The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MADAEHERIFKKFDTDGDGKISAAELEEALKKLGSVTPDDVTRMMAKIDTDGDGNISFQE
FTEFASANPGLMKDVAKVF
Sequence Info Allergen Name Length Opt Bits Score E Value
P69197 Bra r 5.0101 79 509 90.3 6.8e-21
Q39406 Bra n 2 83 395 72.1 2.1e-15
BAA09633 Bra n 2 82 393 71.8 2.6e-15
CAA73147 Bet v 4 85 385 70.5 6.4e-15
Q39419 Bet v 4 85 380 69.7 1.1e-14
O81701 Aln g 4 85 378 69.4 1.4e-14
O81092 Ole e 3 84 371 68.3 3e-14
AAL92871 Che a 3 86 369 68.0 3.8e-14
ALE34025 Sal k 7.0101 86 369 68.0 3.8e-14
P58171 Syr v 3 81 360 66.6 9.6e-14
CAP05019 Par j 4.0101 84 360 66.6 1e-13
O82040 Phl p 7 78 354 65.6 1.8e-13
P94092 Cyn d 7 80 351 65.1 2.6e-13
CAA62634 Cyn d 7 82 351 65.1 2.6e-13
AY904434 Art v 5.0101 82 329 61.6 3e-12
O64943 Jun o 4 165 218 44.0 1.2e-06
ABP87672 Cup a 4.0101 177 218 44.1 1.2e-06
Q2KN25 Amb a 10.0101 160 216 43.7 1.4e-06
AAF31152 Ole e 8 171 204 41.8 5.7e-06
Q9M7R0 Ole e 8 171 192 39.9 2.1e-05
ACL36923 Tyr p 24.0101 153 159 34.6 0.00074
QBF67841 Der f 39.0101 153 159 34.6 0.00074
D2DGW3 Tyr p 34.0101 153 159 34.6 0.00074
QXY82447 Der p 39.0101 153 159 34.6 0.00074
P43187 Bet v 3 205 153 33.7 0.0019
Q1M0Y3 Per a 6.0101 151 149 33.0 0.0022
ABB89298 Bla g 6.0301 154 144 32.2 0.0039
ADV17344 Pen m 6.0101 150 136 31.0 0.0092
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Bra r 5.0101 Sequence ID: P69197

 Score = 90.3 bits 509,  Expect = 7e-21
 Identities = 79/79 100%, Positives = 79/79 100%, Gaps = 0/79 0%
Query  1    MADAEHERIFKKFDTDGDGKISAAELEEALKKLGSVTPDDVTRMMAKIDTDGDGNISFQE 60
            MADAEHERIFKKFDTDGDGKISAAELEEALKKLGSVTPDDVTRMMAKIDTDGDGNISFQE
Sbjct  1    MADAEHERIFKKFDTDGDGKISAAELEEALKKLGSVTPDDVTRMMAKIDTDGDGNISFQE 60
Query  61   FTEFASANPGLMKDVAKVF 79
            FTEFASANPGLMKDVAKVF
Sbjct  61   FTEFASANPGLMKDVAKVF 79

Sequence Alignment: 2. Allergen Name: Bra n 2 Sequence ID: Q39406

 Score = 72.1 bits 395,  Expect = 2e-15
 Identities = 62/79 78%, Positives = 72/79 91%, Gaps = 4/79 5%
Query  1    MADA----EHERIFKKFDTDGDGKISAAELEEALKKLGSVTPDDVTRMMAKIDTDGDGNI 56
            MADA    EH+RIFKKFD +GDGKISA+EL +ALK LGSVT DD+ RMMA+IDTDGDG I
Sbjct  1    MADATEKAEHDRIFKKFDANGDGKISASELGDALKNLGSVTHDDIKRMMAEIDTDGDGYI 60
Query  57   SFQEFTEFASANPGLMKDVAKVF 79
            S+QEF++FASAN GLMKDVAK+F
Sbjct  61   SYQEFSDFASANRGLMKDVAKIF 83

