The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MADATEKAEHDRIFKKFDANGDGKISASELGDALKNLGSVTHDDIKRMMAEIDTDGDGYI
SYQEFSDFASANRGLMKDVAKIF
Sequence Info Allergen Name Length Opt Bits Score E Value
Q39406 Bra n 2 83 538 97.1 6.4e-23
BAA09633 Bra n 2 82 531 96.0 1.4e-22
O81701 Aln g 4 85 427 79.1 1.8e-17
CAA73147 Bet v 4 85 424 78.6 2.5e-17
Q39419 Bet v 4 85 419 77.8 4.4e-17
O81092 Ole e 3 84 406 75.7 1.9e-16
AAL92871 Che a 3 86 401 74.9 3.4e-16
CAP05019 Par j 4.0101 84 399 74.5 4.2e-16
ALE34025 Sal k 7.0101 86 398 74.4 4.8e-16
P69197 Bra r 5.0101 79 395 73.9 6.2e-16
P58171 Syr v 3 81 394 73.7 7.1e-16
AY904434 Art v 5.0101 82 365 69.0 1.9e-14
O82040 Phl p 7 78 347 66.1 1.4e-13
P94092 Cyn d 7 80 343 65.4 2.2e-13
CAA62634 Cyn d 7 82 343 65.4 2.3e-13
O64943 Jun o 4 165 259 51.7 5.9e-09
ABP87672 Cup a 4.0101 177 259 51.7 6.3e-09
AAF31152 Ole e 8 171 232 47.3 1.3e-07
Q2KN25 Amb a 10.0101 160 231 47.2 1.3e-07
Q9M7R0 Ole e 8 171 224 46.0 3.2e-07
ADV17344 Pen m 6.0101 150 144 33.0 0.0023
Q1M0Y3 Per a 6.0101 151 140 32.4 0.0037
ABB89297 Bla g 6.0201 151 139 32.2 0.0041
ABB89296 Bla g 6.0101 151 138 32.1 0.0046
ABB89298 Bla g 6.0301 154 137 31.9 0.0052
P29291 Hom a 6.0101 150 132 31.1 0.0089
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Bra n 2 Sequence ID: Q39406

 Score = 97.1 bits 538,  Expect = 6e-23
 Identities = 83/83 100%, Positives = 83/83 100%, Gaps = 0/83 0%
Query  1    MADATEKAEHDRIFKKFDANGDGKISASELGDALKNLGSVTHDDIKRMMAEIDTDGDGYI 60
            MADATEKAEHDRIFKKFDANGDGKISASELGDALKNLGSVTHDDIKRMMAEIDTDGDGYI
Sbjct  1    MADATEKAEHDRIFKKFDANGDGKISASELGDALKNLGSVTHDDIKRMMAEIDTDGDGYI 60
Query  61   SYQEFSDFASANRGLMKDVAKIF 83
            SYQEFSDFASANRGLMKDVAKIF
Sbjct  61   SYQEFSDFASANRGLMKDVAKIF 83

Sequence Alignment: 2. Allergen Name: Bra n 2 Sequence ID: BAA09633

 Score = 96.0 bits 531,  Expect = 1e-22
 Identities = 82/82 100%, Positives = 82/82 100%, Gaps = 0/82 0%
Query  2    ADATEKAEHDRIFKKFDANGDGKISASELGDALKNLGSVTHDDIKRMMAEIDTDGDGYIS 61
            ADATEKAEHDRIFKKFDANGDGKISASELGDALKNLGSVTHDDIKRMMAEIDTDGDGYIS
Sbjct  1    ADATEKAEHDRIFKKFDANGDGKISASELGDALKNLGSVTHDDIKRMMAEIDTDGDGYIS 60
Query  62   YQEFSDFASANRGLMKDVAKIF 83
            YQEFSDFASANRGLMKDVAKIF
Sbjct  61   YQEFSDFASANRGLMKDVAKIF 82

