The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAARSAKYMYQSSRAGHGGDISIEYGTDLGALTRLEDKIRLLSEDLESERELRQRVEREK
SDITVQLMNLTERLEETEGSSESVTEMNKKRDSELAKLRKLLEDVHMESEETAHHLRQKH
QAAIQEMQDQLDQVQKAKNKSDKEKQKFQAEVFELLAQVETANKDKLVAQKTVEKLEYTV
HELNIKIEEINRTVVEVTAHRQRLSQENSELIKEVHEYKISLDNANHLKGQIAQQLEDTR
HRLEDEERKRSSLENHAHTLEVELESLKVQLEEESEARLELERQLTKANGDAASWKSKYE
AELQAHVDEVEELRRKMAQKISEYGEQLEALLNKCSALEKQKARLQSEVEVLIMDLEKAT
AHAQALEKRVSQLEKINLDLKSKLEEVSMLLEQTQKDLRVKIADLQKLQHEYEKLRDQKE
ALARENKKLADDLAEAKSQLNDAHRRIHEQEIEIKRLENEREELAAAYKEAETLRKQEEA
KNQRLTAELAQTRHDYEKRLAQKEEEIEALRKQYQIEIEQLNMRLAEAEAKLKTEVARLK
KKYQAQITELELSLDAANKANIDLQKTIKKQALQITGLQAHYDEVHRQLQQAVDQLGVTQ
RRCQALTAELEEMRVNLEQALRAKRAAEQMHEEAVVRVNELTTINVNLASAKSKLETEFS
ALQNDYDEVHKELRISDERVQKLTIEVKSTKDLLESETERVTKLETIKKSLETEVRNLQI
RIEEVEANALAGGKRVIAKLESRIRDVEIEVEEERRRHAETEKMLRKKDHRVKELLLQNE
EDHKQIQLLQEMSDKLNEKVKVYKRQMQEQEGMSQQNLTRVRRFQRELEAAEDRADQAES
NLSFIRAKHRSWVTTSQVPGGTRQVFVTEQESSNF
Sequence Info Allergen Name Length Opt Bits Score E Value
AAM83103 Blo t 11 875 5377 1231.7 0
AAO73464 Der p 11 875 4930 1129.8 0
AAK39511 Der f 11.0101 692 3907 896.7 0
AAF72796 Ani s 2 869 2777 639.1 5.2e-184
QPB41107 Rap v 2.0101 859 1694 392.2 1.1e-109
BAA04557 Der f 10.0101 299 228 58.3 1.2e-09
AAG08987 Hal d 1 284 223 57.2 2.4e-09
CBY17558 Pan b 1.0101 284 217 55.8 6.3e-09
O18416 Der p 10 284 217 55.8 6.3e-09
AAX37288 Pen m 1 284 216 55.6 7.4e-09
11893851 Pen a 1 284 216 55.6 7.4e-09
EU410072 Lit v 1.0101 284 216 55.6 7.4e-09
ABU97466 Blo t 10.0101 284 216 55.6 7.4e-09
NP_001103782 Bomb m 3.0101 285 214 55.2 1e-08
Q25456 Met e 1 274 212 54.7 1.3e-08
Q9NFZ4 Lep d 10 284 212 54.7 1.4e-08
C0LU07 Pro c 1.0101 284 209 54.0 2.2e-08
A7L5V2 Scy p 1.0101 284 208 53.8 2.6e-08
O44119 Hom a 1.0101 284 208 53.8 2.6e-08
XP_026781482 Pan h 4.0101 284 204 52.9 4.9e-08
M4M2H6 Mel l 1.0101 284 202 52.4 6.7e-08
AEX31649 Cho a 10.0101 284 202 52.4 6.7e-08
Q9UB83 Per a 7 284 201 52.2 7.9e-08
APG42675 Hal l 1.0101 284 198 51.5 1.3e-07
AAD19606 Per a 7.0102 284 197 51.3 1.5e-07
M1H607 Por p 1.0101 284 195 50.8 2e-07
AAF72534 Bla g 7.0101 284 195 50.8 2e-07
AAC48288 Hom a 1.0102 284 194 50.6 2.4e-07
AAT40866 Tyr p 10.0101 284 193 50.4 2.8e-07
D3XNR9 Mac r 1.0101 284 192 50.1 3.3e-07
CAB38044 Hel as 1 284 189 49.5 5.2e-07
O61379 Pan s 1 274 186 48.8 8e-07
XP_026775428 Pan h 4.0201 284 186 48.8 8.4e-07
Q17H75 Aed a 10.0101 285 182 47.9 1.6e-06
AAK96889 Cra g 1 233 171 45.5 6.8e-06
Q9NAS5 Ani s 3 284 166 44.2 2e-05
AAG08989 Mim n 1 284 165 44.0 2.3e-05
ACN32322 Asc l 3.0101 287 165 44.0 2.4e-05
Q17H80 Aed a 10.0201 284 164 43.8 2.7e-05
NP_001117128 Sal s 4.0101 284 162 43.3 3.7e-05
AVD53650 Sac g 1.0101 284 159 42.6 6e-05
P02538 Hom s 5 564 163 43.3 7.5e-05
CAA09938 Chi k 10 285 157 42.2 8.3e-05
CAC84590 Lep s 1 284 153 41.3 0.00015
AGM32377.1 Copt f 7.0101 256 152 41.1 0.00016
Q9N2R3 Cha f 1 264 149 40.4 0.00026
AAG08988 Per v 1 284 146 39.7 0.00047
P05547 Pon l 7.0101 201 136 37.6 0.0014
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Blo t 11 Sequence ID: AAM83103

 Score = 1231.7 bits 5377,  Expect = 0
 Identities = 875/875 100%, Positives = 875/875 100%, Gaps = 0/875 0%
Query  1    MAARSAKYMYQSSRAGHGGDISIEYGTDLGALTRLEDKIRLLSEDLESERELRQRVEREK 60
            MAARSAKYMYQSSRAGHGGDISIEYGTDLGALTRLEDKIRLLSEDLESERELRQRVEREK
Sbjct  1    MAARSAKYMYQSSRAGHGGDISIEYGTDLGALTRLEDKIRLLSEDLESERELRQRVEREK 60
Query  61   SDITVQLMNLTERLEETEGSSESVTEMNKKRDSELAKLRKLLEDVHMESEETAHHLRQKH 120
            SDITVQLMNLTERLEETEGSSESVTEMNKKRDSELAKLRKLLEDVHMESEETAHHLRQKH
Sbjct  61   SDITVQLMNLTERLEETEGSSESVTEMNKKRDSELAKLRKLLEDVHMESEETAHHLRQKH 120
Query  121  QAAIQEMQDQLDQVQKAKNKSDKEKQKFQAEVFELLAQVETANKDKLVAQKTVEKLEYTV 180
            QAAIQEMQDQLDQVQKAKNKSDKEKQKFQAEVFELLAQVETANKDKLVAQKTVEKLEYTV
Sbjct  121  QAAIQEMQDQLDQVQKAKNKSDKEKQKFQAEVFELLAQVETANKDKLVAQKTVEKLEYTV 180
Query  181  HELNIKIEEINRTVVEVTAHRQRLSQENSELIKEVHEYKISLDNANHLKGQIAQQLEDTR 240
            HELNIKIEEINRTVVEVTAHRQRLSQENSELIKEVHEYKISLDNANHLKGQIAQQLEDTR
Sbjct  181  HELNIKIEEINRTVVEVTAHRQRLSQENSELIKEVHEYKISLDNANHLKGQIAQQLEDTR 240
Query  241  HRLEDEERKRSSLENHAHTLEVELESLKVQLEEESEARLELERQLTKANGDAASWKSKYE 300
            HRLEDEERKRSSLENHAHTLEVELESLKVQLEEESEARLELERQLTKANGDAASWKSKYE
Sbjct  241  HRLEDEERKRSSLENHAHTLEVELESLKVQLEEESEARLELERQLTKANGDAASWKSKYE 300
Query  301  AELQAHVDEVEELRRKMAQKISEYGEQLEALLNKCSALEKQKARLQSEVEVLIMDLEKAT 360
            AELQAHVDEVEELRRKMAQKISEYGEQLEALLNKCSALEKQKARLQSEVEVLIMDLEKAT
Sbjct  301  AELQAHVDEVEELRRKMAQKISEYGEQLEALLNKCSALEKQKARLQSEVEVLIMDLEKAT 360
Query  361  AHAQALEKRVSQLEKINLDLKSKLEEVSMLLEQTQKDLRVKIADLQKLQHEYEKLRDQKE 420
            AHAQALEKRVSQLEKINLDLKSKLEEVSMLLEQTQKDLRVKIADLQKLQHEYEKLRDQKE
Sbjct  361  AHAQALEKRVSQLEKINLDLKSKLEEVSMLLEQTQKDLRVKIADLQKLQHEYEKLRDQKE 420
Query  421  ALARENKKLADDLAEAKSQLNDAHRRIHEQEIEIKRLENEREELAAAYKEAETLRKQEEA 480
            ALARENKKLADDLAEAKSQLNDAHRRIHEQEIEIKRLENEREELAAAYKEAETLRKQEEA
Sbjct  421  ALARENKKLADDLAEAKSQLNDAHRRIHEQEIEIKRLENEREELAAAYKEAETLRKQEEA 480
Query  481  KNQRLTAELAQTRHDYEKRLAQKEEEIEALRKQYQIEIEQLNMRLAEAEAKLKTEVARLK 540
            KNQRLTAELAQTRHDYEKRLAQKEEEIEALRKQYQIEIEQLNMRLAEAEAKLKTEVARLK
Sbjct  481  KNQRLTAELAQTRHDYEKRLAQKEEEIEALRKQYQIEIEQLNMRLAEAEAKLKTEVARLK 540
Query  541  KKYQAQITELELSLDAANKANIDLQKTIKKQALQITGLQAHYDEVHRQLQQAVDQLGVTQ 600
            KKYQAQITELELSLDAANKANIDLQKTIKKQALQITGLQAHYDEVHRQLQQAVDQLGVTQ
Sbjct  541  KKYQAQITELELSLDAANKANIDLQKTIKKQALQITGLQAHYDEVHRQLQQAVDQLGVTQ 600
Query  601  RRCQALTAELEEMRVNLEQALRAKRAAEQMHEEAVVRVNELTTINVNLASAKSKLETEFS 660
            RRCQALTAELEEMRVNLEQALRAKRAAEQMHEEAVVRVNELTTINVNLASAKSKLETEFS
Sbjct  601  RRCQALTAELEEMRVNLEQALRAKRAAEQMHEEAVVRVNELTTINVNLASAKSKLETEFS 660
Query  661  ALQNDYDEVHKELRISDERVQKLTIEVKSTKDLLESETERVTKLETIKKSLETEVRNLQI 720
            ALQNDYDEVHKELRISDERVQKLTIEVKSTKDLLESETERVTKLETIKKSLETEVRNLQI
Sbjct  661  ALQNDYDEVHKELRISDERVQKLTIEVKSTKDLLESETERVTKLETIKKSLETEVRNLQI 720
Query  721  RIEEVEANALAGGKRVIAKLESRIRDVEIEVEEERRRHAETEKMLRKKDHRVKELLLQNE 780
            RIEEVEANALAGGKRVIAKLESRIRDVEIEVEEERRRHAETEKMLRKKDHRVKELLLQNE
Sbjct  721  RIEEVEANALAGGKRVIAKLESRIRDVEIEVEEERRRHAETEKMLRKKDHRVKELLLQNE 780
Query  781  EDHKQIQLLQEMSDKLNEKVKVYKRQMQEQEGMSQQNLTRVRRFQRELEAAEDRADQAES 840
            EDHKQIQLLQEMSDKLNEKVKVYKRQMQEQEGMSQQNLTRVRRFQRELEAAEDRADQAES
Sbjct  781  EDHKQIQLLQEMSDKLNEKVKVYKRQMQEQEGMSQQNLTRVRRFQRELEAAEDRADQAES 840
Query  841  NLSFIRAKHRSWVTTSQVPGGTRQVFVTEQESSNF 875
            NLSFIRAKHRSWVTTSQVPGGTRQVFVTEQESSNF
Sbjct  841  NLSFIRAKHRSWVTTSQVPGGTRQVFVTEQESSNF 875