Sequence Alignment: 3. Allergen Name: Bra n 2 Sequence ID: BAA09633

 Score = 71.8 bits 393,  Expect = 3e-15
 Identities = 59/76 77%, Positives = 69/76 90%, Gaps = 0/76 0%
Query  4    AEHERIFKKFDTDGDGKISAAELEEALKKLGSVTPDDVTRMMAKIDTDGDGNISFQEFTE 63
            AEH+RIFKKFD +GDGKISA+EL +ALK LGSVT DD+ RMMA+IDTDGDG IS+QEF++
Sbjct  7    AEHDRIFKKFDANGDGKISASELGDALKNLGSVTHDDIKRMMAEIDTDGDGYISYQEFSD 66
Query  64   FASANPGLMKDVAKVF 79
            FASAN GLMKDVAK+F
Sbjct  67   FASANRGLMKDVAKIF 82

Sequence Alignment: 4. Allergen Name: Bet v 4 Sequence ID: CAA73147

 Score = 70.5 bits 385,  Expect = 6e-15
 Identities = 59/76 77%, Positives = 67/76 88%, Gaps = 0/76 0%
Query  4    AEHERIFKKFDTDGDGKISAAELEEALKKLGSVTPDDVTRMMAKIDTDGDGNISFQEFTE 63
            AE ERIFK+FD +GDGKISAAEL EALK LGS+TPD+V  MMA+IDTDGDG ISFQEFT+
Sbjct  10   AERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTD 69
Query  64   FASANPGLMKDVAKVF 79
            FA AN GL+KDVAK+F
Sbjct  70   FARANRGLLKDVAKIF 85

Sequence Alignment: 5. Allergen Name: Bet v 4 Sequence ID: Q39419

 Score = 69.7 bits 380,  Expect = 1e-14
 Identities = 58/76 76%, Positives = 66/76 86%, Gaps = 0/76 0%
Query  4    AEHERIFKKFDTDGDGKISAAELEEALKKLGSVTPDDVTRMMAKIDTDGDGNISFQEFTE 63
            AE ERIFK+FD +GDGKISAAEL EALK LGS+TPD+V  MMA+IDTDGDG ISFQEFT+
Sbjct  10   AERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTD 69
Query  64   FASANPGLMKDVAKVF 79
            F  AN GL+KDVAK+F
Sbjct  70   FGRANRGLLKDVAKIF 85

Sequence Alignment: 6. Allergen Name: Aln g 4 Sequence ID: O81701

 Score = 69.4 bits 378,  Expect = 1e-14
 Identities = 59/76 77%, Positives = 66/76 86%, Gaps = 0/76 0%
Query  4    AEHERIFKKFDTDGDGKISAAELEEALKKLGSVTPDDVTRMMAKIDTDGDGNISFQEFTE 63
            AEHERIFK FD +GDGKISA+EL +ALK LGSVTPD+V  MMA+IDTDGDG ISFQEFT 
Sbjct  10   AEHERIFKCFDANGDGKISASELGDALKTLGSVTPDEVKHMMAEIDTDGDGFISFQEFTN 69
Query  64   FASANPGLMKDVAKVF 79
            FA AN GL+KDVAK+F
Sbjct  70   FARANRGLVKDVAKIF 85

Sequence Alignment: 7. Allergen Name: Ole e 3 Sequence ID: O81092

 Score = 68.3 bits 371,  Expect = 3e-14
 Identities = 56/76 73%, Positives = 67/76 88%, Gaps = 0/76 0%
Query  4    AEHERIFKKFDTDGDGKISAAELEEALKKLGSVTPDDVTRMMAKIDTDGDGNISFQEFTE 63
            AEHERIFK+FD +GDGKIS++EL E LK LGSVTP+++ RMMA+IDTDGDG ISF+EFT 
Sbjct  9    AEHERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEIDTDGDGFISFEEFTV 68
Query  64   FASANPGLMKDVAKVF 79
            FA AN GL+KDVAK+F
Sbjct  69   FARANRGLVKDVAKIF 84

