEKMIVSVDSNRDGRVDFFEFKDMM 197

Sequence Alignment: 38. Allergen Name: Cyp c 1.01 Sequence ID: CAC83658

 Score = 33.2 bits 121,  Expect = 0.003
 Identities = 23/68 33%, Positives = 40/68 58%, Gaps = 3/68 4%
Query  90   SSGGENELKEAFELYDQDHNGLISSVELHKILTRL--GER-YAEHDCVEMIKSVDSDGDG 146
            S+   +++K+AF + DQD +G+I   EL   L  +  G R   + +    +K+ DSDGDG
Sbjct  37   SAKTPDDIKKAFAVIDQDKSGFIEEDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDG 96
Query  147  YVSFEEFKKMM 157
             +  +EF  ++
Sbjct  97   KIGVDEFAALV 107

Sequence Alignment: 39. Allergen Name: Cro p 1.0101 Sequence ID: XP_019397705

 Score = 33.0 bits 120,  Expect = 0.004
 Identities = 26/65 40%, Positives = 36/65 55%, Gaps = 3/65 4%
Query  19   NEVQGVFNRFDANGDGKISGDELACALKALGSNT---SKEEIARMMEEIDTDKDGFINVQ 75
            ++V+ VF  +D +  G I  DEL   LK + S+    +  E    +   DTD DG I V 
Sbjct  42   DQVKKVFGILDQDKSGFIEEDELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVD 101
Query  76   EFAAFVKA 83
            EF A+VKA
Sbjct  102  EFQALVKA 109

Sequence Alignment: 40. Allergen Name: Sar sa 1.0101 Sequence ID: FM177701

 Score = 32.8 bits 119,  Expect = 0.004
 Identities = 21/68 30%, Positives = 39/68 57%, Gaps = 3/68 4%
Query  90   SSGGENELKEAFELYDQDHNGLISSVELHKILTRLGER---YAEHDCVEMIKSVDSDGDG 146
            S    +ELK+AF + DQD +G+I   EL   L  + ++     + +  + +K+ D+ GDG
Sbjct  37   SGKSADELKKAFAIIDQDKSGFIEEEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDG 96
Query  147  YVSFEEFKKMM 157
             +  +EF  ++
Sbjct  97   KIGIDEFNHLV 107

Sequence Alignment: 41. Allergen Name: Thu a 1.0101 Sequence ID: CAQ72967

 Score = 32.8 bits 119,  Expect = 0.004
 Identities = 27/77 35%, Positives = 41/77 53%, Gaps = 5/77 6%
Query  6    DRNSKPSVYLQEPNEVQGVFNRFDANGDGKISGDELACALKALGSN----TSKEEIARMM 61
            D  +K  +  + P +++  F   D +  G I  DEL   L+ + +     T  E  A +M
Sbjct  29   DFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIEEDELKLFLQNFSAGARALTDAETKAFLM 88
Query  62   EEIDTDKDGFINVQEFAAFVKA 83
               D+D DG I + EFAA+VKA
Sbjct  89   AG-DSDGDGKIGIDEFAALVKA 109

Sequence Alignment: 42. Allergen Name: Cro p 2.0101 Sequence ID: XP_019400389

 Score = 32.4 bits 117,  Expect = 0.005
 Identities = 18/64 28%, Positives = 38/64 59%, Gaps = 3/64 4%
Query  94   ENELKEAFELYDQDHNGLISSVELHKIL---TRLGERYAEHDCVEMIKSVDSDGDGYVSF 150
            ++++K+ F + D+D +G+I   EL  +L   T      ++ +  E++ + D DGDG +  
Sbjct  41   QDDVKKVFHILDKDRSGFIEEDELKSVLKGFTPDARDLSDKETKELLAAGDKDGDGKIGV 100
Query  151  EEFKKMM 157
            +EF  ++
Sbjct  101  DEFTSLV 107

Sequence Alignment: 43. Allergen Name: Per a 8.0101 Sequence ID: H6WP59

 Score = 33.3 bits 122,  Expect = 0.005
 Identities = 22/69 31%, Positives = 41/69 59%, Gaps = 5/69 7%
Query  96   ELKEAFELYDQDHNGLISSVELHKILTRLGERYAEHDCVEMIKSVDSDGDGYVSFEEFKK 155
            E+KEAF+L DQD +G+IS  +L   + +LG    + +  EM+    ++  G ++F ++  
Sbjct  64   EFKEAFQLMDQDKDGIISKNDLRATFDQLGRLAVDKELDEMV----NEAPGPINFTQLLT 119
Query  156  MMTNK-SGNNSQAE 168
            +   + SG +   E
Sbjct  120  LFAGRMSGGSDDDE 133