Sequence Alignment: 2. Allergen Name: Der p 11 Sequence ID: AAO73464

 Score = 1129.8 bits 4930,  Expect = 0
 Identities = 781/875 89%, Positives = 841/875 96%, Gaps = 0/875 0%
Query  1    MAARSAKYMYQSSRAGHGGDISIEYGTDLGALTRLEDKIRLLSEDLESERELRQRVEREK 60
            M+AR+AKYMY+SS AG  GDIS+EYGTDLGALTRLEDKIRLLS+DLESERE+RQR+EREK
Sbjct  1    MSARTAKYMYRSSGAGASGDISVEYGTDLGALTRLEDKIRLLSDDLESEREMRQRIEREK 60
Query  61   SDITVQLMNLTERLEETEGSSESVTEMNKKRDSELAKLRKLLEDVHMESEETAHHLRQKH 120
            +++ +Q+M+L+ERLEE EGSSESVTEMNKKRDSELAKLRKLLEDVHMESEETAHHLRQKH
Sbjct  61   AELQIQVMSLSERLEEAEGSSESVTEMNKKRDSELAKLRKLLEDVHMESEETAHHLRQKH 120
Query  121  QAAIQEMQDQLDQVQKAKNKSDKEKQKFQAEVFELLAQVETANKDKLVAQKTVEKLEYTV 180
            QAA++EMQDQLDQ+QKAKNKSDKEKQKFQAEVFELL+Q+ETANK+KL A K+VEKLEYTV
Sbjct  121  QAAVHEMQDQLDQLQKAKNKSDKEKQKFQAEVFELLSQLETANKEKLTALKSVEKLEYTV 180
Query  181  HELNIKIEEINRTVVEVTAHRQRLSQENSELIKEVHEYKISLDNANHLKGQIAQQLEDTR 240
            HELNIKIEEINRTV+E+T+H+QRL+QEN+ELIKEVHE K+ LDNANHLK QIAQQLEDTR
Sbjct  181  HELNIKIEEINRTVIELTSHKQRLTQENTELIKEVHEVKLQLDNANHLKQQIAQQLEDTR 240
Query  241  HRLEDEERKRSSLENHAHTLEVELESLKVQLEEESEARLELERQLTKANGDAASWKSKYE 300
            HRLE+EERKRSSLENHAHTLEVELESLKVQL++ESEARLELERQLTKANGDAASWKSKYE
Sbjct  241  HRLEEEERKRSSLENHAHTLEVELESLKVQLDDESEARLELERQLTKANGDAASWKSKYE 300
Query  301  AELQAHVDEVEELRRKMAQKISEYGEQLEALLNKCSALEKQKARLQSEVEVLIMDLEKAT 360
            AELQAH DEVEELRRKMAQKISEY EQLEALLNKCS+LEKQK+RLQSEVEVLIMDLEKA 
Sbjct  301  AELQAHADEVEELRRKMAQKISEYEEQLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKAA 360
Query  361  AHAQALEKRVSQLEKINLDLKSKLEEVSMLLEQTQKDLRVKIADLQKLQHEYEKLRDQKE 420
            AHAQ LEKRV+QLEKINLDLK KLEEV+ML+EQ QK+LR+KI +LQKLQHEYEK+RDQ++
Sbjct  361  AHAQQLEKRVAQLEKINLDLKDKLEEVTMLMEQAQKELRIKIGELQKLQHEYEKVRDQRD 420
Query  421  ALARENKKLADDLAEAKSQLNDAHRRIHEQEIEIKRLENEREELAAAYKEAETLRKQEEA 480
             LARENKKL DDLAEAKSQLNDAHRRIHEQEIEIKRLENER+EL+AAYKEAETLRKQEEA
Sbjct  421  QLARENKKLTDDLAEAKSQLNDAHRRIHEQEIEIKRLENERDELSAAYKEAETLRKQEEA 480
Query  481  KNQRLTAELAQTRHDYEKRLAQKEEEIEALRKQYQIEIEQLNMRLAEAEAKLKTEVARLK 540
            KNQRL AELAQ RHDYEKRLAQK+EEIEALRKQYQIEIEQLNMRLAEAEAKLKTE+ARLK
Sbjct  481  KNQRLIAELAQVRHDYEKRLAQKDEEIEALRKQYQIEIEQLNMRLAEAEAKLKTEIARLK 540
Query  541  KKYQAQITELELSLDAANKANIDLQKTIKKQALQITGLQAHYDEVHRQLQQAVDQLGVTQ 600
            KKYQAQITELELSLDAANKANIDLQKTIKKQALQIT LQAHYDEVHRQLQQAVDQLGVTQ
Sbjct  541  KKYQAQITELELSLDAANKANIDLQKTIKKQALQITELQAHYDEVHRQLQQAVDQLGVTQ 600
Query  601  RRCQALTAELEEMRVNLEQALRAKRAAEQMHEEAVVRVNELTTINVNLASAKSKLETEFS 660
            RRCQAL AELEEMR+ LEQA RAKR AEQ+HEEAVVRVNELTTINVNLASAKSKLE+EFS
Sbjct  601  RRCQALQAELEEMRIALEQASRAKRQAEQLHEEAVVRVNELTTINVNLASAKSKLESEFS 660
Query  661  ALQNDYDEVHKELRISDERVQKLTIEVKSTKDLLESETERVTKLETIKKSLETEVRNLQI 720
            ALQ DYDEVHKELRISDERVQKLTIE+KSTKDLL  E ER+ KLET+KKSLE EVR L++
Sbjct  661  ALQADYDEVHKELRISDERVQKLTIELKSTKDLLIEEQERLVKLETVKKSLEQEVRTLHV 720
Query  721  RIEEVEANALAGGKRVIAKLESRIRDVEIEVEEERRRHAETEKMLRKKDHRVKELLLQNE 780
            RIEEVEANALAGGKRVIAKLESRIRDVEIEVEEERRRHAETEKMLRKKDHRVKELLLQNE
Sbjct  721  RIEEVEANALAGGKRVIAKLESRIRDVEIEVEEERRRHAETEKMLRKKDHRVKELLLQNE 780
Query  781  EDHKQIQLLQEMSDKLNEKVKVYKRQMQEQEGMSQQNLTRVRRFQRELEAAEDRADQAES 840
            EDHKQIQLLQEM+DKLNEKVKVYKRQMQEQEGMSQQNLTRVRRFQRELEAAEDRADQAES
Sbjct  781  EDHKQIQLLQEMTDKLNEKVKVYKRQMQEQEGMSQQNLTRVRRFQRELEAAEDRADQAES 840
Query  841  NLSFIRAKHRSWVTTSQVPGGTRQVFVTEQESSNF 875
            NLSFIRAKHRSWVTTSQVPGGTRQVF T++E++N+
Sbjct  841  NLSFIRAKHRSWVTTSQVPGGTRQVFTTQEETTNY 875

Sequence Alignment: 3. Allergen Name: Der f 11.0101 Sequence ID: AAK39511

 Score = 896.7 bits 3907,  Expect = 0
 Identities = 629/692 90%, Positives = 665/692 96%, Gaps = 0/692 0%
Query  87   MNKKRDSELAKLRKLLEDVHMESEETAHHLRQKHQAAIQEMQDQLDQVQKAKNKSDKEKQ 146
            MNKKRDSELAKLRKLLEDVH+ESEETAHHLRQKHQAAIQEMQDQLDQ+QKAKNKSDKEKQ
Sbjct  1    MNKKRDSELAKLRKLLEDVHIESEETAHHLRQKHQAAIQEMQDQLDQLQKAKNKSDKEKQ 60
Query  147  KFQAEVFELLAQVETANKDKLVAQKTVEKLEYTVHELNIKIEEINRTVVEVTAHRQRLSQ 206
            KFQAEVFELLAQ+ETANK+KL A K VEKLEYTVHELNIKIEEINRTV+E+T+H+QRLSQ
Sbjct  61   KFQAEVFELLAQLETANKEKLTALKNVEKLEYTVHELNIKIEEINRTVIELTSHKQRLSQ 120
Query  207  ENSELIKEVHEYKISLDNANHLKGQIAQQLEDTRHRLEDEERKRSSLENHAHTLEVELES 266
            EN+ELIKEVHE K+ LDNANHLK QIAQQLEDTRHRLE+EERKR+SLENHAHTLEVELES
Sbjct  121  ENTELIKEVHEVKLQLDNANHLKTQIAQQLEDTRHRLEEEERKRASLENHAHTLEVELES 180
Query  267  LKVQLEEESEARLELERQLTKANGDAASWKSKYEAELQAHVDEVEELRRKMAQKISEYGE 326
            LKVQL+EESEARLELERQLTKANGDAASWKSKYEAELQAH DEVEELRRKMAQKISEY E
Sbjct  181  LKVQLDEESEARLELERQLTKANGDAASWKSKYEAELQAHADEVEELRRKMAQKISEYEE 240
Query  327  QLEALLNKCSALEKQKARLQSEVEVLIMDLEKATAHAQALEKRVSQLEKINLDLKSKLEE 386
            QLEALLNKCS+LEKQK+RLQSEVEVLIMDLEKAT HAQ LEKRV+QLEKINLDLK+KLEE
Sbjct  241  QLEALLNKCSSLEKQKSRLQSEVEVLIMDLEKATRHAQQLEKRVAQLEKINLDLKNKLEE 300
Query  387  VSMLLEQTQKDLRVKIADLQKLQHEYEKLRDQKEALARENKKLADDLAEAKSQLNDAHRR 446
            V+ML+EQ QK+LRVKIA+LQKLQHEYEKLRDQ++ LARENKKL DDLAEAKSQLNDAHRR
Sbjct  301  VTMLMEQAQKELRVKIAELQKLQHEYEKLRDQRDQLARENKKLTDDLAEAKSQLNDAHRR 360
Query  447  IHEQEIEIKRLENEREELAAAYKEAETLRKQEEAKNQRLTAELAQTRHDYEKRLAQKEEE 506
            IHEQEIEIKRLENER+EL+AAYKEAETLRKQEEAKNQRL AELAQ RHDYEKRLAQK+EE
Sbjct  361  IHEQEIEIKRLENERDELSAAYKEAETLRKQEEAKNQRLIAELAQVRHDYEKRLAQKDEE 420
Query  507  IEALRKQYQIEIEQLNMRLAEAEAKLKTEVARLKKKYQAQITELELSLDAANKANIDLQK 566
            IEALRKQYQIEIEQLNMRLAEAEAKLKTE+ARLKKKYQAQITELELSLDAANKANIDLQK
Sbjct  421  IEALRKQYQIEIEQLNMRLAEAEAKLKTEIARLKKKYQAQITELELSLDAANKANIDLQK 480
Query  567  TIKKQALQITGLQAHYDEVHRQLQQAVDQLGVTQRRCQALTAELEEMRVNLEQALRAKRA 626
            TIKKQALQIT LQAHYDEVHRQLQQAVDQLGVTQRRCQAL AELEEMR+ LEQA RAKR 
Sbjct  481  TIKKQALQITELQAHYDEVHRQLQQAVDQLGVTQRRCQALQAELEEMRIALEQANRAKRQ 540
Query  627  AEQMHEEAVVRVNELTTINVNLASAKSKLETEFSALQNDYDEVHKELRISDERVQKLTIE 686
            AEQ+HEEAVVRVNELTTINVNLASAKSKLE+EFSALQ DYDEVHKELRISDERVQKLTIE
Sbjct  541  AEQLHEEAVVRVNELTTINVNLASAKSKLESEFSALQADYDEVHKELRISDERVQKLTIE 600
Query  687  VKSTKDLLESETERVTKLETIKKSLETEVRNLQIRIEEVEANALAGGKRVIAKLESRIRD 746
            +KSTKDLL  E ER+ KLET+KKSLE EVR L++RIEEVEANALAGGKRVIAKLESRIRD
Sbjct  601  LKSTKDLLIEEQERLVKLETVKKSLEQEVRTLHVRIEEVEANALAGGKRVIAKLESRIRD 660
Query  747  VEIEVEEERRRHAETEKMLRKKDHRVKELLLQ 778
            VEIEVEEERRRHAET+KMLRKKDHRVKELLLQ
Sbjct  661  VEIEVEEERRRHAETDKMLRKKDHRVKELLLQ 692

Sequence Alignment: 4. Allergen Name: Ani s 2 Sequence ID: AAF72796

 Score = 639.1 bits 2777,  Expect = 5e-184
 Identities = 441/863 51%, Positives = 628/863 72%, Gaps = 5/863 0%
Query  4    RSAKYMYQSSRAGHGGDISIEYGTDLGALTRLEDKIRLLSEDLESERELRQRVEREKSDI 63
            RS     +SS A  G   S+    DLG+LTRLEDKIRLL +D+ESERELR R+ERE++D+
Sbjct  7    RSPSMAIRSSTADMGALTSMSVA-DLGSLTRLEDKIRLLQDDFESERELRNRIERERADL 65
Query  64   TVQLMNLTERLEETEGSSESVTEMNKKRDSELAKLRKLLEDVHMESEETAHHLRQKHQAA 123
            +VQL+ LT+RL++ E +++S  E N+KR+ EL+KLRKLLE+ ++E+E+  + LR+KHQ  
Sbjct  66   SVQLIALTDRLQDAECATDSQIESNRKREVELSKLRKLLEESQLENEDAMNVLRKKHQDV 125
Query  124  IQEMQDQLDQVQKAKNKSDKEKQKFQAEVFELLAQVETANKDKLVAQKTVEKLEYTVHEL 183
              +  +Q++Q+QK  +K D+E+Q++Q EV EL A ++   KDK VA+K  +K+E    EL
Sbjct  126  CLDYTEQIEQLQKKNSKIDRERQRLQHEVIELTATIDQLQKDKHVAEKMAQKFEQQTIEL 185
Query  184  NIKIEEINRTVVEVTAHRQRLSQENSELIKEVHEYKISLDNANHLKGQIAQQLEDTRHRL 243
            + K+E++N+ V ++  +RQRL  ENS+L+ E+H+ K+ LDN  H+K Q+AQQLE++R RL
Sbjct  186  SNKVEDLNKHVNDLAQQRQRLQAENSDLLAEIHDQKVQLDNLQHVKYQLAQQLEESRRRL 245
Query  244  EDEERKRSSLENHAHTLEVELESLKVQLEEESEARLELERQLTKANGDAASWKSKYEAEL 303
            ED ER+RS ++ + H +++EL+S++V L+EES AR+E E +L+ AN +   WKSK++AE+
Sbjct  246  EDAERERSQMQAQLHQVQLELDSVRVALDEESAARVEAEHKLSLANTEITQWKSKFDAEV 305
Query  304  QAHVDEVEELRRKMAQKISEYGEQLEALLNKCSALEKQKARLQSEVEVLIMDLEKATAHA 363
              H +EVE+LR+KM QK +EY EQ+E +L K S LEK KARLQSEVEVLI+DLEKA    
Sbjct  306  ALHHEEVEDLRKKMMQKQAEYEEQIEIMLQKVSQLEKAKARLQSEVEVLIVDLEKAQNTI 365
Query  364  QALEKRVSQLEKINLDLKSKLEEVSMLLEQTQKDLRVKIADLQKLQHEYEKLRDQKEALA 423
              LE+   QLEK  L++KS+++E+ + LE  Q++ R  +A+LQK+++ YEK  +QKEALA
Sbjct  366  AILERAKEQLEKQVLEMKSRIDELLVELEAAQREARAALAELQKMKQLYEKAVEQKEALA 425
Query  424  RENKKLADDLAEAKSQLNDAHRRIHEQEIEIKRLENEREELAAAYKEAETLRKQEEAKNQ 483
            RENKKL DDL EA   L DA+R++HE ++E  RL  E  +L  A KE+E  R+  EA+ Q
Sbjct  426  RENKKLQDDLHEANEALADANRKLHELDLENARLAGEIRDLQVALKESEAARRDAEARAQ 485
Query  484  RLTAELAQTRHDYEKRLAQKEEEIEALRKQYQIEIEQLNMRLAEAEAKLKTEVARLKKKY 543
            R  AEL Q R + E+RL +KEEE+EALRK  Q EI++L   LA+AEA++K E+ARL+KKY
Sbjct  486  RALAELQQVRIEMERRLQEKEEEMEALRKSMQFEIDRLTAALADAEARMKAEIARLRKKY 545
Query  544  QAQITELELSLDAANKANIDLQKTIKKQALQITGLQAHYDEVHRQLQQAVDQLGVTQRRC 603
            QA+I ELE+++D  N+AN++ QKTIKKQ+ QI  LQA+ ++ +RQLQQ +DQ  + QR+ 
Sbjct  546  QAEIAELEMTVDNLNRANLEAQKTIKKQSEQIIQLQANLEDTQRQLQQTLDQYALAQRKI 605
Query  604  QALTAELEEMRVNLEQALRAKRAAEQMHEEAVVRVNELTTINVNLASAKSKLETEFSALQ 663
             AL+AELEE +  L+ A+RA++ AE   EEA VR+++LT+IN NL + K+KLETE+S  Q
Sbjct  606  SALSAELEECKTALDNAIRARKQAEADLEEAHVRISDLTSINSNLTAIKNKLETELSTAQ 665
Query  664  NDYDEVHKELRISDERVQKLTIEVKSTKDLLESETERVTKLETIKKSLETEVRNLQIRIE 723
             D DEV KEL  +DER  +   +       L  E E   K++ ++KSLE +V+ LQ++I+
Sbjct  666  ADLDEVTKELHAADERANRALADAARAVQELHEEQEHSMKIDALRKSLEEQVKQLQVQIQ 725
Query  724  EVEANALAGGKRVIAKLESRIRDVEIEVEEERRRHAETEKMLRKKDHRVKELLLQNEEDH 783
            E EA AL GGKRVIAKLE+RIRD+E+ ++EE RRH ET+  LRKKD R+KE+ +Q +E+H
Sbjct  726  EAEAAALLGGKRVIAKLETRIRDLEVALDEETRRHKETQSALRKKDRRIKEVQMQIDEEH 785
Query  784  KQIQLLQEMSDKLNEKVKVYKRQMQEQEGMSQQNLTRVRRFQRELEAAEDRADQAESNLS 843
            K   + Q+ +D++ EK+ + KRQ+ E E M+ QNL RVRR+QRELE AE RADQAES+L+
Sbjct  786  KMFVMAQDTADRMLEKLNIQKRQLGEAEAMTMQNLQRVRRYQRELEDAEGRADQAESSLN 845
Query  844  FIRAKHRSWVTTSQVPGGTRQVFVTEQE 871
            +IRAKHR  V      G    V+V E++
Sbjct  846  LIRAKHRGTVAV----GKATDVYVVEED 869