Sequence Alignment: 8. Allergen Name: Che a 3 Sequence ID: AAL92871

 Score = 68.0 bits 369,  Expect = 4e-14
 Identities = 56/76 73%, Positives = 68/76 89%, Gaps = 0/76 0%
Query  4    AEHERIFKKFDTDGDGKISAAELEEALKKLGSVTPDDVTRMMAKIDTDGDGNISFQEFTE 63
            A+ ERIFK+FDT+GDGKIS++EL +ALK LGSVTPD+V RMMA+IDTDGDG ISF EFT+
Sbjct  11   ADRERIFKRFDTNGDGKISSSELGDALKTLGSVTPDEVRRMMAEIDTDGDGFISFDEFTD 70
Query  64   FASANPGLMKDVAKVF 79
            FA AN GL+KDV+K+F
Sbjct  71   FARANRGLVKDVSKIF 86

Sequence Alignment: 9. Allergen Name: Sal k 7.0101 Sequence ID: ALE34025

 Score = 68.0 bits 369,  Expect = 4e-14
 Identities = 56/76 73%, Positives = 68/76 89%, Gaps = 0/76 0%
Query  4    AEHERIFKKFDTDGDGKISAAELEEALKKLGSVTPDDVTRMMAKIDTDGDGNISFQEFTE 63
            A+ ERIFK+FDT+GDGKIS++EL +ALK LGSVT D++ RMMA+IDTDGDG ISF+EFTE
Sbjct  11   ADRERIFKRFDTNGDGKISSSELGDALKTLGSVTSDEIVRMMAEIDTDGDGFISFEEFTE 70
Query  64   FASANPGLMKDVAKVF 79
            FA AN GL+KDVAK+F
Sbjct  71   FARANRGLIKDVAKIF 86

Sequence Alignment: 10. Allergen Name: Syr v 3 Sequence ID: P58171

 Score = 66.6 bits 360,  Expect = 1e-13
 Identities = 54/76 71%, Positives = 66/76 86%, Gaps = 0/76 0%
Query  4    AEHERIFKKFDTDGDGKISAAELEEALKKLGSVTPDDVTRMMAKIDTDGDGNISFQEFTE 63
            AE ERIFK+FD +GDGKIS++EL E LK LGSVTP+++ RMMA+IDTDGDG ISF+EF +
Sbjct  6    AELERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEIDTDGDGFISFEEFKD 65
Query  64   FASANPGLMKDVAKVF 79
            FA AN GL+KDVAK+F
Sbjct  66   FARANSGLIKDVAKIF 81

Sequence Alignment: 11. Allergen Name: Par j 4.0101 Sequence ID: CAP05019

 Score = 66.6 bits 360,  Expect = 1e-13
 Identities = 54/76 71%, Positives = 68/76 89%, Gaps = 0/76 0%
Query  4    AEHERIFKKFDTDGDGKISAAELEEALKKLGSVTPDDVTRMMAKIDTDGDGNISFQEFTE 63
            AE+ERIFK+FD++GDGKIS++EL EALK LGSVT D+V RMMA+IDTDGDG IS++EF+ 
Sbjct  9    AEQERIFKRFDSNGDGKISSSELGEALKALGSVTADEVHRMMAEIDTDGDGAISLEEFSS 68
Query  64   FASANPGLMKDVAKVF 79
            FA AN GL+KD+AK+F
Sbjct  69   FADANRGLIKDIAKIF 84

Sequence Alignment: 12. Allergen Name: Phl p 7 Sequence ID: O82040

 Score = 65.6 bits 354,  Expect = 2e-13
 Identities = 55/78 70%, Positives = 65/78 83%, Gaps = 1/78 1%
Query  1    MADAEHERIFKKFDTDGDGKISAAELEEALKKLGSVTPDDVTRMMAKIDTDGDGNISFQE 60
            MAD + ERIFK+FDT+GDGKIS +EL +AL+ LGS + D+V RMMA+IDTDGDG I F E
Sbjct  1    MAD-DMERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFNE 59
Query  61   FTEFASANPGLMKDVAKVF 79
            F  F +ANPGLMKDVAKVF
Sbjct  60   FISFCNANPGLMKDVAKVF 78