Sequence Alignment: 3. Allergen Name: Aln g 4 Sequence ID: O81701

 Score = 79.1 bits 427,  Expect = 2e-17
 Identities = 66/83 79%, Positives = 76/83 91%, Gaps = 2/83 2%
Query  1    MAD--ATEKAEHDRIFKKFDANGDGKISASELGDALKNLGSVTHDDIKRMMAEIDTDGDG 58
            MAD    ++AEH+RIFK FDANGDGKISASELGDALK LGSVT D++K MMAEIDTDGDG
Sbjct  1    MADDHPQDQAEHERIFKCFDANGDGKISASELGDALKTLGSVTPDEVKHMMAEIDTDGDG 60
Query  59   YISYQEFSDFASANRGLMKDVAKIF 83
            +IS+QEF++FA ANRGL+KDVAKIF
Sbjct  61   FISFQEFTNFARANRGLVKDVAKIF 85

Sequence Alignment: 4. Allergen Name: Bet v 4 Sequence ID: CAA73147

 Score = 78.6 bits 424,  Expect = 3e-17
 Identities = 64/83 77%, Positives = 76/83 91%, Gaps = 2/83 2%
Query  1    MAD--ATEKAEHDRIFKKFDANGDGKISASELGDALKNLGSVTHDDIKRMMAEIDTDGDG 58
            MAD    +KAE +RIFK+FDANGDGKISA+ELG+ALK LGS+T D++K MMAEIDTDGDG
Sbjct  1    MADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDG 60
Query  59   YISYQEFSDFASANRGLMKDVAKIF 83
            +IS+QEF+DFA ANRGL+KDVAKIF
Sbjct  61   FISFQEFTDFARANRGLLKDVAKIF 85

Sequence Alignment: 5. Allergen Name: Bet v 4 Sequence ID: Q39419

 Score = 77.8 bits 419,  Expect = 4e-17
 Identities = 63/83 75%, Positives = 75/83 90%, Gaps = 2/83 2%
Query  1    MAD--ATEKAEHDRIFKKFDANGDGKISASELGDALKNLGSVTHDDIKRMMAEIDTDGDG 58
            MAD    +KAE +RIFK+FDANGDGKISA+ELG+ALK LGS+T D++K MMAEIDTDGDG
Sbjct  1    MADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDG 60
Query  59   YISYQEFSDFASANRGLMKDVAKIF 83
            +IS+QEF+DF  ANRGL+KDVAKIF
Sbjct  61   FISFQEFTDFGRANRGLLKDVAKIF 85

Sequence Alignment: 6. Allergen Name: Ole e 3 Sequence ID: O81092

 Score = 75.7 bits 406,  Expect = 2e-16
 Identities = 61/81 75%, Positives = 73/81 90%, Gaps = 0/81 0%
Query  3    DATEKAEHDRIFKKFDANGDGKISASELGDALKNLGSVTHDDIKRMMAEIDTDGDGYISY 62
            D  E AEH+RIFK+FDANGDGKIS+SELG+ LK LGSVT ++I+RMMAEIDTDGDG+IS+
Sbjct  4    DPQEVAEHERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEIDTDGDGFISF 63
Query  63   QEFSDFASANRGLMKDVAKIF 83
            +EF+ FA ANRGL+KDVAKIF
Sbjct  64   EEFTVFARANRGLVKDVAKIF 84

Sequence Alignment: 7. Allergen Name: Che a 3 Sequence ID: AAL92871

 Score = 74.9 bits 401,  Expect = 3e-16
 Identities = 58/76 76%, Positives = 70/76 92%, Gaps = 0/76 0%
Query  8    AEHDRIFKKFDANGDGKISASELGDALKNLGSVTHDDIKRMMAEIDTDGDGYISYQEFSD 67
            A+ +RIFK+FD NGDGKIS+SELGDALK LGSVT D+++RMMAEIDTDGDG+IS+ EF+D
Sbjct  11   ADRERIFKRFDTNGDGKISSSELGDALKTLGSVTPDEVRRMMAEIDTDGDGFISFDEFTD 70
Query  68   FASANRGLMKDVAKIF 83
            FA ANRGL+KDV+KIF
Sbjct  71   FARANRGLVKDVSKIF 86