Sequence Alignment: 5. Allergen Name: Rap v 2.0101 Sequence ID: QPB41107

 Score = 392.2 bits 1694,  Expect = 1e-109
 Identities = 299/832 35%, Positives = 495/832 59%, Gaps = 9/832 1%
Query  22   SIEYGTDLGALTRLEDKIRLLSEDLESERELRQRVEREKSDITVQLMNLTERLEETEGSS 81
            ++  G+      RLE +IR L + L+SER+ R R E+  +++  ++  L + L+E   S+
Sbjct  18   NVYRGSSPSTQNRLESRIRELEDALDSERDGRVRAEKMVAELNFRVDQLQDSLDEQGTST 77
Query  82   ESVTEMNKKRDSELAKLRKLLEDVHMESEETAHHLRQKHQAAIQEMQDQLDQVQKAKNKS 141
             +  E++KKR+SE+ KLRK +E    + E T   +R++HQ ++ ++ DQ+D + K KN+ 
Sbjct  78   SAQMEISKKRESEIMKLRKDMELASAQFEATESSMRKRHQESVNDLSDQVDYLNKNKNRV 137
Query  142  DKEKQKFQAEVFELLAQVETANKDKLVAQKTVEKLEYTVHELNIKIEEINRTVVEVTAHR 201
            +KEKQ +  E+  L  Q+E+ +K K   +  V+  E +   L  +++++ R + E+T+ +
Sbjct  138  EKEKQTLVVELDGLTGQLESVSKAKATLESRVDAAERSASGLKSQVDDLTRQLSELTSLK 197
Query  202  QRLSQENSELIKEVHEYKISLDNANHLKGQIAQQLE----DTRHRLEDEERKRSSLENHA 257
             RL+QEN +L  +V+E    LD+ N   G+   QL+    D + +L+DE R+R +L+ + 
Sbjct  198  SRLTQENFDLQHQVQE----LDSNNAALGKARSQLQASNDDLKRQLDDETRQRQNLQVNL 253
Query  258  HTLEVELESLKVQLEEESEARLELERQLTKANGDAASWKSKYEAELQAHVDEVEELRRKM 317
              L+ + ++L V+LEEE+E    L  QL+K N D ++ KS+++ EL   ++E+E+L+R+M
Sbjct  254  SALQADYDNLNVRLEEEAETSTNLRNQLSKVNADYSALKSRFDKELALKMEEMEDLKRRM 313
Query  318  AQKISEYGEQLEALLNKCSALEKQKARLQSEVEVLIMDLEKATAHAQALEKRVSQLEKIN 377
              +I+E  +  E L  K S+LEK K +L +E++ + ++LE      Q L KR  QLE  N
Sbjct  314  QVRITELEDTCEQLRVKNSSLEKAKTKLANEIKEITIELENTQIIVQDLTKRNRQLENEN 373
Query  378  LDLKSKLEEVSMLLEQTQKDLRVKIADLQKLQHEYEKLRDQKEALARENKKLADDLAEAK 437
              L+ ++EE++      + +  +   D+QKL+    +L ++ + L RENK L+D L EA 
Sbjct  374  AGLQRRIEELTGENNTLRNEKALLEQDVQKLRVSNAELTERNDNLQRENKHLSDQLREAN 433
Query  438  SQLNDAHRRIHEQEIEIKRLENEREELAAAYKEAETLRKQEEAKNQRLTAELAQTRHDYE 497
              L DA+R + +      +LE ER+ LAAA K+ E   +  EAK     A L Q + D E
Sbjct  434  LALKDANRELADLRQLRSQLEAERDSLAAALKDTEEALRDAEAKLASAQAALNQLKIDME 493
Query  498  KRLAQKEEEIEALRKQYQIEIEQLNMRLAEAEAKLKTEVARLKKKYQAQITELELSLDAA 557
             RL +K+EEIE +R+     IE+L   L E E + KTE++R+KKK+++ I ELE +LD A
Sbjct  494  NRLREKDEEIENVRRSSARAIEELQRTLVEVETRYKTEISRMKKKFESDIRELEAALDNA 553
Query  558  NKANIDLQKTIKKQALQITGLQAHYDEVHRQLQQAVDQLGVTQRRCQALTAELEEMRVNL 617
            N+AN +  K IK    ++  L+   +E  R      +QLGV +R+  AL  ELE+ R  L
Sbjct  554  NRANSEYLKQIKSLQQRVKELETLLEEERRVSDDLRNQLGVAERKRVALAQELEDARALL 613
Query  618  EQALRAKRAAEQMHEEAVVRVNELTTINVNLASAKSKLETEFSALQNDYDEVHKELRISD 677
            E A RA++ AE    +   R++E+T    +L + K +LE ++SA+Q+D D+     R ++
Sbjct  614  EGAERARKNAETELADTSTRLSEITLQVTSLTNDKRRLEADLSAMQSDLDDAINNQRGAE 673
Query  678  ERVQKLTIEVKSTKDLLESETERVTKLETIKKSLETEVRNLQIRIEEVEANALAGGKRVI 737
            ER ++L  E     D L  E E     E+++K LE E+R + IR+EE EA A   G+R++
Sbjct  674  ERAERLAAENGRLADELRQEQENYKNAESLRKQLEVEIREITIRLEEAEAFATKEGRRLV 733
Query  738  AKLESRIRDVEIEVEEERRRHAETEKMLRKKDHRVKELLLQNEEDHKQIQLLQEMSDKLN 797
            AKL+ R+RD+E E+E E RR  E+    RK +   KEL+ Q EE+ +Q+  L  ++D+L 
Sbjct  734  AKLQVRVRDLEAELENEARRVRESVANQRKAERLHKELVAQTEEERRQLAELASLNDQLQ 793
Query  798  EKVKVYKRQMQEQEGMSQQNLTRVRRFQRELEAAEDRADQAESNLSFIRAKHRSWVTTSQ 857
             ++K YKRQ++E E ++   + + R+ Q  ++ A+ RAD AE NL  +R + RS   T +
Sbjct  794  LRIKTYKRQLEEAEDVASLTMNKYRKAQALIDEADARADAAEKNLQTVR-RARSMSVTRE 852
Query  858  V 858
            +
Sbjct  853  I 853

Sequence Alignment: 6. Allergen Name: Der f 10.0101 Sequence ID: BAA04557

 Score = 58.3 bits 228,  Expect = 1e-09
 Identities = 69/269 25%, Positives = 138/269 51%, Gaps = 15/269 5%
Query  197  VTAHRQRLSQENSELIKE-VHEYKISLDNANHLKGQIAQQ-LEDTRHRLEDEERKRSSLE 254
            V A +Q+      E IK+ ++  K+  DNA   + +IA+Q   D   R E  E +  +L+
Sbjct  4    VAAKQQQQPSTKMEAIKKKMQAMKLEKDNAID-RAEIAEQKARDANLRAEKSEEEVRALQ 62
Query  255  NHAHTLEVELESLKVQLEEESEARLELERQLTKANGDAASWKSKYEAELQAHVDEVEELR 314
               + +E EL+ ++ QL   +    E E+ L  A GD A+   + +  ++  ++  EE R
Sbjct  63   KKIQQIENELDQVQEQLSAANTKLEEKEKALQTAEGDVAALNRRIQL-IEEDLERSEE-R 120
Query  315  RKMAQ-KISEYGEQLEALLNKCSALEKQKARLQSEVEVLIMDLEKATAHAQALEKRVSQL 373
             K+A  K+ E  +  +        LE +    +  ++ L   L++A   A+  +++  ++
Sbjct  121  LKIATAKLEEASQSADESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEV 180
Query  374  EK----INLDLKSKLEEV----SMLLEQTQKDLRVKIADLQKLQHEYEKLRDQKEALARE 425
             +    +  DL+   E      S ++E  +++LRV   +L+ L+   EK + ++EA  ++
Sbjct  181  ARKLAMVEADLERAEERAETGESKIVE-LEEELRVVGNNLKSLEVSEEKAQQREEAYEQQ 239
Query  426  NKKLADDLAEAKSQLNDAHRRIHEQEIEIKRLENEREELAAAYK 469
             + +   L EA+++   A R +++ + E+ RLE+E       YK
Sbjct  240  IRIMTAKLKEAEARAEFAERSVQKLQKEVDRLEDELVHEKEKYK 283

Sequence Alignment: 7. Allergen Name: Hal d 1 Sequence ID: AAG08987

 Score = 57.2 bits 223,  Expect = 2e-09
 Identities = 75/241 31%, Positives = 138/241 57%, Gaps = 36/241 14%
Query  302  ELQAHVDEVEELRRKMAQKISEYGEQLEALLNKCSALEKQKARLQSEVEVLIMDLEKATA 361
            E +  VD  E+  +K+ +   E   ++E  LN    L+K+ A L+++ + +   L++A A
Sbjct  14   EKENAVDRAEQNEQKL-RDTEEQKAKIEEDLNN---LQKKCANLENDFDNVNEQLQEAMA 69
Query  362  HAQALEKRVSQLEKINLDLKSKLEEVSMLLEQTQKDL-RVKIADLQKLQHEYEKLRDQKE 420
              +  EKRV+++E+   ++     ++++L E  +++  R++ A  ++L+ E  K  D+ E
Sbjct  70   KLETSEKRVTEMEQ---EVSGTTRKITLLEEDLERNEERLQTAT-ERLE-EASKAADESE 124
Query  421  ALAR--ENKKLADD---------LAEAKSQLNDAHRRIHE--QEIEIKRLENEREELAAA 467
              AR  E++ LADD         L EAK    DA R+  E  +++ I  ++ ER E    
Sbjct  125  RGARVLESRSLADDERIDQLEAQLKEAKYIAEDAERKYDEAARKLAITEVDLERAEARLE 184
Query  468  YKEAETLRKQEEAKNQRLTAELAQTRHDYEKRLAQKEEEIEALRKQYQIEIEQLNMRLAE 527
              EA+ L  +EE K   +     ++    E+  +Q+E+  E   +     ++    R  E
Sbjct  185  AAEAKILELEEELK---VVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRATE 241
Query  528  AE---AKLKTEVARL-------KKKYQAQITELELSL 554
            AE   +KL+ EV RL       K+KY+A   EL+ ++
Sbjct  242  AERTVSKLQKEVDRLEDELLAEKEKYKAISDELDQTF 278

Sequence Alignment: 8. Allergen Name: Pan b 1.0101 Sequence ID: CBY17558

 Score = 55.8 bits 217,  Expect = 6e-09
 Identities = 59/255 23%, Positives = 127/255 49%, Gaps = 10/255 3%
Query  213  KEVHEYKISLDNANHLKGQIAQQLEDTRHRLEDEERKRSSLENHAHTLEVELESLKVQLE 272
            K+++  K+  DNA      + QQ ++  +R E  E +   L+   + LE +L+S++  L 
Sbjct  6    KKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVFGLQKKLQQLENDLDSVQEALL 65
Query  273  EESEARLELERQLTKANGDAASWKSKYEAELQAHVDEVEELRRKMAQKISEYGEQLEALL 332
            + ++   E ++ L+ A G+ A+   + +  L+  ++  EE       K++E  +  +   
Sbjct  66   KANQHLEEKDKALSNAEGEVAALNRRIQL-LEEDLERSEERLNTATTKLAEASQAADESE 124
Query  333  NKCSALEKQKARLQSEVEVLIMDLEKATAHAQALEKRVSQLEK----INLDLKSKLEEV- 387
                 LE +    +  ++ L   L++A   A+  +++  ++ +    +  DL+   E   
Sbjct  125  RMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAE 184
Query  388  ---SMLLEQTQKDLRVKIADLQKLQHEYEKLRDQKEALARENKKLADDLAEAKSQLNDAH 444
               S ++E  +++LRV   +L+ L+   EK   ++EA   + K L + L  A+++   A 
Sbjct  185  TGESKIVE-LEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAE 243
Query  445  RRIHEQEIEIKRLENEREELAAAYK 469
            R +++ + E+ RLE+E       YK
Sbjct  244  RSVQKLQKEVDRLEDELVNEKEKYK 268

Sequence Alignment: 9. Allergen Name: Der p 10 Sequence ID: O18416

 Score = 55.8 bits 217,  Expect = 6e-09
 Identities = 67/256 26%, Positives = 133/256 51%, Gaps = 15/256 5%
Query  210  ELIK-EVHEYKISLDNANHLKGQIAQQ-LEDTRHRLEDEERKRSSLENHAHTLEVELESL 267
            E IK +++  K+  DNA   + +IA+Q   D   R E  E +  +L+   + +E EL+ +
Sbjct  2    EAIKNKMQAMKLEKDNAID-RAEIAEQKARDANLRAEKSEEEVRALQKKIQQIENELDQV 60
Query  268  KVQLEEESEARLELERQLTKANGDAASWKSKYEAELQAHVDEVEELRRKMAQ-KISEYGE 326
            + QL   +    E E+ L  A GD A+   + +  ++  ++  EE R K+A  K+ E  +
Sbjct  61   QEQLSAANTKLEEKEKALQTAEGDVAALNRRIQL-IEEDLERSEE-RLKIATAKLEEASQ 118
Query  327  QLEALLNKCSALEKQKARLQSEVEVLIMDLEKATAHAQALEKRVSQLEK----INLDLKS 382
              +        LE +    +  +E L   L++A   A+  +++  ++ +    +  DL+ 
Sbjct  119  SADESERMRKMLEHRSITDEERMEGLENQLKEARMMAEDADRKYDEVARKLAMVEADLER 178
Query  383  KLEEV----SMLLEQTQKDLRVKIADLQKLQHEYEKLRDQKEALARENKKLADDLAEAKS 438
              E      S ++E  +++LRV   +L+ L+   EK + ++EA  ++ + +   L EA++
Sbjct  179  AEERAETGESKIVE-LEEELRVVGNNLKSLEVSEEKAQQREEAHEQQIRIMTTKLKEAEA 237
Query  439  QLNDAHRRIHEQEIEIKRLENEREELAAAYK 469
            +   A R +++ + E+ RLE+E       YK
Sbjct  238  RAEFAERSVQKLQKEVGRLEDELVHEKEKYK 268