Sequence Alignment: 13. Allergen Name: Cyn d 7 Sequence ID: P94092

 Score = 65.1 bits 351,  Expect = 3e-13
 Identities = 55/79 69%, Positives = 64/79 81%, Gaps = 1/79 1%
Query  1    MADA-EHERIFKKFDTDGDGKISAAELEEALKKLGSVTPDDVTRMMAKIDTDGDGNISFQ 59
            MAD  + E IFK+FDT+GDGKIS AEL +AL+ LGS + D+V RMMA+IDTDGDG I F 
Sbjct  1    MADTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFD 60
Query  60   EFTEFASANPGLMKDVAKVF 79
            EF  F +ANPGLMKDVAKVF
Sbjct  61   EFISFCNANPGLMKDVAKVF 80

Sequence Alignment: 14. Allergen Name: Cyn d 7 Sequence ID: CAA62634

 Score = 65.1 bits 351,  Expect = 3e-13
 Identities = 55/79 69%, Positives = 64/79 81%, Gaps = 1/79 1%
Query  1    MADA-EHERIFKKFDTDGDGKISAAELEEALKKLGSVTPDDVTRMMAKIDTDGDGNISFQ 59
            MAD  + E IFK+FDT+GDGKIS AEL +AL+ LGS + D+V RMMA+IDTDGDG I F 
Sbjct  3    MADTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFD 62
Query  60   EFTEFASANPGLMKDVAKVF 79
            EF  F +ANPGLMKDVAKVF
Sbjct  63   EFISFCNANPGLMKDVAKVF 82

Sequence Alignment: 15. Allergen Name: Art v 5.0101 Sequence ID: AY904434

 Score = 61.6 bits 329,  Expect = 3e-12
 Identities = 53/79 67%, Positives = 64/79 81%, Gaps = 3/79 3%
Query  1    MAD---AEHERIFKKFDTDGDGKISAAELEEALKKLGSVTPDDVTRMMAKIDTDGDGNIS 57
            MAD   AE +RIF  FD +GDGKISAAEL E+L KLGSV+P++V  MM ++DTDGDG IS
Sbjct  1    MADEDKAECDRIFGAFDKNGDGKISAAELGESLTKLGSVSPEEVQTMMDELDTDGDGYIS 60
Query  58   FQEFTEFASANPGLMKDVAKVF 79
            + EF EF +AN GLMKDV K+F
Sbjct  61   YDEFAEFFNANRGLMKDVGKIF 82

Sequence Alignment: 16. Allergen Name: Jun o 4 Sequence ID: O64943

 Score = 44.0 bits 218,  Expect = 1e-06
 Identities = 36/75 48%, Positives = 51/75 68%, Gaps = 3/75 4%
Query  5    EHERIFKKFDTDGDGKISAAELEEALKKLGS-VTPDDVTRMMAKIDTDGDGNISFQEFTE 63
            E E +FKKFD +GDGKIS +EL + L+ LGS V   +V  MM + D DGDG +S+QEF +
Sbjct  26   ELEEVFKKFDANGDGKISGSELADILRSLGSDVGEAEVKAMMEEADADGDGYVSLQEFVD 85
Query  64   FASANPGL--MKDVAKVF 79
            + +    +  +K+  KVF
Sbjct  86   LNNKGASVKDLKNAFKVF 103

Sequence Alignment: 17. Allergen Name: Cup a 4.0101 Sequence ID: ABP87672

 Score = 44.1 bits 218,  Expect = 1e-06
 Identities = 35/74 47%, Positives = 50/74 67%, Gaps = 2/74 2%
Query  5    EHERIFKKFDTDGDGKISAAELEEALKKLGS-VTPDDVTRMMAKIDTDGDGNISFQEFTE 63
            E E +FKKFD +GDGKIS +EL + L+ +GS V   +V  MM + DTDGDG +S+QEF +
Sbjct  38   ELEEVFKKFDANGDGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVD 97
Query  64   FASANPGLMKDVAKVF 79
            + +     +KD+   F
Sbjct  98   L-NIKGATVKDLKNAF 112