Sequence Alignment: 44. Allergen Name: Art fr 5.0101 Sequence ID: A7L499

 Score = 32.2 bits 116,  Expect = 0.008
 Identities = 33/109 30%, Positives = 56/109 51%, Gaps = 11/109 10%
Query  43   CALKALGSNTSKEEIARMMEEIDTDKDGFINVQEFAAF---VKAETDPYPSSGGENELKE 99
            C L+AL  N +  +I ++      ++   + V+EF      VK E D     G   ++ E
Sbjct  22   C-LRALNLNPTLAQIEKLGGTKKKNEKK-LKVEEFLPIFSQVKKEKD----HGTLEDFIE 75
Query  100  AFELYDQDHNGLISSVELHKILTRLGERYAEHDCVEMIKS-VDSDGD-GYVSFEEFKKMM 157
              +LYD+  NG +   EL+ IL  LGE+  +     + K  +D + D G + +  F K +
Sbjct  76   CMKLYDKSENGTMMLAELNHILLALGEKLEDSQVDSIFKECMDPEDDEGNIPYTPFLKRL 135

Sequence Alignment: 45. Allergen Name: Pan h 1.0101 Sequence ID: XP_026772003

 Score = 31.6 bits 113,  Expect = 0.009
 Identities = 19/63 30%, Positives = 37/63 58%, Gaps = 3/63 4%
Query  95   NELKEAFELYDQDHNGLISSVELHKILTRL---GERYAEHDCVEMIKSVDSDGDGYVSFE 151
            +++K+AF + DQD +G+I   EL   L  +        +++    +K+ D+DGDG +  +
Sbjct  42   DDVKKAFSIIDQDKSGFIEEDELKLFLQNFKSDARALTDNETKIFLKAGDTDGDGKIGVD 101
Query  152  EFKKMM 157
            EF  ++
Sbjct  102  EFASLV 107

Sequence Alignment: 46. Allergen Name: Pan h 1.0201 Sequence ID: XP_026803769

 Score = 31.6 bits 113,  Expect = 0.009
 Identities = 22/61 36%, Positives = 32/61 52%, Gaps = 3/61 4%
Query  21   VQGVFNRFDANGDGKISGDELACALKAL---GSNTSKEEIARMMEEIDTDKDGFINVQEF 77
            V+ VF+ +D +  G I  DEL   LK +   G + + +E    +   D D DG I + EF
Sbjct  44   VKKVFSVLDVDASGFIEEDELKFVLKGFSKDGRDLTDKETKAFLTAADRDGDGKIGIDEF 103
Query  78   AAFV 81
             A V
Sbjct  104  EAIV 107

Sequence Alignment: 47. Allergen Name: Bla g 8.0101 Sequence ID: ABD47458

 Score = 32.4 bits 117,  Expect = 0.01
 Identities = 34/136 25%, Positives = 70/136 51%, Gaps = 15/136 11%
Query  12   SVYLQEP-NEVQGVFNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDG 70
            S++ Q+   E +  F   DA+ DG IS ++L   +  LG     +E+  M+ E      G
Sbjct  42   SMFSQKQVAEFKEAFQLMDADKDGIISKNDLRATFDQLGRLAVDKELDEMVNEAP----G 97
Query  71   FINVQEFAAFVKAETDPYPSSGGENE---LKEAFELYDQDHNGLISSVELHKILTRLGER 127
             IN  ++  +          SGG ++   +  AF+ ++ D  G I S  L   L   G++
Sbjct  98   PINFTQLLTLFAGRM-----SGGSDDDEVVIAAFKTFEDD--GKIDSERLRHALMTWGDK 150
Query  128  YAEHDCVEMIKSVDSDGDGYVSFEEFKKMMT 158
            ++  +  +   + + D  G+++  ++ +++T
Sbjct  151  FSADEVDDAYDNFEIDDKGFINTAKLIQLLT 181

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.