Sequence Alignment: 10. Allergen Name: Pen m 1 Sequence ID: AAX37288

 Score = 55.6 bits 216,  Expect = 7e-09
 Identities = 58/255 22%, Positives = 127/255 49%, Gaps = 10/255 3%
Query  213  KEVHEYKISLDNANHLKGQIAQQLEDTRHRLEDEERKRSSLENHAHTLEVELESLKVQLE 272
            K+++  K+  DNA      + QQ ++  +R E  E +  +L+   + LE +L+ ++  L 
Sbjct  6    KKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLL 65
Query  273  EESEARLELERQLTKANGDAASWKSKYEAELQAHVDEVEELRRKMAQKISEYGEQLEALL 332
            + +   +E ++ L+ A G+ A+   + +  L+  ++  EE       K++E  +  +   
Sbjct  66   KANIQLVEKDKALSNAEGEVAALNRRIQL-LEEDLERSEERLNTATTKLAEASQAADESE 124
Query  333  NKCSALEKQKARLQSEVEVLIMDLEKATAHAQALEKRVSQLEK----INLDLKSKLEEV- 387
                 LE +    +  ++ L   L++A   A+  +++  ++ +    +  DL+   E   
Sbjct  125  RMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAE 184
Query  388  ---SMLLEQTQKDLRVKIADLQKLQHEYEKLRDQKEALARENKKLADDLAEAKSQLNDAH 444
               S ++E  +++LRV   +L+ L+   EK   ++EA   + K L + L  A+++   A 
Sbjct  185  TGESKIVE-LEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAE 243
Query  445  RRIHEQEIEIKRLENEREELAAAYK 469
            R +++ + E+ RLE+E       YK
Sbjct  244  RSVQKLQKEVDRLEDELVNEKEKYK 268

Sequence Alignment: 11. Allergen Name: Pen a 1 Sequence ID: 11893851

 Score = 55.6 bits 216,  Expect = 7e-09
 Identities = 58/255 22%, Positives = 127/255 49%, Gaps = 10/255 3%
Query  213  KEVHEYKISLDNANHLKGQIAQQLEDTRHRLEDEERKRSSLENHAHTLEVELESLKVQLE 272
            K+++  K+  DNA      + QQ ++  +R E  E +  +L+   + LE +L+ ++  L 
Sbjct  6    KKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLL 65
Query  273  EESEARLELERQLTKANGDAASWKSKYEAELQAHVDEVEELRRKMAQKISEYGEQLEALL 332
            + +   +E ++ L+ A G+ A+   + +  L+  ++  EE       K++E  +  +   
Sbjct  66   KANIQLVEKDKALSNAEGEVAALNRRIQL-LEEDLERSEERLNTATTKLAEASQAADESE 124
Query  333  NKCSALEKQKARLQSEVEVLIMDLEKATAHAQALEKRVSQLEK----INLDLKSKLEEV- 387
                 LE +    +  ++ L   L++A   A+  +++  ++ +    +  DL+   E   
Sbjct  125  RMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAE 184
Query  388  ---SMLLEQTQKDLRVKIADLQKLQHEYEKLRDQKEALARENKKLADDLAEAKSQLNDAH 444
               S ++E  +++LRV   +L+ L+   EK   ++EA   + K L + L  A+++   A 
Sbjct  185  TGESKIVE-LEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAE 243
Query  445  RRIHEQEIEIKRLENEREELAAAYK 469
            R +++ + E+ RLE+E       YK
Sbjct  244  RSVQKLQKEVDRLEDELVNEKEKYK 268

Sequence Alignment: 12. Allergen Name: Lit v 1.0101 Sequence ID: EU410072

 Score = 55.6 bits 216,  Expect = 7e-09
 Identities = 58/255 22%, Positives = 127/255 49%, Gaps = 10/255 3%
Query  213  KEVHEYKISLDNANHLKGQIAQQLEDTRHRLEDEERKRSSLENHAHTLEVELESLKVQLE 272
            K+++  K+  DNA      + QQ ++  +R E  E +  +L+   + LE +L+ ++  L 
Sbjct  6    KKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLL 65
Query  273  EESEARLELERQLTKANGDAASWKSKYEAELQAHVDEVEELRRKMAQKISEYGEQLEALL 332
            + +   +E ++ L+ A G+ A+   + +  L+  ++  EE       K++E  +  +   
Sbjct  66   KANIQLVEKDKALSNAEGEVAALNRRIQL-LEEDLERSEERLNTATTKLAEASQAADESE 124
Query  333  NKCSALEKQKARLQSEVEVLIMDLEKATAHAQALEKRVSQLEK----INLDLKSKLEEV- 387
                 LE +    +  ++ L   L++A   A+  +++  ++ +    +  DL+   E   
Sbjct  125  RMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAE 184
Query  388  ---SMLLEQTQKDLRVKIADLQKLQHEYEKLRDQKEALARENKKLADDLAEAKSQLNDAH 444
               S ++E  +++LRV   +L+ L+   EK   ++EA   + K L + L  A+++   A 
Sbjct  185  TGESKIVE-LEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAE 243
Query  445  RRIHEQEIEIKRLENEREELAAAYK 469
            R +++ + E+ RLE+E       YK
Sbjct  244  RSVQKLQKEVDRLEDELVNEKEKYK 268

Sequence Alignment: 13. Allergen Name: Blo t 10.0101 Sequence ID: ABU97466

 Score = 55.6 bits 216,  Expect = 7e-09
 Identities = 59/256 23%, Positives = 129/256 50%, Gaps = 8/256 3%
Query  213  KEVHEYKISLDNANHLKGQIAQQL-EDTRHRLEDEERKRSSLENHAHTLEVELESLKVQL 271
            K+++  K+  DNA   + +IA+Q   D   R E  E +  +L+   + +E EL+ ++  L
Sbjct  6    KKMQAMKLEKDNAID-RAEIAEQKSRDANLRAEKSEEEVRALQKKIQQIENELDQVQESL 64
Query  272  EEESEARLELERQLTKANGDAASWKSKY---EAELQAHVDEVEELRRKM--AQKISEYGE 326
             + +    E E+ L  A GD A+   +    E +L+   + ++    K+  A   ++  E
Sbjct  65   TQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHSADESE 124
Query  327  QLEALLNKCSALEKQKAR-LQSEVEVLIMDLEKATAHAQALEKRVSQLEKINLDLKSKLE 385
            ++  +L   S  ++++   L+S+++   M  E A      + ++++ +E      + + E
Sbjct  125  RMRKMLEHRSITDEERMDGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAEERAE 184
Query  386  EVSMLLEQTQKDLRVKIADLQKLQHEYEKLRDQKEALARENKKLADDLAEAKSQLNDAHR 445
                 + + +++LRV   +L+ L+   EK + ++EA  ++ + +   L EA+++   A R
Sbjct  185  TGETKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRMMTGKLKEAEARAEFAER 244
Query  446  RIHEQEIEIKRLENEREELAAAYK 469
             + + + E+ RLE+E       YK
Sbjct  245  SVRKLQKEVDRLEDELVHEKEKYK 268

Sequence Alignment: 14. Allergen Name: Bomb m 3.0101 Sequence ID: NP_001103782

 Score = 55.2 bits 214,  Expect = 1e-08
 Identities = 62/256 24%, Positives = 121/256 47%, Gaps = 10/256 3%
Query  213  KEVHEYKISLDNANHLKGQIAQQLEDTRHRLEDEERKRSSLENHAHTLEVELESLKVQLE 272
            K+++  K+  DNA        QQ +D   R E  E +   L+   +T+E EL+  +  L 
Sbjct  6    KKMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQTQESLM 65
Query  273  EESEARLELERQLTKANGDAASWKSKYEAELQAHVDEVEELRRKMAQKISEYGEQLEALL 332
            + +    E E+ L  A  + A+   + +  L+  ++  EE       K+SE  +  +   
Sbjct  66   QVNGKLEEKEKALQNAESEVAALNRRIQL-LEEDLERSEERLATATAKLSEASQAADESE 124
Query  333  NKCSALEKQKARLQSEVEVLIMDLEKATAHAQALEKRVSQLEK----INLDLKSKLEEV- 387
                 LE +    +  ++ L   L++A   A+  +K+  ++ +    +  DL+   E   
Sbjct  125  RARKVLENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAEERAE 184
Query  388  ---SMLLEQTQKDLRVKIADLQKLQHEYEKLRDQKEALARENKKLADDLAEAKSQLNDAH 444
               S ++E  +++LRV   +L+ L+   EK   ++E    + K L   L EA+++   A 
Sbjct  185  SGESKIVE-LEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAEFAE 243
Query  445  RRIHEQEIEIKRLENEREELAAAYKE 470
            R +++ + E+ RLE+E       YK+
Sbjct  244  RSVQKLQKEVDRLEDELVAEKEKYKD 269

Sequence Alignment: 15. Allergen Name: Met e 1 Sequence ID: Q25456

 Score = 54.7 bits 212,  Expect = 1e-08
 Identities = 57/249 22%, Positives = 123/249 49%, Gaps = 10/249 4%
Query  219  KISLDNANHLKGQIAQQLEDTRHRLEDEERKRSSLENHAHTLEVELESLKVQLEEESEAR 278
            K+  DNA      + QQ ++  +R E  E +  +L+   + LE +L+ ++  L + +   
Sbjct  2    KLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDQVQESLLKANNQL 61
Query  279  LELERQLTKANGDAASWKSKYEAELQAHVDEVEELRRKMAQKISEYGEQLEALLNKCSAL 338
            +E ++ L+ A G+ A+   + +  L+  ++  EE       K++E  +  +        L
Sbjct  62   VEKDKALSNAEGEVAALNRRIQL-LEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
Query  339  EKQKARLQSEVEVLIMDLEKATAHAQALEKRVSQLEK----INLDLKSKLEEV----SML 390
            E +    +  ++ L   L++A   A+  +++  ++ +    +  DL+   E      S +
Sbjct  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAETGESKI 180
Query  391  LEQTQKDLRVKIADLQKLQHEYEKLRDQKEALARENKKLADDLAEAKSQLNDAHRRIHEQ 450
            +E  +++LRV   +L+ L+   EK   ++EA   + K L + L  A+++   A R +++ 
Sbjct  181  VE-LEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKL 239
Query  451  EIEIKRLENEREELAAAYK 469
            + E+ RLE+E       YK
Sbjct  240  QKEVDRLEDELVNEKEKYK 258

Sequence Alignment: 16. Allergen Name: Lep d 10 Sequence ID: Q9NFZ4

 Score = 54.7 bits 212,  Expect = 1e-08
 Identities = 61/259 23%, Positives = 131/259 50%, Gaps = 9/259 3%
Query  210  ELIK-EVHEYKISLDNANHLKGQIAQQL-EDTRHRLEDEERKRSSLENHAHTLEVELESL 267
            E IK +++  K+  DNA   + +IA+Q   D   R E  E +   L+   + +E EL+ +
Sbjct  2    EAIKNKMQAMKLEKDNAID-RAEIAEQKSRDANLRAEKSEEEVRGLQKKIQQIENELDQV 60
Query  268  KVQLEEESEARLELERQLTKANGDAASWKSKY---EAELQAHVDEVEELRRKM--AQKIS 322
            +  L + +    E E+ L  A GD A+   +    E +L+     ++    K+  A + +
Sbjct  61   QESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSA 120
Query  323  EYGEQLEALLNKCSALEKQKAR-LQSEVEVLIMDLEKATAHAQALEKRVSQLEKINLDLK 381
            +  E++  +L   S  ++++   L+S+++   M  E A      + ++++ +E      +
Sbjct  121  DESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAE 180
Query  382  SKLEEVSMLLEQTQKDLRVKIADLQKLQHEYEKLRDQKEALARENKKLADDLAEAKSQLN 441
             + E     + + +++LRV   +L+ L+   EK + ++EA  ++ + +   L EA+++  
Sbjct  181  ERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAE 240
Query  442  DAHRRIHEQEIEIKRLENEREELAAAYK 469
             A R +++ + E+ RLE+E       YK
Sbjct  241  FAERSVQKLQKEVDRLEDELVHEKEKYK 268

Sequence Alignment: 17. Allergen Name: Pro c 1.0101 Sequence ID: C0LU07

 Score = 54.0 bits 209,  Expect = 2e-08
 Identities = 58/255 22%, Positives = 126/255 49%, Gaps = 10/255 3%
Query  213  KEVHEYKISLDNANHLKGQIAQQLEDTRHRLEDEERKRSSLENHAHTLEVELESLKVQLE 272
            K+++  K+  DNA      + QQ ++   R E  E +  +L+   + LE +L+ ++  L 
Sbjct  6    KKMQATKLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQHLENDLDQVQESLL 65
Query  273  EESEARLELERQLTKANGDAASWKSKYEAELQAHVDEVEELRRKMAQKISEYGEQLEALL 332
            + +    E ++ ++ A G+ A+   + +  L+  ++  EE       K++E  +  +   
Sbjct  66   KANTQLEEKDKAISNAEGEVAALNRRIQL-LEEDLERSEERLNTATTKLAEASQAADESE 124
Query  333  NKCSALEKQKARLQSEVEVLIMDLEKATAHAQALEKRVSQLEK----INLDLKSKLEEV- 387
                 LE +    +  ++ L   L++A   A+  +++  ++ +    +  DL+   E   
Sbjct  125  RMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAE 184
Query  388  ---SMLLEQTQKDLRVKIADLQKLQHEYEKLRDQKEALARENKKLADDLAEAKSQLNDAH 444
               S ++E  +++LRV   +L+ L+   EK   ++EA   + K LA+ L  A+++   A 
Sbjct  185  TGESKIVE-LEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAEFAE 243
Query  445  RRIHEQEIEIKRLENEREELAAAYK 469
            R +++ + E+ RLE+E       YK
Sbjct  244  RSVQKLQKEVDRLEDELVNEKEKYK 268

Sequence Alignment: 18. Allergen Name: Scy p 1.0101 Sequence ID: A7L5V2

 Score = 53.8 bits 208,  Expect = 3e-08
 Identities = 59/255 23%, Positives = 122/255 47%, Gaps = 10/255 3%
Query  213  KEVHEYKISLDNANHLKGQIAQQLEDTRHRLEDEERKRSSLENHAHTLEVELESLKVQLE 272
            K+++  K+  DNA      + QQ ++   R E  E +  + +   + +E EL+  + QL 
Sbjct  6    KKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQAQEQLS 65
Query  273  EESEARLELERQLTKANGDAASWKSKYEAELQAHVDEVEELRRKMAQKISEYGEQLEALL 332
              +    E E+ L  A G+ A+   + +  L+  ++  EE       K++E  +  +   
Sbjct  66   AANTKLDEKEKALQNAEGEVAALNRRIQL-LEEDLERSEERLNTATTKLAEASQAADESE 124
Query  333  NKCSALEKQKARLQSEVEVLIMDLEKATAHAQALEKRVSQLEK----INLDLKSKLEEV- 387
                 LE +    +  ++ L   L++A   A+  +++  ++ +    +  DL+   E   
Sbjct  125  RMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAE 184
Query  388  ---SMLLEQTQKDLRVKIADLQKLQHEYEKLRDQKEALARENKKLADDLAEAKSQLNDAH 444
               S ++E  +++LRV   +L+ L+   EK   ++E    + K LA+ L  A+++   A 
Sbjct  185  SGESKIVE-LEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAEFAE 243
Query  445  RRIHEQEIEIKRLENEREELAAAYK 469
            R +++ + E+ RLE+E       YK
Sbjct  244  RSVQKLQKEVDRLEDELVNEKEKYK 268