Sequence Alignment: 8. Allergen Name: Par j 4.0101 Sequence ID: CAP05019

 Score = 74.5 bits 399,  Expect = 4e-16
 Identities = 61/83 73%, Positives = 74/83 89%, Gaps = 1/83 1%
Query  1    MADAT-EKAEHDRIFKKFDANGDGKISASELGDALKNLGSVTHDDIKRMMAEIDTDGDGY 59
            MAD   ++AE++RIFK+FD+NGDGKIS+SELG+ALK LGSVT D++ RMMAEIDTDGDG 
Sbjct  1    MADKQIDRAEQERIFKRFDSNGDGKISSSELGEALKALGSVTADEVHRMMAEIDTDGDGA 60
Query  60   ISYQEFSDFASANRGLMKDVAKIF 83
            IS +EFS FA ANRGL+KD+AKIF
Sbjct  61   ISLEEFSSFADANRGLIKDIAKIF 84

Sequence Alignment: 9. Allergen Name: Sal k 7.0101 Sequence ID: ALE34025

 Score = 74.4 bits 398,  Expect = 5e-16
 Identities = 59/76 77%, Positives = 70/76 92%, Gaps = 0/76 0%
Query  8    AEHDRIFKKFDANGDGKISASELGDALKNLGSVTHDDIKRMMAEIDTDGDGYISYQEFSD 67
            A+ +RIFK+FD NGDGKIS+SELGDALK LGSVT D+I RMMAEIDTDGDG+IS++EF++
Sbjct  11   ADRERIFKRFDTNGDGKISSSELGDALKTLGSVTSDEIVRMMAEIDTDGDGFISFEEFTE 70
Query  68   FASANRGLMKDVAKIF 83
            FA ANRGL+KDVAKIF
Sbjct  71   FARANRGLIKDVAKIF 86

Sequence Alignment: 10. Allergen Name: Bra r 5.0101 Sequence ID: P69197

 Score = 73.9 bits 395,  Expect = 6e-16
 Identities = 62/79 78%, Positives = 72/79 91%, Gaps = 4/79 5%
Query  1    MADATEKAEHDRIFKKFDANGDGKISASELGDALKNLGSVTHDDIKRMMAEIDTDGDGYI 60
            MADA    EH+RIFKKFD +GDGKISA+EL +ALK LGSVT DD+ RMMA+IDTDGDG I
Sbjct  1    MADA----EHERIFKKFDTDGDGKISAAELEEALKKLGSVTPDDVTRMMAKIDTDGDGNI 56
Query  61   SYQEFSDFASANRGLMKDVAKIF 83
            S+QEF++FASAN GLMKDVAK+F
Sbjct  57   SFQEFTEFASANPGLMKDVAKVF 79

Sequence Alignment: 11. Allergen Name: Syr v 3 Sequence ID: P58171

 Score = 73.7 bits 394,  Expect = 7e-16
 Identities = 60/80 75%, Positives = 71/80 88%, Gaps = 0/80 0%
Query  4    ATEKAEHDRIFKKFDANGDGKISASELGDALKNLGSVTHDDIKRMMAEIDTDGDGYISYQ 63
            A E AE +RIFK+FDANGDGKIS+SELG+ LK LGSVT ++I+RMMAEIDTDGDG+IS++
Sbjct  2    AEEVAELERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEIDTDGDGFISFE 61
Query  64   EFSDFASANRGLMKDVAKIF 83
            EF DFA AN GL+KDVAKIF
Sbjct  62   EFKDFARANSGLIKDVAKIF 81

