The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAASEAAAAAATPVAPTEGTVIAIHSLEEWSIQIEEANSAKKLVVIDFTATWCPPCRAMA
PIFADMAKKSPNVVFLKVDVDEMKTIAEQFSVEAMPTFLFMREGDVKDRVVGAAKEELAR
KLELHMAS
Sequence Info Allergen Name Length Opt Bits Score E Value
Q4W1F7 Zea m 25.0101 128 818 197.0 1.4e-52
Q9LDX4 Tri a 25.0101 125 611 149.2 3.1e-38
AJ937744 Asp f 28.0101 108 266 69.7 2.3e-14
CAI78451 Mala s 13.0101 105 264 69.3 3e-14
CBW45298 Plo i 2.0101 106 257 67.7 9.4e-14
Q9UW02 Cop c 2 106 256 67.4 1.1e-13
AJ937745 Asp f 29.0101 110 252 66.5 2.2e-13
AAL79931 Fus c 2 121 246 65.1 6.4e-13
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Zea m 25.0101 Sequence ID: Q4W1F7

 Score = 197.0 bits 818,  Expect = 1e-52
 Identities = 128/128 100%, Positives = 128/128 100%, Gaps = 0/128 0%
Query  1    MAASEAAAAAATPVAPTEGTVIAIHSLEEWSIQIEEANSAKKLVVIDFTATWCPPCRAMA 60
            MAASEAAAAAATPVAPTEGTVIAIHSLEEWSIQIEEANSAKKLVVIDFTATWCPPCRAMA
Sbjct  1    MAASEAAAAAATPVAPTEGTVIAIHSLEEWSIQIEEANSAKKLVVIDFTATWCPPCRAMA 60
Query  61   PIFADMAKKSPNVVFLKVDVDEMKTIAEQFSVEAMPTFLFMREGDVKDRVVGAAKEELAR 120
            PIFADMAKKSPNVVFLKVDVDEMKTIAEQFSVEAMPTFLFMREGDVKDRVVGAAKEELAR
Sbjct  61   PIFADMAKKSPNVVFLKVDVDEMKTIAEQFSVEAMPTFLFMREGDVKDRVVGAAKEELAR 120
Query  121  KLELHMAS 128
            KLELHMAS
Sbjct  121  KLELHMAS 128

Sequence Alignment: 2. Allergen Name: Tri a 25.0101 Sequence ID: Q9LDX4

 Score = 149.2 bits 611,  Expect = 3e-38
 Identities = 92/122 75%, Positives = 105/122 86%, Gaps = 0/122 0%
Query  6    AAAAAATPVAPTEGTVIAIHSLEEWSIQIEEANSAKKLVVIDFTATWCPPCRAMAPIFAD 65
            A+AA AT  A   G VI++HSLE+W++QIEEAN+AKKLVVIDFTA+WC PCR MAPIFAD
Sbjct  3    ASAATATAAAVGAGEVISVHSLEQWTMQIEEANAAKKLVVIDFTASWCGPCRIMAPIFAD 62
Query  66   MAKKSPNVVFLKVDVDEMKTIAEQFSVEAMPTFLFMREGDVKDRVVGAAKEELARKLELH 125
            +AKK P  VFLKVDVDE+K+IAEQFSVEAMPTFLFM+EGDVKDRVVGA KEEL  K+ LH
Sbjct  63   LAKKFPAAVFLKVDVDELKSIAEQFSVEAMPTFLFMKEGDVKDRVVGAIKEELTNKVGLH 122
Query  126  MA 127
             A
Sbjct  123  AA 124

Sequence Alignment: 3. Allergen Name: Asp f 28.0101 Sequence ID: AJ937744

 Score = 69.7 bits 266,  Expect = 2e-14
 Identities = 42/97 43%, Positives = 70/97 72%, Gaps = 6/97 6%
Query  17   TEGTVIAIHSLEEWSIQIEEANSAKKLVVIDFTATWCPPCRAMAPIFADMAKKSPNVVFL 76
            + G VIA+ +     I I +A ++   VV+DF ATWC PCRA+AP   ++++K  NV F+
Sbjct  2    SHGKVIAVDN----PI-IYKALTSSGPVVVDFFATWCGPCRAVAPKVGELSEKYSNVRFI 56
Query  77   KVDVDEMKTIAEQFSVEAMPTFLFMREGD-VKDRVVGAAKEEL 118
            +VDVD+++++A + ++ AMPTF++ ++G  ++ RVVG    EL
Sbjct  57   QVDVDKVRSVAHEMNIRAMPTFVLYKDGQPLEKRVVGGNVREL 99