Sequence Alignment: 19. Allergen Name: Hom a 1.0101 Sequence ID: O44119

 Score = 53.8 bits 208,  Expect = 3e-08
 Identities = 60/255 23%, Positives = 122/255 47%, Gaps = 10/255 3%
Query  213  KEVHEYKISLDNANHLKGQIAQQLEDTRHRLEDEERKRSSLENHAHTLEVELESLKVQLE 272
            K+++  K+  DNA      + QQ ++   R E  E +        + +E EL+ ++ QL 
Sbjct  6    KKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKTEEEIRITHKKMQQVENELDQVQEQLS 65
Query  273  EESEARLELERQLTKANGDAASWKSKYEAELQAHVDEVEELRRKMAQKISEYGEQLEALL 332
              +    E E+ L  A G+ A+   + +  L+  ++  EE       K++E  +  +   
Sbjct  66   LANTKLEEKEKALQNAEGEVAALNRRIQL-LEEDLERSEERLNTATTKLAEASQAADESE 124
Query  333  NKCSALEKQKARLQSEVEVLIMDLEKATAHAQALEKRVSQLEK----INLDLKSKLEEV- 387
                 LE +    +  ++ L   L++A   A+  +++  ++ +    +  DL+   E   
Sbjct  125  RMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAE 184
Query  388  ---SMLLEQTQKDLRVKIADLQKLQHEYEKLRDQKEALARENKKLADDLAEAKSQLNDAH 444
               S ++E  +++LRV   +L+ L+   EK   ++EA   + K LA+ L  A+++   A 
Sbjct  185  TGESKIVE-LEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAEFAE 243
Query  445  RRIHEQEIEIKRLENEREELAAAYK 469
            R +++ + E+ RLE+E       YK
Sbjct  244  RSVQKLQKEVDRLEDELVNEKEKYK 268

Sequence Alignment: 20. Allergen Name: Pan h 4.0101 Sequence ID: XP_026781482

 Score = 52.9 bits 204,  Expect = 5e-08
 Identities = 72/274 26%, Positives = 146/274 53%, Gaps = 26/274 9%
Query  116  LRQKHQAAIQEMQDQLDQVQKA----KNKSDKEKQKFQAEVFELLAQVETANKDKLVAQK 171
            +++K Q    + ++ +D+ ++A    K   DK KQ ++ E++ L  +++   +D++   K
Sbjct  4    IKKKMQMLKGDKENAFDRAEQAELDKKVSEDKCKQ-LEDELLGLQKKLK-GTEDEV--DK 59
Query  172  TVEKLEYTVHELNIKIEEINRTVVEVTAHRQRLSQENSELIKEVHEYKISLDNANHLKGQ 231
              E L+    +L +  ++      EV A  +R+     +LI+E       LD A    G 
Sbjct  60   YSEALKDAQEKLELSEKKATDAEGEVAALNRRI-----QLIEE------ELDRAQGRLGT 108
Query  232  IAQQLEDTRHRLEDEERKRSSLENHAHTLEVELESLKVQLEEESEARLELERQLTKANGD 291
              Q+LE+   + ++ ER    +EN A   E ++E  ++QL+E  +   + +R+  +    
Sbjct  109  ALQKLEEAEKQADESERGMKVIENRAMKDEEKMEIQELQLKEAKQIAEDSDRKYDEVARK 168
Query  292  AASWKSKYE-AELQAHVDEVE--ELRRKMAQKISEYGEQLEALLNKCSALEKQKARLQSE 348
                + + E AE +A V E++  +L  ++ + ++   + LEA   K S  E    + + E
Sbjct  169  LVVIEGELERAEERAEVSELKSGDLEEEL-KNVTNTLKSLEAQAEKYSDKED---KYEEE 224
Query  349  VEVLIMDLEKATAHAQALEKRVSQLEKINLDLKSKLEEVSMLLEQTQKDLRVKIADLQKL 408
            + +L   L++A   A+  EK VS+LEK   DL+ +L    + ++   ++L   + D+  L
Sbjct  225  INLLNEKLKEAETRAEFAEKTVSKLEKTIDDLEDELYNQKLKVKAICEELDNALNDMTTL 284

Sequence Alignment: 21. Allergen Name: Mel l 1.0101 Sequence ID: M4M2H6

 Score = 52.4 bits 202,  Expect = 7e-08
 Identities = 73/258 28%, Positives = 137/258 53%, Gaps = 28/258 10%
Query  279  LELERQLTKANGDAASWKSKYEAELQAHV--DEVEELRRKMAQKISEYGEQLEALL-NKC 335
            ++LE+       D    ++K EA ++A    D+V +L++K+ Q  +++ +  EALL    
Sbjct  11   MKLEKDNAMDRADTLEQQNK-EANIRAEKAEDDVNKLQKKLQQLENDFDQVQEALLLANT 69
Query  336  SALEKQKARLQSEVEVLIMDLEKATAHAQALEKRVSQLEKINLDLKSKLEEVSMLLEQTQ 395
            +A+EK KA   +E EV  ++        Q LE+ + + E+      +KL E S   ++++
Sbjct  70   NAVEKDKALSNAEGEVAALN-----RRIQLLEEDLERSEERLNTATTKLAEASQAADESE 124
Query  396  KDLRV----KIADLQKLQHEYEKLRDQK---EALARENKKLADDLAEAKSQLNDAHRRIH 448
            +  +V     ++D +++     +L++ +   E   R+  ++A  LA  ++ L  A  R  
Sbjct  125  RMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAE 184
Query  449  EQEIEIKRLENEREELAAAYKEAETLRKQEEAKNQRLTAELAQTRHDYEKRLAQKEEEIE 508
              E +I  LE   EEL       ++L   EE  NQR  A   Q      K L  K +  E
Sbjct  185  TGESKIVELE---EELRVVGNNLKSLEVSEEKANQREEAYKEQI-----KTLTNKLKAAE 236
Query  509  ALRKQYQIEIEQLNMRLAEAEAKLKTEVARLKKKYQAQITELELSL 554
            A R ++    E+   +L +   +L+ E+   K+KY++   EL+ ++
Sbjct  237  A-RAEFA---ERSVQKLQKEVDRLEDELVNEKEKYKSITDELDQTF 278

Sequence Alignment: 22. Allergen Name: Cho a 10.0101 Sequence ID: AEX31649

 Score = 52.4 bits 202,  Expect = 7e-08
 Identities = 56/256 21%, Positives = 129/256 50%, Gaps = 8/256 3%
Query  213  KEVHEYKISLDNANHLKGQIAQQL-EDTRHRLEDEERKRSSLENHAHTLEVELESLKVQL 271
            K+++  K+  DNA   + +IA+Q   D   + E  E +   L+   + +E EL+ ++  +
Sbjct  6    KKMQAMKLEKDNAID-RAEIAEQKSRDANLKAEKSEEEVRGLQKKIQQIENELDQVQESF 64
Query  272  EEESEARLELERQLTKANGDAASWKSKY---EAELQAHVDEVEELRRKM--AQKISEYGE 326
             + +    E E+ L  A GD A+   +    E +L+   + ++    K+  A   ++  E
Sbjct  65   TQANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKVATAKLEEASHAADESE 124
Query  327  QLEALLNKCSALEKQKAR-LQSEVEVLIMDLEKATAHAQALEKRVSQLEKINLDLKSKLE 385
            ++  +L   S  ++++   L+++++   M  E A      + ++++ +E      + + E
Sbjct  125  RMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAEERAE 184
Query  386  EVSMLLEQTQKDLRVKIADLQKLQHEYEKLRDQKEALARENKKLADDLAEAKSQLNDAHR 445
                 + + +++LRV   +L+ L+   EK + ++EA  ++ + +   L EA+++   A R
Sbjct  185  TGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAEFAER 244
Query  446  RIHEQEIEIKRLENEREELAAAYK 469
             +++ + E+ RLE+E       YK
Sbjct  245  SVQKLQKEVDRLEDELVHEKEKYK 268

Sequence Alignment: 23. Allergen Name: Per a 7 Sequence ID: Q9UB83

 Score = 52.2 bits 201,  Expect = 8e-08
 Identities = 70/268 26%, Positives = 138/268 51%, Gaps = 32/268 11%
Query  310  VEELRRKM-AQKISEYGEQLEALLNKCSALEKQKARLQSEVEVLIMDLEKATAHAQALEK 368
            ++ +++KM A K+    E+  A+   C+ L +Q+AR  +      +  EKA   A++L+K
Sbjct  1    MDAIKKKMQAMKL----EKDNAM--DCALLCEQQARDAN------LRAEKAEEEARSLQK 48
Query  369  RVSQLEKINLDLKSKLEEVSMLLEQTQKDLRVKIADLQKLQHEYEKLRDQKEALARENKK 428
            ++ Q+E    DL   +E+    L Q    L  K   LQ  + E   L  + + L  + ++
Sbjct  49   KIQQIEN---DLDQTMEQ----LMQVNAKLDEKDKALQNAESEVAALNRRIQLLEEDLER 101
Query  429  LADDLAEAKSQLNDAHRRIHEQE-----IEIKRLENER--EELAAAYKEAETLRKQEEAK 481
              + LA A ++L +A + + E E     +E K L +E   + L    KEA  + ++ + K
Sbjct  102  SEERLATATAKLAEASQAVDESERARKILESKGLADEERMDALENQLKEARFMAEEADKK 161
Query  482  NQRLTAELAQTRHDYEK---RLAQKEEEIEALRKQYQIEIEQL-NMRLAEAEAKLKTEVA 537
               +  +LA    D E+   R    E +I  L ++ ++    L ++ ++E +A L+ E  
Sbjct  162  YDEVARKLAMVEADLERAEERAESGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEY 221
Query  538  RLK-KKYQAQITELELSLDAANKANIDLQKTIKKQALQITGLQAHYDEVHRQLQQAVDQL 596
            + + K    ++ E E   + A ++   LQK + +   ++   +  Y  +   L     +L
Sbjct  222  KQQIKTLTTRLKEAEARAEFAERSVQKLQKEVDRLEDELVHEKEKYKFICDDLDMTFTEL 281

Sequence Alignment: 24. Allergen Name: Hal l 1.0101 Sequence ID: APG42675

 Score = 51.5 bits 198,  Expect = 1e-07
 Identities = 67/269 24%, Positives = 127/269 47%, Gaps = 16/269 5%
Query  98   LRKLLEDVHMESEETAHHLRQKHQAAIQEMQDQLDQVQKAKNKSDKEKQKFQAEVFELLA 157
            ++K +  + ME E       Q  Q  +++ ++Q  ++++  N   K+   ++ +   +  
Sbjct  4    IKKKMLAMKMEKENAVDRAEQNEQK-LRDTEEQKAKIEEDLNNLQKKCANLENDFDNVNE 62
Query  158  QVETANKDKLVAQKTVEKLEYTVHELNIKI----EEINRTVVEVTAHRQRLSQ-----EN 208
            Q++ A      ++K V ++E  V     KI    E++ R    +    +RL +     + 
Sbjct  63   QLQEAMTKLETSEKRVTEMEQEVSGTTRKITLLEEDLERNEERLQTATERLEEASKAADE 122
Query  209  SELIKEVHEYKISLDNANHLKGQIAQQLEDTRHRLEDEERKRSSLENHAHTLEVELESLK 268
            SE  ++V E + SL +   +  Q+  QL++ ++  ED ERK           EV+LE  +
Sbjct  123  SERGRKVLESR-SLADDERID-QLEAQLKEAKYIAEDAERKYDEAARKLAITEVDLERAE 180
Query  269  VQLEEESEARLELERQLTKANGDAASWKSKYEAELQAHVDEVEELRRKMAQKISEYGEQL 328
             +LE      LELE +L K  G+        E E     D  EE  R + Q++ +   + 
Sbjct  181  ARLEAAEAKILELEEEL-KVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRA 239
Query  329  EALLNKCSALEKQKARLQSEVEVLIMDLEKATAHAQALEKRVSQL 373
                   S L+K+  RL+ E   L+ + EK  A +  L++  ++L
Sbjct  240  TEAERTVSKLQKEVDRLEDE---LLAEKEKYKAISDELDQTFAEL 281

Sequence Alignment: 25. Allergen Name: Per a 7.0102 Sequence ID: AAD19606

 Score = 51.3 bits 197,  Expect = 1e-07
 Identities = 60/255 23%, Positives = 120/255 47%, Gaps = 10/255 3%
Query  213  KEVHEYKISLDNANHLKGQIAQQLEDTRHRLEDEERKRSSLENHAHTLEVELESLKVQLE 272
            K+++  K+  DNA        QQ  D   R E  E +  SL+   + +E +L+    QL 
Sbjct  6    KKMQAMKLEKDNAMDRALLCEQQARDANLRAEKAEEEARSLQKKIQQIENDLDQTMEQLM 65
Query  273  EESEARLELERQLTKANGDAASWKSKYEAELQAHVDEVEELRRKMAQKISEYGEQLEALL 332
            + +    E ++ L  A  + A+   + +  L+  ++  EE       K++E  +  +   
Sbjct  66   QVNAKLDEKDKALQNAESEVAALNRRIQL-LEEDLERSEERLATATAKLAEASQAADESE 124
Query  333  NKCSALEKQKARLQSEVEVLIMDLEKATAHAQALEKRVSQLEK----INLDLKSKLEEV- 387
                 LE +    +  ++ L   L++A   A+  +K+  ++ +    +  DL+   E   
Sbjct  125  RARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAEERAE 184
Query  388  ---SMLLEQTQKDLRVKIADLQKLQHEYEKLRDQKEALARENKKLADDLAEAKSQLNDAH 444
               S ++E  +++LRV   +L+ L+   EK   ++E   ++ K L   L EA+++   A 
Sbjct  185  SGESKIVE-LEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLTTRLKEAEARAEFAE 243
Query  445  RRIHEQEIEIKRLENEREELAAAYK 469
            R +++ + E+ RLE+E       YK
Sbjct  244  RSVQKLQKEVDRLEDELVHEKEKYK 268

Sequence Alignment: 26. Allergen Name: Por p 1.0101 Sequence ID: M1H607

 Score = 50.8 bits 195,  Expect = 2e-07
 Identities = 57/255 22%, Positives = 125/255 49%, Gaps = 10/255 3%
Query  213  KEVHEYKISLDNANHLKGQIAQQLEDTRHRLEDEERKRSSLENHAHTLEVELESLKVQLE 272
            K+++  K+  D+A      + QQ ++   R E  E +  +L+   + LE +L+ ++  L 
Sbjct  6    KKMQAMKLEKDDAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLL 65
Query  273  EESEARLELERQLTKANGDAASWKSKYEAELQAHVDEVEELRRKMAQKISEYGEQLEALL 332
            + +    E ++ L+ A G+ A+   + +  L+  ++  EE       K++E  +  +   
Sbjct  66   KANTQLEEKDKALSNAEGEVAALNRRIQL-LEEDLERSEERLNTATTKLAEASQAADESE 124
Query  333  NKCSALEKQKARLQSEVEVLIMDLEKATAHAQALEKRVSQLEK----INLDLKSKLEEV- 387
                 LE +    +  ++ L   L++A   A+  +++  ++ +    +  DL+   E   
Sbjct  125  RMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAE 184
Query  388  ---SMLLEQTQKDLRVKIADLQKLQHEYEKLRDQKEALARENKKLADDLAEAKSQLNDAH 444
               S ++E  +++LRV   +L+ L+   EK   ++EA   + K L + L  A+++   A 
Sbjct  185  TGESKIVE-LEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAE 243
Query  445  RRIHEQEIEIKRLENEREELAAAYK 469
            R +++ + E+ RLE+E       YK
Sbjct  244  RSVQKLQKEVDRLEDELVNEKEKYK 268