Sequence Alignment: 12. Allergen Name: Art v 5.0101 Sequence ID: AY904434

 Score = 69.0 bits 365,  Expect = 2e-14
 Identities = 56/82 68%, Positives = 69/82 84%, Gaps = 1/82 1%
Query  1    MADATEKAEHDRIFKKFDANGDGKISASELGDALKNLGSVTHDDIKRMMAEIDTDGDGYI 60
            MAD  +KAE DRIF  FD NGDGKISA+ELG++L  LGSV+ ++++ MM E+DTDGDGYI
Sbjct  1    MADE-DKAECDRIFGAFDKNGDGKISAAELGESLTKLGSVSPEEVQTMMDELDTDGDGYI 59
Query  61   SYQEFSDFASANRGLMKDVAKIF 83
            SY EF++F +ANRGLMKDV KIF
Sbjct  60   SYDEFAEFFNANRGLMKDVGKIF 82

Sequence Alignment: 13. Allergen Name: Phl p 7 Sequence ID: O82040

 Score = 66.1 bits 347,  Expect = 1e-13
 Identities = 50/75 66%, Positives = 62/75 82%, Gaps = 0/75 0%
Query  9    EHDRIFKKFDANGDGKISASELGDALKNLGSVTHDDIKRMMAEIDTDGDGYISYQEFSDF 68
            + +RIFK+FD NGDGKIS SEL DAL+ LGS + D+++RMMAEIDTDGDG+I + EF  F
Sbjct  4    DMERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFNEFISF 63
Query  69   ASANRGLMKDVAKIF 83
             +AN GLMKDVAK+F
Sbjct  64   CNANPGLMKDVAKVF 78

Sequence Alignment: 14. Allergen Name: Cyn d 7 Sequence ID: P94092

 Score = 65.4 bits 343,  Expect = 2e-13
 Identities = 54/80 67%, Positives = 65/80 81%, Gaps = 3/80 3%
Query  1    MADATEKAEHDRIFKKFDANGDGKISASELGDALKNLGSVTHDDIKRMMAEIDTDGDGYI 60
            MAD T   EH  IFK+FD NGDGKIS +EL DAL+ LGS + D+++RMMAEIDTDGDG+I
Sbjct  1    MAD-TGDMEH--IFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFI 57
Query  61   SYQEFSDFASANRGLMKDVAKIF 83
             + EF  F +AN GLMKDVAK+F
Sbjct  58   DFDEFISFCNANPGLMKDVAKVF 80

Sequence Alignment: 15. Allergen Name: Cyn d 7 Sequence ID: CAA62634

 Score = 65.4 bits 343,  Expect = 2e-13
 Identities = 54/80 67%, Positives = 65/80 81%, Gaps = 3/80 3%
Query  1    MADATEKAEHDRIFKKFDANGDGKISASELGDALKNLGSVTHDDIKRMMAEIDTDGDGYI 60
            MAD T   EH  IFK+FD NGDGKIS +EL DAL+ LGS + D+++RMMAEIDTDGDG+I
Sbjct  3    MAD-TGDMEH--IFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFI 59
Query  61   SYQEFSDFASANRGLMKDVAKIF 83
             + EF  F +AN GLMKDVAK+F
Sbjct  60   DFDEFISFCNANPGLMKDVAKVF 82

Sequence Alignment: 16. Allergen Name: Jun o 4 Sequence ID: O64943

 Score = 51.7 bits 259,  Expect = 6e-09
 Identities = 43/73 58%, Positives = 54/73 73%, Gaps = 4/73 5%
Query  9    EHDRIFKKFDANGDGKISASELGDALKNLGS-VTHDDIKRMMAEIDTDGDGYISYQEFSD 67
            E + +FKKFDANGDGKIS SEL D L++LGS V   ++K MM E D DGDGY+S QEF D
Sbjct  26   ELEEVFKKFDANGDGKISGSELADILRSLGSDVGEAEVKAMMEEADADGDGYVSLQEFVD 85
Query  68   FASANRGL-MKDVAKIF 83
            +   N+G  +KD+   F
Sbjct  86   L--NNKGASVKDLKNAF 100