Sequence Alignment: 18. Allergen Name: Amb a 10.0101 Sequence ID: Q2KN25

 Score = 43.7 bits 216,  Expect = 1e-06
 Identities = 35/60 58%, Positives = 44/60 73%, Gaps = 1/60 1%
Query  5    EHERIFKKFDTDGDGKISAAELEEALKKLGS-VTPDDVTRMMAKIDTDGDGNISFQEFTE 63
            E  +IF +FDT+GDG+IS  EL   LK LGS  +PD+V R+MA+ID DGDG IS+ EF  
Sbjct  17   EVTKIFNRFDTNGDGQISEDELFAILKSLGSDTSPDEVKRVMAEIDADGDGFISLDEFIL 76
Query  64   F 64
            F
Sbjct  77   F 77

Sequence Alignment: 19. Allergen Name: Ole e 8 Sequence ID: AAF31152

 Score = 41.8 bits 204,  Expect = 6e-06
 Identities = 34/63 53%, Positives = 43/63 68%, Gaps = 1/63 1%
Query  5    EHERIFKKFDTDGDGKISAAELEEALKKLGSVTP-DDVTRMMAKIDTDGDGNISFQEFTE 63
            E + +F +FD +GDGKIS  EL  ALK LGS T  +++ RMM +IDTD DG I+ QEF  
Sbjct  20   EVQGVFNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFINVQEFAA 79
Query  64   FASA 67
            F  A
Sbjct  80   FVKA 83

Sequence Alignment: 20. Allergen Name: Ole e 8 Sequence ID: Q9M7R0

 Score = 39.9 bits 192,  Expect = 2e-05
 Identities = 32/63 50%, Positives = 42/63 66%, Gaps = 1/63 1%
Query  5    EHERIFKKFDTDGDGKISAAELEEALKKLGSVTP-DDVTRMMAKIDTDGDGNISFQEFTE 63
            E + +F +FD +GDGKIS  EL   LK LGS T  +++ R+M +IDTD DG I+ QEF  
Sbjct  20   EVQGVFNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGFINVQEFAA 79
Query  64   FASA 67
            F  A
Sbjct  80   FVKA 83

Sequence Alignment: 21. Allergen Name: Tyr p 24.0101 Sequence ID: ACL36923

 Score = 34.6 bits 159,  Expect = 0.0007
 Identities = 24/64 37%, Positives = 38/64 59%, Gaps = 1/64 1%
Query  5    EHERIFKKFDTDGDGKISAAELEEALKKLGS-VTPDDVTRMMAKIDTDGDGNISFQEFTE 63
            E    F+ +D +G+G I  + L E L+ L   +T D++  M+A+IDTDG G + F EF E
Sbjct  89   ELREAFRMYDKEGNGYIPTSALREILRALDDKLTEDELDEMIAEIDTDGSGTVDFDEFME 148
Query  64   FASAN 68
              + +
Sbjct  149  MMTGD 153

Sequence Alignment: 22. Allergen Name: Der f 39.0101 Sequence ID: QBF67841

 Score = 34.6 bits 159,  Expect = 0.0007
 Identities = 26/67 38%, Positives = 43/67 64%, Gaps = 4/67 5%
Query  2    ADAEHERI---FKKFDTDGDGKISAAELEEALKKLGS-VTPDDVTRMMAKIDTDGDGNIS 57
            A+A +E +   F+ +D +G+G I  + L E L+ L   +T D++  M+A+IDTDG G + 
Sbjct  83   AEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTNDELDEMIAEIDTDGSGTVD 142
Query  58   FQEFTEFASAN 68
            F EF E  + +
Sbjct  143  FDEFMEMMTGD 153