Sequence Alignment: 27. Allergen Name: Bla g 7.0101 Sequence ID: AAF72534

 Score = 50.8 bits 195,  Expect = 2e-07
 Identities = 60/255 23%, Positives = 120/255 47%, Gaps = 10/255 3%
Query  213  KEVHEYKISLDNANHLKGQIAQQLEDTRHRLEDEERKRSSLENHAHTLEVELESLKVQLE 272
            K+++  K+  DNA        QQ  D   R E  E +  SL+   + +E +L+    QL 
Sbjct  6    KKMQAMKLEKDNAMDRALLCEQQARDANIRAEKAEEEARSLQKKIQQIENDLDQTMEQLM 65
Query  273  EESEARLELERQLTKANGDAASWKSKYEAELQAHVDEVEELRRKMAQKISEYGEQLEALL 332
            + +    E ++ L  A  + A+   + +  L+  ++  EE       K++E  +  +   
Sbjct  66   QVNAKLDEKDKALQNAESEVAALNRRIQL-LEEDLERSEERLATATAKLAEASQAADESE 124
Query  333  NKCSALEKQKARLQSEVEVLIMDLEKATAHAQALEKRVSQLEK----INLDLKSKLEEV- 387
                 LE +    +  ++ L   L++A   A+  +K+  ++ +    +  DL+   E   
Sbjct  125  RARKILESKGLADEERMDALENQLKEARFMAEEADKKYDEVARKLAMVEADLERAEERAE 184
Query  388  ---SMLLEQTQKDLRVKIADLQKLQHEYEKLRDQKEALARENKKLADDLAEAKSQLNDAH 444
               S ++E  +++LRV   +L+ L+   EK   ++E   ++ K L   L EA+++   A 
Sbjct  185  TGESKIVE-LEEELRVVGNNLKSLEVSEEKANLREEEYKQQIKTLNTRLKEAEARAEFAE 243
Query  445  RRIHEQEIEIKRLENEREELAAAYK 469
            R +++ + E+ RLE+E       YK
Sbjct  244  RSVQKLQKEVDRLEDELVHEKEKYK 268

Sequence Alignment: 28. Allergen Name: Hom a 1.0102 Sequence ID: AAC48288

 Score = 50.6 bits 194,  Expect = 2e-07
 Identities = 59/255 23%, Positives = 126/255 49%, Gaps = 10/255 3%
Query  213  KEVHEYKISLDNANHLKGQIAQQLEDTRHRLEDEERKRSSLENHAHTLEVELESLKVQLE 272
            K+++  K+  DNA      + QQ ++   R E  E +  +L+   + LE +L+ ++  L 
Sbjct  6    KKMQAMKLEKDNAMDRADTLEQQNKEANIRAEKSEEEVHNLQKRMQQLENDLDQVQESLL 65
Query  273  EESEARLELERQLTKANGDAASWKSKYEAELQAHVDEVEELRRKMAQKISEYGEQLEALL 332
            + +    E ++ L+ A G+ A+   + +  L+  ++  EE       K++E  +  +   
Sbjct  66   KANTQLEEKDKALSNAEGEVAALNRRIQL-LEEDLERSEERLNTATTKLAEASQAADESE 124
Query  333  NKCSALEKQKARLQSEVEVLIMDLEKATAHAQALEKRVSQLEK----INLDLKSKLEEV- 387
                 LE +    +  ++ L   L++A   A+  +++  ++ +    +  DL+   E   
Sbjct  125  RMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAE 184
Query  388  ---SMLLEQTQKDLRVKIADLQKLQHEYEKLRDQKEALARENKKLADDLAEAKSQLNDAH 444
               S ++E  +++LRV   +L+ L+   EK   ++EA   + K LA+ L  A+++   A 
Sbjct  185  TGESKIVE-LEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAEFAE 243
Query  445  RRIHEQEIEIKRLENEREELAAAYK 469
            R +++ + E+ RLE+E       YK
Sbjct  244  RSVQKLQKEVDRLEDELVNEKEKYK 268

Sequence Alignment: 29. Allergen Name: Tyr p 10.0101 Sequence ID: AAT40866

 Score = 50.4 bits 193,  Expect = 3e-07
 Identities = 66/267 24%, Positives = 136/267 50%, Gaps = 21/267 7%
Query  86   EMNKKRDSELAKLRKLLEDVHMESEETAHHLRQKHQAAIQEMQDQLDQVQKAKNKSDKEK 145
            E N    +E+A+ +    D +++SE+T   +R   Q  IQ+++++LDQVQ+   ++  + 
Sbjct  15   EDNAIDRAEIAEQKA--RDANLKSEKTEEEVRAL-QKKIQQIENELDQVQENLTQATTKL 71
Query  146  QKFQAEVFELLAQVETANKDKLVAQKTVEKLEYTVHELNIKIEEINRTVVEVTAHRQRLS 205
            ++ +  +    A V   N+   + ++ +E+ E  +     K+EE         +H    S
Sbjct  72   EEKEKALQTAEADVAALNRRIQLIEEDLERSEERLKVATAKLEE--------ASH----S 119
Query  206  QENSELIKEVHEYKISLDNANHLKGQIAQQLEDTRHRLEDEERKRSSLENHAHTLEVELE 265
             + SE ++++ E++ S+ +   + G +  QL++ R   ED +RK   +      +E +LE
Sbjct  120  ADESERMRKMLEHR-SITDEERMDG-LESQLKEARLMAEDADRKYDEVARKLAMVEADLE 177
Query  266  SLKVQLEEESEARLELERQLTKANGDAASWKSKYEAELQAHVDEVEELRRKMAQKISEYG 325
              + + E      +ELE +L     +  S +   E + Q   +  E+  R M  K+ E  
Sbjct  178  RAEERAETGESKIVELEEELRVVGNNLKSLEVS-EEKAQQREEAYEQQIRIMTSKLKEAE 236
Query  326  EQLEALLNKCSALEKQKARLQSEVEVLIMDLEKATAHAQALEKRVSQL 373
             + E        L+K+  RL+ E   L+ + EK  + +  L++  ++L
Sbjct  237  ARAEFAERSVQKLQKEVDRLEDE---LVHEKEKYESISDELDQTFAEL 281

Sequence Alignment: 30. Allergen Name: Mac r 1.0101 Sequence ID: D3XNR9

 Score = 50.1 bits 192,  Expect = 3e-07
 Identities = 59/255 23%, Positives = 128/255 50%, Gaps = 10/255 3%
Query  213  KEVHEYKISLDNANHLKGQIAQQLEDTRHRLEDEERKRSSLENHAHTLEVELESLKVQLE 272
            K+++  K+  DNA      + QQ ++  +R E  E +  +L+   + LE +L+S++  L 
Sbjct  6    KKMQAMKLEKDNAMDRADTLEQQNKEANNRAEKSEEEVHNLQKRMQQLENDLDSVQEALL 65
Query  273  EESEARLELERQLTKANGDAASWKSKYEAELQAHVDEVEELRRKMAQKISEYGEQLEALL 332
            + ++   E ++ L+ A G+ A+   + +  L+  ++  EE       K++E  +  +   
Sbjct  66   KANQHLEEKDKALSNAEGEVAALNRRIQL-LEEDLERSEERLNTATTKLAEASQAADESE 124
Query  333  NKCSALEKQKARLQSEVEVLIMDLEKATAHAQALEKRVSQLEK----INLDLKSKLEEV- 387
                 LE +    +  ++ L   L++A   A+  +++  ++ +    +  DL+   E   
Sbjct  125  RMRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAE 184
Query  388  ---SMLLEQTQKDLRVKIADLQKLQHEYEKLRDQKEALARENKKLADDLAEAKSQLNDAH 444
               S ++E  +++LRV   +L+ L+   EK   ++EA   + K L + L  A+++   A 
Sbjct  185  TGESKIVE-LEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAE 243
Query  445  RRIHEQEIEIKRLENEREELAAAYK 469
            R +++ + E+ RLE+E       YK
Sbjct  244  RSVQKLQKEVDRLEDELVNEKEKYK 268

Sequence Alignment: 31. Allergen Name: Hel as 1 Sequence ID: CAB38044

 Score = 49.5 bits 189,  Expect = 5e-07
 Identities = 75/252 29%, Positives = 143/252 56%, Gaps = 42/252 16%
Query  271  LEEESEARLELERQLTKANGDAASWKSKYEAEL---QAHVDEVEELRRKMAQKISEYGEQ 327
            ++ E E  L+   Q+ +   D    K+K E +L   Q     +E     + +++ +   +
Sbjct  11   MKMEKENALDRAEQVEQKLRDCECNKNKVEEDLNNLQKKFAILENDFDSINEQLLDANTK 70
Query  328  LEALLNKCSALEKQKARLQSEVEVLIMDLEKATAHAQALEKRVSQLEKINLDLKSKLEEV 387
            LEA   K + +E + A LQ  +++L  DLE++       E+R+    +       KLEE 
Sbjct  71   LEASEKKNAEIESETAGLQRRIQLLEEDLERS-------EERLQSATE-------KLEEA 116
Query  388  SMLLEQTQKDLRVKIADLQKLQHEYEKLRDQKEALARENKKLADDLAEAKSQLNDAHRRI 447
            S   +++++    K+ + + L  + E+L D  EA  +E K +A+D   A+ ++++A R++
Sbjct  117  SKAADESERGR--KVLESRSLADD-ERL-DGLEAQLKEAKYIAED---AERKFDEAARKL 169
Query  448  HEQEIEIKRLENEREELAAAYKEAETLRKQEEAKNQRLTAELAQTRHDYEKRLAQKEEEI 507
               E++++R E     L AA  EA+ L  +EE K   +     ++    E+  +Q+E+  
Sbjct  170  AITEVDLERAEA---RLEAA--EAKILELEEELK---VVGNNMKSLEISEQEASQREDSY 221
Query  508  EALRKQYQIEIEQLNMRLAEAE---AKLKTEVARL-------KKKYQAQITELE 551
            E   +     ++    R +EAE   +KL+ EV RL       K++Y+A   EL+
Sbjct  222  EETIRDLTQRLKDAENRASEAERTVSKLQKEVDRLEDELLAEKERYKATSDELD 275

Sequence Alignment: 32. Allergen Name: Pan s 1 Sequence ID: O61379

 Score = 48.8 bits 186,  Expect = 8e-07
 Identities = 57/249 22%, Positives = 122/249 48%, Gaps = 10/249 4%
Query  219  KISLDNANHLKGQIAQQLEDTRHRLEDEERKRSSLENHAHTLEVELESLKVQLEEESEAR 278
            K+  DNA      + QQ ++   R E  E +  +L+   + LE +L+ ++  L + +   
Sbjct  2    KLEKDNAMDRADTLEQQNKEANIRAEKAEEEVHNLQKRMQQLENDLDQVQESLLKANTQL 61
Query  279  LELERQLTKANGDAASWKSKYEAELQAHVDEVEELRRKMAQKISEYGEQLEALLNKCSAL 338
             E ++ L+ A G+ A+   + +  L+  ++  EE       K++E  +  +        L
Sbjct  62   EEKDKALSNAEGEVAALNRRIQL-LEEDLERSEERLNTATTKLAEASQAADESERMRKVL 120
Query  339  EKQKARLQSEVEVLIMDLEKATAHAQALEKRVSQLEK----INLDLKSKLEEVSMLLE-- 392
            E +    +  ++ L   L++A   A+  +++  ++ +    +  DL+ + EE +   E  
Sbjct  121  ENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLE-RAEERAETGESK 179
Query  393  --QTQKDLRVKIADLQKLQHEYEKLRDQKEALARENKKLADDLAEAKSQLNDAHRRIHEQ 450
              + +++LRV   +L+ L+   EK   ++EA   + K L + L  A+++   A R +++ 
Sbjct  180  FVELEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERSVQKL 239
Query  451  EIEIKRLENEREELAAAYK 469
            + E+ RLE+E       YK
Sbjct  240  QKEVDRLEDELVNEKEKYK 258

Sequence Alignment: 33. Allergen Name: Pan h 4.0201 Sequence ID: XP_026775428

 Score = 48.8 bits 186,  Expect = 8e-07
 Identities = 70/271 25%, Positives = 142/271 52%, Gaps = 32/271 11%
Query  116  LRQKHQAAIQEMQDQLDQVQKAKNKSDKEKQKFQAEVFELLAQVETANKDKLVAQKTVEK 175
            +++K Q    + ++ LD+ ++A  +SDK+  + +++      Q+E    D LVA +  +K
Sbjct  4    IKKKMQMLKLDKENALDRAEQA--ESDKKAAEDRSK------QLE----DDLVALQ--KK 49
Query  176  LEYTVHELNIKIEEINRTVVEVTAHRQRLSQENSE---LIKEVHEYKISLDNANHLKGQI 232
            L+ T  EL+   E +     ++    ++ +   ++   L + ++  +  LD A       
Sbjct  50   LKGTEDELDKYSEALKDAQEKLELSEKKAADAEADVASLNRRIQLVEEELDRAQERLATA 109
Query  233  AQQLEDTRHRLEDEERKRSSLENHAHTLEVELESLKVQLEEESEARLELERQLTKANGDA 292
             Q+LE+     ++ ER    +EN A   E ++E  ++QL+E      E +R+      + 
Sbjct  110  LQKLEEAEKAADESERGMKVIENRALKDEEKMEIQEIQLKEAKHIAEEADRKYE----EV 165
Query  293  ASWKSKYEAELQAHVDEVEELRRKMAQKISEYGEQLEALLNKCSALEKQ-------KARL 345
            A      E EL+   +E  EL      K +E  E+L+ + N   +LE Q       + + 
Sbjct  166  ARKLVIVEGELE-RTEERAELSEG---KCAELEEELKTVTNTLKSLEAQAEKYSQKEDKY 221
Query  346  QSEVEVLIMDLEKATAHAQALEKRVSQLEKINLDLKSKLEEVSMLLEQTQKDLRVKIADL 405
            + E++VL   L++A   A+  E+ V++LEK   DL+ +L    +  +   ++L   + D+
Sbjct  222  EEEIKVLTDKLKEAETRAEFAERTVAKLEKTIDDLEDELYSQKLKYKAISEELDHALNDM 281
Query  406  QKL 408
              +
Sbjct  282  TSI 284