Sequence Alignment: 17. Allergen Name: Cup a 4.0101 Sequence ID: ABP87672

 Score = 51.7 bits 259,  Expect = 6e-09
 Identities = 42/75 56%, Positives = 54/75 72%, Gaps = 3/75 4%
Query  9    EHDRIFKKFDANGDGKISASELGDALKNLGS-VTHDDIKRMMAEIDTDGDGYISYQEFSD 67
            E + +FKKFDANGDGKIS SEL D L+++GS V   ++K MM E DTDGDGY+S QEF D
Sbjct  38   ELEEVFKKFDANGDGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVD 97
Query  68   FA--SANRGLMKDVAKIF 83
            +    A    +K+  K+F
Sbjct  98   LNIKGATVKDLKNAFKVF 115

Sequence Alignment: 18. Allergen Name: Ole e 8 Sequence ID: AAF31152

 Score = 47.3 bits 232,  Expect = 1e-07
 Identities = 39/66 59%, Positives = 46/66 69%, Gaps = 1/66 1%
Query  6    EKAEHDRIFKKFDANGDGKISASELGDALKNLGSVT-HDDIKRMMAEIDTDGDGYISYQE 64
            E  E   +F +FDANGDGKIS  EL  ALK LGS T  ++I RMM EIDTD DG+I+ QE
Sbjct  17   EPNEVQGVFNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFINVQE 76
Query  65   FSDFASA 71
            F+ F  A
Sbjct  77   FAAFVKA 83

Sequence Alignment: 19. Allergen Name: Amb a 10.0101 Sequence ID: Q2KN25

 Score = 47.2 bits 231,  Expect = 1e-07
 Identities = 38/64 59%, Positives = 47/64 73%, Gaps = 1/64 1%
Query  5    TEKAEHDRIFKKFDANGDGKISASELGDALKNLGSVTH-DDIKRMMAEIDTDGDGYISYQ 63
            T+K E  +IF +FD NGDG+IS  EL   LK+LGS T  D++KR+MAEID DGDG+IS  
Sbjct  13   TDKEEVTKIFNRFDTNGDGQISEDELFAILKSLGSDTSPDEVKRVMAEIDADGDGFISLD 72
Query  64   EFSDF 68
            EF  F
Sbjct  73   EFILF 77

Sequence Alignment: 20. Allergen Name: Ole e 8 Sequence ID: Q9M7R0

 Score = 46.0 bits 224,  Expect = 3e-07
 Identities = 37/66 56%, Positives = 45/66 68%, Gaps = 1/66 1%
Query  6    EKAEHDRIFKKFDANGDGKISASELGDALKNLGSVT-HDDIKRMMAEIDTDGDGYISYQE 64
            E  E   +F +FDANGDGKIS  EL   LK LGS T  ++I R+M EIDTD DG+I+ QE
Sbjct  17   EPNEVQGVFNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGFINVQE 76
Query  65   FSDFASA 71
            F+ F  A
Sbjct  77   FAAFVKA 83

Sequence Alignment: 21. Allergen Name: Pen m 6.0101 Sequence ID: ADV17344

 Score = 33.0 bits 144,  Expect = 0.002
 Identities = 19/59 32%, Positives = 38/59 64%, Gaps = 1/59 1%
Query  12   RIFKKFDANGDGKISASELGDALKNLG-SVTHDDIKRMMAEIDTDGDGYISYQEFSDFAS 70
            + F  FD  G G I+A  +G  L+ +G  ++  +++ ++AE D DG G + ++EF+++A+
Sbjct  14   KAFNSFDTEGAGSINAETVGVILRMMGVKISEKNLQEVIAETDEDGSGMLEFEEFAELAA 73