Sequence Alignment: 4. Allergen Name: Mala s 13.0101 Sequence ID: CAI78451

 Score = 69.3 bits 264,  Expect = 3e-14
 Identities = 41/94 43%, Positives = 57/94 60%, Gaps = 4/94 4%
Query  33   QIEEANSAKKLVVIDFTATWCPPCRAMAPIFADMAKKSP---NVVFLKVDVDEMKTIAEQ 89
            Q ++     K+VVIDF ATWC PC+ + P+F  ++  +P    V F KVDVDE   IA++
Sbjct  9    QFKQVTGGDKVVVIDFWATWCGPCKMIGPVFEKISD-TPAGDKVGFYKVDVDEQSQIAQE 67
Query  90   FSVEAMPTFLFMREGDVKDRVVGAAKEELARKLELHMA 127
              + AMPTF+F + G   D VVGA   +L   +  H A
Sbjct  68   VGIRAMPTFVFFKNGQKIDTVVGADPSKLQAAITQHSA 105

Sequence Alignment: 5. Allergen Name: Plo i 2.0101 Sequence ID: CBW45298

 Score = 67.7 bits 257,  Expect = 9e-14
 Identities = 40/95 42%, Positives = 65/95 68%, Gaps = 3/95 3%
Query  22   IAIHSLEEWSIQIEEANSAKKLVVIDFTATWCPPCRAMAPIFADMAKK-SPNVVFLKVDV 80
            I I  +E+ + ++ EA    KLVVIDF ATWC PC+ + P + ++A + + ++V +KVDV
Sbjct  3    IHIKDVEDLTARLTEAGD--KLVVIDFMATWCGPCKIIGPKLDEIAAEMADSIVVVKVDV 60
Query  81   DEMKTIAEQFSVEAMPTFLFMREGDVKDRVVGAAKEEL 118
            DE + IA ++S+  MPTF+F++ G   ++  GA  E+L
Sbjct  61   DECEDIATEYSINTMPTFVFVKNGKPVEQFSGANVEKL 98

Sequence Alignment: 6. Allergen Name: Cop c 2 Sequence ID: Q9UW02

 Score = 67.4 bits 256,  Expect = 1e-13
 Identities = 45/97 46%, Positives = 66/97 68%, Gaps = 9/97 9%
Query  21   VIAIHSLEEWSIQIEEANSAKKLVVIDFTATWCPPCRAMAPIFADMAKK--SPNVVFLKV 78
            V  I +L+E++   +  NS K +++IDF ATWC PCR ++PIF   ++K  + N+VF KV
Sbjct  2    VQVISNLDEFN---KLTNSGK-IIIIDFWATWCGPCRVISPIFEKFSEKYGANNIVFAKV 57
Query  79   DVDEMKTIAEQFSVEAMPTFLFMREGDVKDRVVGA---AKEELARK 121
            DVD    I+E+  + AMPTF   ++G   D +VGA   A E L +K
Sbjct  58   DVDTASDISEEAKIRAMPTFQVYKDGQKIDELVGANPTALESLVQK 103

Sequence Alignment: 7. Allergen Name: Asp f 29.0101 Sequence ID: AJ937745

 Score = 66.5 bits 252,  Expect = 2e-13
 Identities = 34/104 32%, Positives = 63/104 60%, Gaps = 2/104 1%
Query  24   IHSLEEWSIQIEEANSAKKLVVIDFTATWCPPCRAMAPIFADMA--KKSPNVVFLKVDVD 81
            +  + +  +  E+       V++D +ATWC PC+A++P+F  ++  ++  N  F ++DVD
Sbjct  5    VEKITDAKVFKEKVQEGSGPVIVDCSATWCGPCKAISPVFQRLSTSEEFKNAKFYEIDVD 64
Query  82   EMKTIAEQFSVEAMPTFLFMREGDVKDRVVGAAKEELARKLELHMA 127
            E+  +A ++ V AMPTF+F ++G   + VVGA    L   ++ H+A
Sbjct  65   ELSEVAAELGVRAMPTFMFFKDGQKVNEVVGANPPALEAAIKAHVA 110

Sequence Alignment: 8. Allergen Name: Fus c 2 Sequence ID: AAL79931

 Score = 65.1 bits 246,  Expect = 6e-13
 Identities = 39/86 45%, Positives = 64/86 74%, Gaps = 15/86 17%
Query  33   QIEEANSAKKLVVIDFTATWCPPCRAMAPIFADMAKKS--PNVV-FLKVDVDEMKTIAEQ 89
            ++++  S+   VV+DF A WCPPC+A+AP++  ++ K   P+V+ F KV+VD ++  A+Q
Sbjct  10   ELQKLLSSTTYVVVDFFADWCPPCKAIAPVYEQLSTKHSVPDVLAFAKVNVDHVQDAAQQ 69
Query  90   FSVEAMPTFLFMREGD---------VKD---RVVGAAKEEL 118
            + + AMPTF+F +EG          +K    R +GAA E+L
Sbjct  70   YGITAMPTFMFFKEGKQVAVNGQAVIKGADPRTLGAAAEKL 110

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.