Sequence Alignment: 34. Allergen Name: Aed a 10.0101 Sequence ID: Q17H75

 Score = 47.9 bits 182,  Expect = 2e-06
 Identities = 72/252 28%, Positives = 137/252 54%, Gaps = 33/252 13%
Query  539  LKKKYQAQITELELSLDAANKANIDLQKTIKKQALQITGLQAHYDEVHRQLQQAVDQLGV 598
            +KKK QA   E + +LD A    +  ++  +   L+    +    ++++++Q   + L  
Sbjct  4    IKKKMQAMKLEKDNALDRA----LLCEQQARDANLRAEKAEEEARQLQKKIQAIENDLDQ 59
Query  599  TQRRCQALTAELEEMRVNLEQALRAKRAAE---QMHEEAVVRVNELTTINVNLASAKSKL 655
            TQ    A+ A+LEE    L+ A     A     Q+ EE + R  E       LASA +KL
Sbjct  60   TQEALMAVNAKLEEKEKALQNAESEVAALNRRIQLLEEDLERSEE------RLASATAKL 113
Query  656  ETEFSALQNDYDEVHKELR---ISDE-RVQKLTIEVKSTKDLLESETERVTKLETIKKSL 711
             +E SA  ++ +   K L    ++DE R+  L  ++K  + ++  E ++  K + + + L
Sbjct  114  -SEASAAADESERARKVLENRALADEERMDALENQLKEAR-FMAEEADK--KYDEVARKL 169
Query  712  ETEVRNLQIRIEEVEANALAGGKRVIAKLESRIRDV-----EIEVEEER--RRHAETEKM 764
                  ++  +E  E  A AG  +++ +LE  +R V      +EV EE+  +R  E +  
Sbjct  170  AM----VEADLERAEERAEAGEGKIV-ELEEELRVVGNNLKSLEVSEEKANQREEEYKNQ 224
Query  765  LRKKDHRVKELLLQNEEDHKQIQLLQEMSDKLNEKVKVYKRQMQE 809
            ++    R+KE   + E   + +Q LQ+  D+L +++ + K + +E
Sbjct  225  IKTLTTRLKEAEARAEFAERSVQKLQKEVDRLEDELVMEKEKYRE 269

Sequence Alignment: 35. Allergen Name: Cra g 1 Sequence ID: AAK96889

 Score = 45.5 bits 171,  Expect = 7e-06
 Identities = 55/221 24%, Positives = 104/221 47%, Gaps = 14/221 6%
Query  142  DKEKQKFQAEVFELLAQVETANKDKLVAQKTVEKLEYTVHELNIKIEEINRTVVEVTAHR 201
            D   +K+Q    E   ++E A K    A++ ++ L   ++ L   +E     +   T   
Sbjct  7    DTVNEKYQ----ECQTKMEEAEKTASEAEQEIQSLNRRIQLLEEDMERSEERLQTATEKL 62
Query  202  QRLSQ--ENSELIKEVHEYKISLDNANHLKGQI-AQQLEDTRHRLEDEERKRSSLENHAH 258
            +  S+  + SE  ++V E   +L+NA+  +  +  +QL + +   E+ ++K         
Sbjct  63   EEASKAADESERNRKVLE---NLNNASEERTDVLEKQLTEAKLIAEEADKKYDEAARKLA 119
Query  259  TLEVELESLKVQLEEESEARLELERQLTKANGDAASWKSKYEAELQAHVDEVEELRRKMA 318
              EV+LE  + +LE      LELE +L K  G+        E E     D  EE  R + 
Sbjct  120  ITEVDLERAEARLEAAEAKVLELEEEL-KVVGNNMKSLEISEQEASQREDSYEETIRDLT 178
Query  319  QKISEYGEQLEALLNKCSALEKQKARLQSEVEVLIMDLEKATAHAQALEKRVSQL 373
            Q++ +   +        S L+K+  RL+ E   L+ + E+  A +  L++  ++L
Sbjct  179  QRLKDAENRATEAERTVSKLQKEVDRLEDE---LLAEKERYKAISDELDQTFAEL 230

Sequence Alignment: 36. Allergen Name: Ani s 3 Sequence ID: Q9NAS5

 Score = 44.2 bits 166,  Expect = 2e-05
 Identities = 65/269 24%, Positives = 128/269 47%, Gaps = 23/269 8%
Query  116  LRQKHQAAIQEMQDQLDQVQKAKNKSDKEKQKFQAEVFELLAQVETANKDKLVAQKTVEK 175
            +++K QA   E  + LD+   A+ K  +   K++     +  ++    K  +  +  ++K
Sbjct  4    IKKKMQAMKIEKDNALDRADAAEEKVRQMTDKLE----RIEEELRDTQKKMMQTENDLDK 59
Query  176  LEYTVHELNIKIEEINRTVVEVTAHRQRLSQENSELIKEVH--EYKISLDNANHLKGQIA 233
             +  +   N  +EE  + V E  A    L++  + L +E+   E ++ L  A        
Sbjct  60   AQEDLSTANSNLEEKEKKVQEAEAEVAALNRRMTLLEEELERAEERLKLATA-------- 111
Query  234  QQLEDTRHRLEDEERKRSSLENH-------AHTLEVELESLKVQLEEESEARLELERQLT 286
             +LE+  H  ++ ER R  +EN        A+T+E +L+  ++  EE      E+ R+LT
Sbjct  112  -KLEEATHTADESERVRKVMENRSFQDEERANTVESQLKEAQMLAEEADRKYDEVARKLT 170
Query  287  KANGDAASWKSKYEAELQAHVDEVEELRRKMAQKISEYGEQLEALLNKCSALEKQKARLQ 346
                D    + + E   +  + E+EE  R +   +       E  L +  + E+Q   + 
Sbjct  171  MVEADLERAEERAETG-ENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVS 229
Query  347  SEVEVLIMDLEKATAHAQALEKRVSQLEKINLDLKSKLEEVSMLLEQTQKDL 398
            + ++      E A    Q L+K V +LE   +  K + + +S  L+QT ++L
Sbjct  230  ARLKEAETRAEFAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQTFQEL 281

Sequence Alignment: 37. Allergen Name: Mim n 1 Sequence ID: AAG08989

 Score = 44.0 bits 165,  Expect = 2e-05
 Identities = 56/240 23%, Positives = 127/240 52%, Gaps = 22/240 9%
Query  213  KEVHEYKISLDNANHLKGQIAQQLEDT---RHRLEDE----ERKRSSLENHAHTLEVELE 265
            K+++  K+  +NA  L  Q+ Q+L+DT   + +LE+E    ++K ++ EN+  T+  +L+
Sbjct  6    KKMQAMKVDRENAQDLAEQMEQKLKDTETAKAKLEEEFNELQKKLTATENNYDTVNEQLQ 65
Query  266  SLKVQLEEESEARLELERQLTKANGDAASWKSKYEAELQAHVDEVEELRRKMAQKISEYG 325
                +LE         E+Q+T+   D    + +    L+   +  EE      +K+ E  
Sbjct  66   EANTKLENS-------EKQITQLESDVGGLQRRLTL-LEEDYERSEEKLNSTTEKLEEAS 117
Query  326  EQLEALLNKCSALEKQKARLQSEVEVLIMDLEKATAHA----QALEKRVSQLEKINLDLK 381
            +  +        LE +    +  ++ L   LE A   A    + +++   +L    +DL+
Sbjct  118  KAADESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLE 177
Query  382  ---SKLEEVSMLLEQTQKDLRVKIADLQKLQHEYEKLRDQKEALARENKKLADDLAEAKS 438
               ++LE     + + +++L V  A+++ LQ + ++   ++++     + L   L +A++
Sbjct  178  RAETRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAEN 237
Query  439  QLNDAHRRIHEQEIEIKRLENE 460
            +  +A R++ + + E+ RLE+E
Sbjct  238  RATEAERQVVKLQKEVDRLEDE 259

Sequence Alignment: 38. Allergen Name: Asc l 3.0101 Sequence ID: ACN32322

 Score = 44.0 bits 165,  Expect = 2e-05
 Identities = 65/263 24%, Positives = 133/263 50%, Gaps = 30/263 11%
Query  405  LQKLQHEYEKLRDQKEALARENKKLADDLAEAKSQLNDAHRRIHEQEIEIKRLENEREEL 464
            +Q ++ E +   D+ +A   + +++ D L   + +L D ++++ + E +   L+  +E+L
Sbjct  8    MQAMKIEKDNALDRADAAEEKVRQMTDKLERIEEELRDTQKKMMQTEND---LDKAQEDL 64
Query  465  AAAYKEAETLRKQEEAKNQRLTAELAQTRHDYEKRLAQKEEEIEALRKQYQIEIEQLNMR 524
            + A    E    ++E K Q   AE+A       +R+   EEE+E   ++ ++  E+L   
Sbjct  65   SVANSNLE----EKEKKVQEAEAEVAAL----NRRMTLLEEELERAEERLKLATEKL--- 113
Query  525  LAEAEAKLKTEVARLKKKYQAQITELELSLDAANKANIDLQKTIKKQALQITGLQAHYDE 584
              E       E  R++K  + +      S+    +AN  ++  +K+  +        YDE
Sbjct  114  --EEATHTADESERVRKVMENR------SFQDEERANT-VESQLKEAQMLAEEADRKYDE 164
Query  585  VHRQLQQAVDQLGVTQRRCQALTAELEEMRVNLEQALRAKRAAEQMHEEAVVRVN----E 640
            V R+L      L   + R +A   ++ E+   L       ++ E   E+A+ R +    +
Sbjct  165  VARKLAMVEADLERAEERAEAGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQ 224
Query  641  LTTINVNLASAKSKLE-TEFSA--LQNDYDEVHKELRISDERVQKLTIEVKST 690
            + T++  L  A+++ E  E S   LQ + D +  EL    ER + ++ E+  T
Sbjct  225  IRTVSARLKEAETRAEFAERSVQKLQKEVDRLEDELVHEKERYKSISEELDQT 277

Sequence Alignment: 39. Allergen Name: Aed a 10.0201 Sequence ID: Q17H80

 Score = 43.8 bits 164,  Expect = 3e-05
 Identities = 71/256 27%, Positives = 131/256 51%, Gaps = 26/256 10%
Query  279  LELERQLTKANGDAASWKSKYEAELQAH--VDEVEELRRKMAQKISEYGEQLEALLNKCS 336
            ++LE+       D    ++K EA L+A   ++EV EL +++ Q ++E  E+++  L + +
Sbjct  11   MKLEKDNAADKADTCENQAK-EANLRADKIMEEVAELTKRLTQ-VTEDHEKFKNTLEQAN 68
Query  337  ALEKQKARLQSEVEVLIMDLEKATAHAQALEKRVSQLEKINLDLKSKLEEVSMLLEQTQK 396
               ++K +L +  E  +  L   T   Q +E+ + + E+ +    SKL E +   ++  +
Sbjct  69   KDLEEKEKLLTSTEANVAAL---TRKVQQVEEDLEKSEERSGAALSKLLEATQSADENNR 125
Query  397  DLRVKIADLQKLQHEYEKLRDQ-KEA--LARENKKLADD----LAEAKSQLNDAHRRIHE 449
              +V     Q+ +   ++L +Q KEA  LA +    +D+    LA  + +L  A  R+  
Sbjct  126  MCKVLENRSQQDEERMDQLSNQLKEARMLAEDADGKSDEVSRKLAFVEDELEVAEDRVKS 185
Query  450  QEIEIKRLENEREELAAAYKEAETLRKQEEAKNQRLTAELAQTRHDYEKRLAQKEEEIEA 509
             E +I  LE   EEL       ++L   E+  NQR+     Q      K L  K +E E 
Sbjct  186  GEAKIMELE---EELKVVGNSLKSLEVSEDKANQRVEEFKRQL-----KSLTIKLKEAET 237
Query  510  LRKQYQIEIEQLNMRLAEAEAKLKTEVARLKKKYQAQITELE 551
              +  +  +++L   +   E KL  E    K KY+A   +L+
Sbjct  238  RAENAEKNVKKLQKEVDRLEDKLMNE----KDKYKAICDDLD 275

Sequence Alignment: 40. Allergen Name: Sal s 4.0101 Sequence ID: NP_001117128

 Score = 43.3 bits 162,  Expect = 4e-05
 Identities = 67/269 24%, Positives = 141/269 52%, Gaps = 36/269 13%
Query  116  LRQKHQAAIQEMQDQLDQVQKA----KNKSDKEKQKFQAEVFELLAQVETANKDKLVAQK 171
            +++K Q    + ++ LD+ + A    K   DK KQ ++ ++  L  +++   +D+L    
Sbjct  4    IKKKMQMLKLDKENALDRAEGAEGDKKAAEDKSKQ-LEDDLVALQKKLK-GTEDEL---- 57
Query  172  TVEKLEYTVHELNIKIEEINRTVVEVTAHRQRLSQENSELIKEVHEYKISLDNANHLKGQ 231
              +K   ++ +   K+E   +T  +  A    L++     I+ V E    LD A      
Sbjct  58   --DKYSESLKDAQEKLEVAEKTATDAEADVASLNRR----IQLVEE---ELDRAQERLAT 108
Query  232  IAQQLEDTRHRLEDEERKRSSLENHAHTLEVELESLKVQLEEESEARLELERQLTKANGD 291
               +LE+     ++ ER    +EN A   E ++E   +QL+E      E +R+  +    
Sbjct  109  ALTKLEEAEKAADESERGMKVIENRASKDEEKMELQDIQLKEAKHIAEEADRKYEEV--- 165
Query  292  AASWKSKYEAELQAHVDEVEELRRKMAQ-KISEYGEQLEALLNKCSALEKQ-------KA 343
                 ++    +++ ++  EE R ++++ K SE  E+L+ + N   +LE Q       + 
Sbjct  166  -----ARKLVIIESDLERTEE-RAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSQKED 219
Query  344  RLQSEVEVLIMDLEKATAHAQALEKRVSQLEKINLDLKSKLEEVSMLLEQTQKDLRVKIA 403
            + + E++VL   L++A   A+  E+ V++LEK   DL+ +L    +  +   ++L   + 
Sbjct  220  KYEEEIKVLTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDNALN 279
Query  404  DLQKL 408
            D+  +
Sbjct  280  DMTSI 284

Sequence Alignment: 41. Allergen Name: Sac g 1.0101 Sequence ID: AVD53650

 Score = 42.6 bits 159,  Expect = 6e-05
 Identities = 68/269 25%, Positives = 142/269 52%, Gaps = 35/269 13%
Query  497  EKRLAQKEEEIEALRKQYQIEIEQLNMRLAEAEAKLKTEVARLKKKYQAQITELELSLDA 556
            +K +A K E+  A  +  Q+E +QL     E +AK++ ++  L+KK+    + LE  +D 
Sbjct  6    KKMIAMKMEKENAQDRAEQLE-QQLR-DTEEQKAKIEEDLTTLQKKH----SNLENEFDI 59
Query  557  ANKANIDLQKTIKKQALQITGLQAHYDEVHRQLQQAVDQLGVTQRRCQALTAELEEMRVN 616
             N+   D Q   ++   + +  +     ++R++Q   + +  ++ R Q  T +LEE    
Sbjct  60   VNEKYQDCQAKYEEAEKKASESEQEIQSLNRRIQLLEEDMERSEERLQTATEKLEEASKA 119
Query  617  LEQALRAKRAAEQMHEEAVVRVNELTTINVNLASAKSKLETEFSALQND--YDEVHKELR 674
             +++ R ++  E ++  +  R + L          K   E ++ A + D  YDE  ++L 
Sbjct  120  ADESERNRKVLENLNNASEERTDVLE---------KQLTEAKLIAEEADKKYDEAARKLA 170
Query  675  ISDERVQKLTIEVKSTKDLLESETERVTKLETIKKSLETEVRNLQIRIEEVEANALAGGK 734
            I++       ++++  +  LE+   +V  LE     +   ++ LQ++ ++  +      +
Sbjct  171  ITE-------VDLERAEARLEAAEAKVIDLEEQLSVVGNNIKTLQVQNDQA-SQREDSYE 222
Query  735  RVIAKLESRIRDVEIEVEEERRRHAETEKMLRKKDHRVKELLLQNEEDHKQIQLLQEMSD 794
              I  L  R++D E    E  R    T   L+K+  R+++ LL  +E +K I      SD
Sbjct  223  ETIRDLTQRLKDAENRATEAER----TVSKLQKEVDRLEDELLAEKERYKAI------SD 272
Query  795  KLNE 798
            +L++
Sbjct  273  ELDQ 276