Sequence Alignment: 22. Allergen Name: Per a 6.0101 Sequence ID: Q1M0Y3

 Score = 32.4 bits 140,  Expect = 0.004
 Identities = 23/63 36%, Positives = 40/63 63%, Gaps = 2/63 3%
Query  2    ADATEKAEHDRIFKKFDANGDGKISASELGDALKNLGS-VTHDDIKRMMAEIDTDGDGYI 60
            A+A ++ E    F+ +D  G+G I+ + L + LK L   +T++D+  M+ EID+DG G +
Sbjct  81   AEAMQQ-ELKEAFRLYDKEGNGYITTTVLREILKELDDKLTNEDLDAMIEEIDSDGSGTV 139
Query  61   SYQEF 65
             + EF
Sbjct  140  DFDEF 144

Sequence Alignment: 23. Allergen Name: Bla g 6.0201 Sequence ID: ABB89297

 Score = 32.2 bits 139,  Expect = 0.004
 Identities = 24/62 38%, Positives = 39/62 62%, Gaps = 4/62 6%
Query  3    DATEKAEHD--RIFKKFDANGDGKISASELGDALKNLGS-VTHDDIKRMMAEIDTDGDGY 59
            DA E  +H+    F+ +D  G+G I+ + L + LK L   +T +D+  M+ EID+DG G 
Sbjct  80   DA-EAMQHELREAFRLYDKEGNGYITTAVLREILKELDDKITAEDLDMMIEEIDSDGSGT 138
Query  60   ISYQEF 65
            + + EF
Sbjct  139  VDFDEF 144

Sequence Alignment: 24. Allergen Name: Bla g 6.0101 Sequence ID: ABB89296

 Score = 32.1 bits 138,  Expect = 0.005
 Identities = 23/63 36%, Positives = 39/63 61%, Gaps = 2/63 3%
Query  2    ADATEKAEHDRIFKKFDANGDGKISASELGDALKNLGS-VTHDDIKRMMAEIDTDGDGYI 60
            A+A ++ E    F+ +D  G+G I+ + L + LK L   +T +D+  M+ EID+DG G +
Sbjct  81   AEAMQQ-ELREAFRLYDKEGNGYITTNVLREILKELDDKITAEDLDMMIEEIDSDGSGTV 139
Query  61   SYQEF 65
             + EF
Sbjct  140  DFDEF 144

Sequence Alignment: 25. Allergen Name: Bla g 6.0301 Sequence ID: ABB89298

 Score = 31.9 bits 137,  Expect = 0.005
 Identities = 24/68 35%, Positives = 39/68 57%, Gaps = 2/68 2%
Query  2    ADATEKAEHDRIFKKFDANGDGKISASELGDALKNLG-SVTHDDIKRMMAEIDTDGDGYI 60
            ++A EK E    F+ +D  G+G I  S L + L+ L   +T D++  M+ EID DG G +
Sbjct  85   SEAMEK-ELREAFRLYDKEGNGYIPTSCLREILRELDEQLTSDELDMMIEEIDADGSGTV 143
Query  61   SYQEFSDFAS 70
             + EF +  +
Sbjct  144  DFDEFMEMMT 153

Sequence Alignment: 26. Allergen Name: Hom a 6.0101 Sequence ID: P29291

 Score = 31.1 bits 132,  Expect = 0.009
 Identities = 20/59 33%, Positives = 35/59 59%, Gaps = 1/59 1%
Query  7    KAEHDRIFKKFDANGDGKISASELGDALKNLGS-VTHDDIKRMMAEIDTDGDGYISYQEF 65
            KAE    F+ +D  G+G I+   L + L+ L + +T +D+  ++ E+D DG G + + EF
Sbjct  85   KAELREAFRVYDRGGNGYITTDVLKEILRELDNRLTEEDLDSIIEEVDEDGSGTLDFNEF 144

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.