Sequence Alignment: 23. Allergen Name: Tyr p 34.0101 Sequence ID: D2DGW3

 Score = 34.6 bits 159,  Expect = 0.0007
 Identities = 24/64 37%, Positives = 38/64 59%, Gaps = 1/64 1%
Query  5    EHERIFKKFDTDGDGKISAAELEEALKKLGS-VTPDDVTRMMAKIDTDGDGNISFQEFTE 63
            E    F+ +D +G+G I  + L E L+ L   +T D++  M+A+IDTDG G + F EF E
Sbjct  89   ELREAFRMYDKEGNGYIPTSALREILRALDDKLTEDELDEMIAEIDTDGSGTVDFDEFME 148
Query  64   FASAN 68
              + +
Sbjct  149  MMTGD 153

Sequence Alignment: 24. Allergen Name: Der p 39.0101 Sequence ID: QXY82447

 Score = 34.6 bits 159,  Expect = 0.0007
 Identities = 26/67 38%, Positives = 43/67 64%, Gaps = 4/67 5%
Query  2    ADAEHERI---FKKFDTDGDGKISAAELEEALKKLGS-VTPDDVTRMMAKIDTDGDGNIS 57
            A+A +E +   F+ +D +G+G I  + L E L+ L   +T D++  M+A+IDTDG G + 
Sbjct  83   AEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTNDELDEMIAEIDTDGSGTVD 142
Query  58   FQEFTEFASAN 68
            F EF E  + +
Sbjct  143  FDEFMEMMTGD 153

Sequence Alignment: 25. Allergen Name: Bet v 3 Sequence ID: P43187

 Score = 33.7 bits 153,  Expect = 0.002
 Identities = 26/54 48%, Positives = 34/54 62%, Gaps = 3/54 5%
Query  10   FKKFDTDGDGKISAAELEEALKKLG---SVTPDDVTRMMAKIDTDGDGNISFQEFTE 63
            FK FD DGDG ISA EL+  L KLG       D V +M+  +D++ DG + F EF +
Sbjct  139  FKVFDEDGDGYISARELQMVLGKLGFSEGSEIDRVEKMIVSVDSNRDGRVDFFEFKD 195

Sequence Alignment: 26. Allergen Name: Per a 6.0101 Sequence ID: Q1M0Y3

 Score = 33.0 bits 149,  Expect = 0.002
 Identities = 23/59 38%, Positives = 37/59 62%, Gaps = 1/59 1%
Query  5    EHERIFKKFDTDGDGKISAAELEEALKKLGS-VTPDDVTRMMAKIDTDGDGNISFQEFTE 63
            E +  F+ +D +G+G I+   L E LK+L   +T +D+  M+ +ID+DG G + F EF E
Sbjct  87   ELKEAFRLYDKEGNGYITTTVLREILKELDDKLTNEDLDAMIEEIDSDGSGTVDFDEFME 146

Sequence Alignment: 27. Allergen Name: Bla g 6.0301 Sequence ID: ABB89298

 Score = 32.2 bits 144,  Expect = 0.004
 Identities = 22/64 34%, Positives = 37/64 57%, Gaps = 1/64 1%
Query  3    DAEHERIFKKFDTDGDGKISAAELEEALKKLG-SVTPDDVTRMMAKIDTDGDGNISFQEF 61
            + E    F+ +D +G+G I  + L E L++L   +T D++  M+ +ID DG G + F EF
Sbjct  89   EKELREAFRLYDKEGNGYIPTSCLREILRELDEQLTSDELDMMIEEIDADGSGTVDFDEF 148
Query  62   TEFAS 66
             E  +
Sbjct  149  MEMMT 153

Sequence Alignment: 28. Allergen Name: Pen m 6.0101 Sequence ID: ADV17344

 Score = 31.0 bits 136,  Expect = 0.009
 Identities = 20/59 33%, Positives = 37/59 62%, Gaps = 1/59 1%
Query  8    RIFKKFDTDGDGKISAAELEEALKKLG-SVTPDDVTRMMAKIDTDGDGNISFQEFTEFAS 66
            + F  FDT+G G I+A  +   L+ +G  ++  ++  ++A+ D DG G + F+EF E+A+
Sbjct  14   KAFNSFDTEGAGSINAETVGVILRMMGVKISEKNLQEVIAETDEDGSGMLEFEEFAELAA 73

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.