Sequence Alignment: 42. Allergen Name: Hom s 5 Sequence ID: P02538

 Score = 43.3 bits 163,  Expect = 7e-05
 Identities = 88/357 24%, Positives = 167/357 46%, Gaps = 34/357 9%
Query  180  VHELNIKIEEINRTVVEVTAHRQRLSQENSELIKEVHEYKIS-LDNANHLKGQIAQQLED 238
            ++E+ +    +    +++    QR+  E  E IK ++    S +D    L+ Q   ++ +
Sbjct  135  IQEVTVNQSLLTPLNLQIDPTIQRVRAEEREQIKTLNNKFASFIDKVRFLEQQ--NKVLE 192
Query  239  TRHRLEDEERKRSSLENHAHTLEVELESLKVQLEEESEARLELERQLTKANGDAASWKSK 298
            T+  L  E+  ++  +N    +E  + +L+ QL+     R  L+ +L         +K+K
Sbjct  193  TKWTLLQEQGTKTVRQNLEPLFEQYINNLRRQLDSIVGERGRLDSELRGMQDLVEDFKNK 252
Query  299  YEAELQAHVDEVEELRRKMAQKISEYGEQLEALLNKCSALEKQKARLQSEVEVLIMDLEK 358
            YE E+        E+        + Y  ++E L  K   L  +   L++  +    +L +
Sbjct  253  YEDEINKRTAAENEFVTLKKDVDAAYMNKVE-LQAKADTLTDEINFLRALYDA---ELSQ 308
Query  359  ATAHAQALEKRVSQLEKINLDLKSKLEEVSMLLEQTQKDLRVKIADLQKLQHEYEKLRDQ 418
               H       +S     NLDL S + EV    E+  +  R +       Q +YE+L  Q
Sbjct  309  MQTHISDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIAQRSRAEAESWY--QTKYEEL--Q 364
Query  419  KEALARENKKLADDLAEAKSQLNDAHRRIHEQEIEIKRLENEREELAAAYKEAETLRKQE 478
              A      +  DDL   K ++ + +R I+    EI  ++ +   L AA  +AE  R + 
Sbjct  365  VTA-----GRHGDDLRNTKQEIAEINRMIQRLRSEIDHVKKQCANLQAAIADAEQ-RGEM 418
Query  479  EAKNQRLTAELAQTRHDYEKRLAQKEEEIEALRKQYQIEIEQLNMRLAEAEAKLKTEVAR 538
              K+ +   E        E  L + ++++  L K+YQ   E +N++LA     L  E+A 
Sbjct  419  ALKDAKNKLE------GLEDALQKAKQDLARLLKEYQ---ELMNVKLA-----LDVEIAT 464
Query  539  LKKKYQAQITELELSLDAANKANIDL-QKTI 568
             +K  + +  E  L+ +   + NI + Q T+
Sbjct  465  YRKLLEGE--ECRLNGEGVGQVNISVVQSTV 493

Sequence Alignment: 43. Allergen Name: Chi k 10 Sequence ID: CAA09938

 Score = 42.2 bits 157,  Expect = 8e-05
 Identities = 71/257 27%, Positives = 128/257 49%, Gaps = 26/257 10%
Query  413  EKLRDQKEALARENKKLADDLAEAKSQLNDAHRRIHEQEIEIKRLENEREELAAAYKEAE 472
            + ++ + +A+  E     D     ++Q  DA+ R  + E E + L+   +++     + +
Sbjct  2    DAIKKKMQAMKLEKDNALDRALLCENQARDANLRAEKAEEEARTLQ---KKIQTIENDLD 58
Query  473  TLRKQEEAKNQRLTAELAQTRHDYEKRLAQKEEEIEALRKQYQIEIEQLNM---RLAEAE 529
              + QE   N +L  +        EK L   E E+ AL ++ Q+  E L+    RLA A 
Sbjct  59   QTQGQETLVNGKLEGK--------EKALQNAESEVAALNRRIQLLGEDLDRSEERLASAT 110
Query  530  AKLKTEVARLKKKYQAQITELELSLDAANKANID-LQKTIKKQALQITGLQAHYDEVHRQ 588
            AKL    A   +  +A+      SL  A++  +D L+  +K+  +        YDEV R+
Sbjct  111  AKLSEASAAADESERARKILENRSL--ADEERMDALENQLKEARFLAEEADKKYDEVARK 168
Query  589  LQQAVDQLGVTQRRCQALTAEL----EEMRV---NLEQALRAKRAAEQMHEEAVVRVNEL 641
            L      L   + R +A  A++    EE+RV   NL+    ++  A Q  EE   ++  L
Sbjct  169  LAMVEADLERAEERAEAGEAKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTL 228
Query  642  TTINVNLASAKSKL-ETEFSALQNDYDEVHKELRISDERVQKL 683
            TT  +  A A++++ E     LQ + D +  EL    E+ +++
Sbjct  229  TT-RLKEAEARAEFAERSVQKLQKEVDRLEDELVSEKEKYREI 270

Sequence Alignment: 44. Allergen Name: Lep s 1 Sequence ID: CAC84590

 Score = 41.3 bits 153,  Expect = 0.0002
 Identities = 73/267 27%, Positives = 134/267 50%, Gaps = 34/267 12%
Query  326  EQLEAL-LNKCSALEKQKARLQSEVEVLIMDLEKATAHAQALEKRVSQLEKINLDLKSKL 384
            ++++A+ L K +A++K  A L+++        +K     Q L+K+ SQ+E      K  L
Sbjct  6    KKMQAMKLEKDNAMDKADA-LEAQARDANRKADKILEEVQDLKKKPSQVETDFTTTKENL 64
Query  385  EEVSMLLEQTQKDL---RVKIADL-QKLQHEYEKLRDQKEALARENKKLADDLAEAKSQL 440
               +  LE  +K L     ++A L +K+Q   E L   +E L     KL     EA    
Sbjct  65   ATANKNLEDKEKTLTNTESEVASLNRKVQMIEENLERSEERLGTALTKLG----EASHAA 120
Query  441  NDAHRRIHEQEIEIKRLENEREELAAAYKEAETLRKQEEAKNQRLTAELAQTRHDYE--- 497
            ++A R     E   ++ E   ++L    KEA  L +  + K+  ++ ++AQ   D E   
Sbjct  121  DEASRMCKVLENRSQQDEERMDQLTNQLKEARMLAEDADGKSDEVSRKMAQVEDDLEVAE 180
Query  498  KRLAQKEEEIEALRKQYQIEIEQL-NMRLAEAEAKLKTEVARLKKKYQAQITELELSLDA 556
             R+   + +I  L ++ ++    L ++ ++E +A  + E      +Y+ QI  L + L  
Sbjct  181  DRVKSGDSKIMELEEELKVVGNSLKSLEVSEEKANQRVE------EYKRQIKTLTVKLKE 234
Query  557  ANKANIDLQKTIKKQALQITGLQAHYDEVHRQLQQAVDQLGVTQRRCQALTAELEEMRVN 616
            A       +K +KK       LQ   D +        D+LG+ + R +AL  E+++    
Sbjct  235  AEARAEYAEKYVKK-------LQKEVDRLE-------DELGINKDRYRALADEMDQTFAE 280
Query  617  L 617
            L
Sbjct  281  L 281

Sequence Alignment: 45. Allergen Name: Copt f 7.0101 Sequence ID: AGM32377.1

 Score = 41.1 bits 152,  Expect = 0.0002
 Identities = 69/222 31%, Positives = 127/222 57%, Gaps = 39/222 17%
Query  310  VEELRRKM-AQKISEYGEQLEALLNKCSALEKQKARLQSEVEVLIMDLEKATAHAQALEK 368
            ++ +++KM A K+ +      ALL  C    +Q+AR  +      +  EKA   A++L+K
Sbjct  1    MDAIKKKMQAMKLEKDNTMDRALL--C----EQQARDAN------LRAEKAEEEARSLQK 48
Query  369  RVSQLEKINLDLK-SKLEEVSMLLEQTQKDLRVKIADLQKLQHEYEKLRDQKEALARENK 427
            ++ Q+E  +LD    +L +V+  L++  K L+   +++  L    + L   +E L R  +
Sbjct  49   KIQQIEN-DLDQTMEQLMQVNAKLDEKDKALQNAESEVAALNRRIQLL---EEDLERSEE 104
Query  428  KLAD---DLAEAKSQLNDAHRRIHEQEIEIKRLENER--EELAAAYKEAETLRKQEEAKN 482
            +LA     LAEA SQ  D   R   + +E K L +E   + L    KEA  + ++ + K 
Sbjct  105  RLATATAKLAEA-SQAADESERAR-KILESKGLADEERMDALENQLKEARFMAEEADKKY 162
Query  483  QRLTAELAQTRHDYEK----------RLAQKEEEIEALR---KQYQIEIEQLNMRLAEAE 529
              +  +LA    D E+          ++ + EEE+  +    K  ++  E+ N+R  E +
Sbjct  163  DEVARKLAMVEADLERAEERAESGESKIVELEEELRVVGNNLKSLEVSEEKANLREEEYK 222
Query  530  AKLKTEVARLKK-KYQAQITE 549
             ++KT   RLK+ + +A+  E
Sbjct  223  QQIKTLTTRLKEAEARAEFAE 243

Sequence Alignment: 46. Allergen Name: Cha f 1 Sequence ID: Q9N2R3

 Score = 40.4 bits 149,  Expect = 0.0003
 Identities = 54/248 21%, Positives = 124/248 50%, Gaps = 6/248 2%
Query  213  KEVHEYKISLDNANHLKGQIAQQLEDTRHRLEDEERKRSSLENHAHTLEVELESLKVQLE 272
            K+++  K+  DNA      + QQ ++   R E  E +  + +   + +E EL+  + QL 
Sbjct  6    KKMQAMKLEKDNAMDRADTLEQQNKEANLRAEKTEEEIRATQKKMQQVENELDQAQEQLS 65
Query  273  EESEARLELERQLTKANGDAASWKSKY---EAELQAHVDEVEELRRKMAQ--KISEYGEQ 327
              +    E E+ L  A G+ A+   +    E +L+   + +     K+A+  + ++  E+
Sbjct  66   AANTKLDEKEKALQNAEGEVAALNRRIQLPEEDLERSEERLNTATTKLAEASQAADESER 125
Query  328  LEALL-NKCSALEKQKARLQSEVEVLIMDLEKATAHAQALEKRVSQLEKINLDLKSKLEE 386
            +  +L N+  + E++   L+++++      E+A      + ++++ +E      + + E 
Sbjct  126  MRKVLENRSLSDEERMDALENQLKEARFLAEEADRKYDEVARKLAMVEADLERAEERAES 185
Query  387  VSMLLEQTQKDLRVKIADLQKLQHEYEKLRDQKEALARENKKLADDLAEAKSQLNDAHRR 446
                + + +++LRV   +L+ L+   EK   ++E    + K LA+ L  A+++   A R 
Sbjct  186  GESKIVELEEELRVVGNNLKSLEVSEEKANQREETYKEQIKTLANKLKAAEARAEFAERS 245
Query  447  IHEQEIEIKRLENE 460
            +++ + E+ RLE+E
Sbjct  246  VQKLQKEVDRLEDE 259

Sequence Alignment: 47. Allergen Name: Per v 1 Sequence ID: AAG08988

 Score = 39.7 bits 146,  Expect = 0.0005
 Identities = 71/264 26%, Positives = 144/264 54%, Gaps = 46/264 17%
Query  162  ANKDKLVAQKTVEKLEYTVHELNIKIEEINRTVVEVTAHRQRLSQENSELIKEVHEYKIS 221
            A K K+VA K  +K     + L+ + E++ + + E    + ++  + + L+K+  + +  
Sbjct  3    AIKKKMVAMKMEKK-----NALD-RAEQLEQKLRETEEAKAKIEDDYNSLVKKNIQTEND 56
Query  222  LDNANHLKGQIAQQLEDTRHRLEDEERKRSSLENHAHTLEVELESLKVQLEEESEARLEL 281
             DN N        QL+D + + E  E++   ++ H    E E++SL  ++    E  ++ 
Sbjct  57   YDNCN-------TQLQDVQAKYERAEKQ---IQEH----EQEIQSLTRKISLLEEGIMKA 102
Query  282  ERQLTKANG--DAASWKSKYEAELQAHVDEVEELRRKMAQKISEYGEQLEALLNKCSALE 339
            E ++T A+G  + AS K+  E+E    V  +E L     ++I +  +QL          +
Sbjct  103  EERFTTASGKLEEAS-KAADESERNRKV--LENLNSGNDERIDQLEKQLTEAKWIAEEAD 159
Query  340  KQKARLQSEVEVLIMDLEKATAHAQALEKRVSQLEKINLDLKSKLEEVSMLLEQTQKDLR 399
            K+      ++ +  +DLE+A A  +A E +V  LE                 EQ    L 
Sbjct  160  KKYEEAARKLAITEVDLERAEARLEAAEAKVIDLE-----------------EQ----LT 198
Query  400  VKIADLQKLQHEYEKLRDQKEALARENKKLADDLAEAKSQLNDAHRRIHEQEIEIKRLEN 459
            V  A+++ LQ + ++   ++++     + L + L +A+++  +A R + + + E+ RLE+
Sbjct  199  VVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRATEAERTVSKLQKEVDRLED 258
Query  460  EREELAAAYK 469
            E       YK
Sbjct  259  ELLTEKEKYK 268

Sequence Alignment: 48. Allergen Name: Pon l 7.0101 Sequence ID: P05547

 Score = 37.6 bits 136,  Expect = 0.001
 Identities = 44/173 25%, Positives = 97/173 56%, Gaps = 26/173 15%
Query  54   QRVEREKSDITVQLMNLTERLEETEGSSESVTEMNKKRDSELAKLRKLLEDVHMESEETA 113
            +  ++++ DI  +   + +RLEE     +    M  +R     KLR LL       ++ A
Sbjct  8    EEAKKKQDDIDRKKAEVRKRLEEQSLKKQKKGFMTPERKK---KLRLLLR------KKAA 58
Query  114  HHLRQKHQAAIQEMQDQLDQ-VQKAKNKSDKEKQKFQA---EVFELLAQVETANKDKLVA 169
              L+++++    E +  +DQ   + KN     +++++A   E F+  AQ+E+   DK   
Sbjct  59   EELKKEQERKAGERRKIIDQRCGQPKNLDGANEEQLRAIIKEYFDHTAQIES---DKYDV 115
Query  170  QKTVEKLEYTVHELNIKIEEINRTVVEVTAHR-QRLSQENSELIKEVHEYKISLDNANHL 228
            +  + + +Y ++ELNI++ ++    ++ T  +  +   + ++L K+  E+       N+L
Sbjct  116  ELEIIRKDYEINELNIQVNDLRGKFIKPTLKKVSKYENKFAKLQKKAAEFNFR----NQL 171
Query  229  KGQIAQQLEDTRHRLEDEE 247
            K    +++E     LED++
Sbjct  172  KTVKKKEFE-----LEDDK 185

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.