The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MADDPQEVAEHERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEIDTDGDGF
ISFEEFTVFARANRGLVKDVAKIF
Sequence Info Allergen Name Length Opt Bits Score E Value
O81092 Ole e 3 84 540 90.9 5.1e-21
O81701 Aln g 4 85 463 79.3 1.5e-17
P58171 Syr v 3 81 460 78.9 2e-17
CAA73147 Bet v 4 85 458 78.6 2.6e-17
AAL92871 Che a 3 86 458 78.6 2.6e-17
Q39419 Bet v 4 85 453 77.8 4.3e-17
ALE34025 Sal k 7.0101 86 449 77.2 6.6e-17
CAP05019 Par j 4.0101 84 414 72.0 2.5e-15
BAA09633 Bra n 2 82 406 70.8 5.5e-15
Q39406 Bra n 2 83 406 70.8 5.6e-15
P69197 Bra r 5.0101 79 371 65.5 2e-13
AY904434 Art v 5.0101 82 357 63.4 9e-13
O82040 Phl p 7 78 356 63.3 9.6e-13
P94092 Cyn d 7 80 345 61.6 3.1e-12
CAA62634 Cyn d 7 82 345 61.6 3.1e-12
Q2KN25 Amb a 10.0101 160 255 48.3 6.1e-08
O64943 Jun o 4 165 251 47.8 9.5e-08
AAF31152 Ole e 8 171 250 47.6 1.1e-07
ABP87672 Cup a 4.0101 177 249 47.5 1.2e-07
Q9M7R0 Ole e 8 171 244 46.7 2e-07
ACL36923 Tyr p 24.0101 153 163 34.5 0.00084
D2DGW3 Tyr p 34.0101 153 163 34.5 0.00084
QBF67841 Der f 39.0101 153 162 34.4 0.00093
QXY82447 Der p 39.0101 153 162 34.4 0.00093
ABB89297 Bla g 6.0201 151 159 33.9 0.0013
ABB89296 Bla g 6.0101 151 150 32.6 0.0032
Q1M0Y3 Per a 6.0101 151 147 32.1 0.0044
ABB89298 Bla g 6.0301 154 145 31.8 0.0055
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ole e 3 Sequence ID: O81092

 Score = 90.9 bits 540,  Expect = 5e-21
 Identities = 84/84 100%, Positives = 84/84 100%, Gaps = 0/84 0%
Query  1    MADDPQEVAEHERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEIDTDGDGF 60
            MADDPQEVAEHERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEIDTDGDGF
Sbjct  1    MADDPQEVAEHERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEIDTDGDGF 60
Query  61   ISFEEFTVFARANRGLVKDVAKIF 84
            ISFEEFTVFARANRGLVKDVAKIF
Sbjct  61   ISFEEFTVFARANRGLVKDVAKIF 84

Sequence Alignment: 2. Allergen Name: Aln g 4 Sequence ID: O81701

 Score = 79.3 bits 463,  Expect = 2e-17
 Identities = 72/84 85%, Positives = 79/84 94%, Gaps = 1/84 1%
Query  1    MADD-PQEVAEHERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEIDTDGDG 59
            MADD PQ+ AEHERIFK FDANGDGKIS+SELG+ LKTLGSVTP+E++ MMAEIDTDGDG
Sbjct  1    MADDHPQDQAEHERIFKCFDANGDGKISASELGDALKTLGSVTPDEVKHMMAEIDTDGDG 60
Query  60   FISFEEFTVFARANRGLVKDVAKIF 84
            FISF+EFT FARANRGLVKDVAKIF
Sbjct  61   FISFQEFTNFARANRGLVKDVAKIF 85

Sequence Alignment: 3. Allergen Name: Syr v 3 Sequence ID: P58171

 Score = 78.9 bits 460,  Expect = 2e-17
 Identities = 73/79 92%, Positives = 75/79 94%, Gaps = 0/79 0%
Query  6    QEVAEHERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEIDTDGDGFISFEE 65
            +EVAE ERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEIDTDGDGFISFEE
Sbjct  3    EEVAELERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEIDTDGDGFISFEE 62
Query  66   FTVFARANRGLVKDVAKIF 84
            F  FARAN GL+KDVAKIF
Sbjct  63   FKDFARANSGLIKDVAKIF 81

Sequence Alignment: 4. Allergen Name: Bet v 4 Sequence ID: CAA73147

 Score = 78.6 bits 458,  Expect = 3e-17
 Identities = 70/84 83%, Positives = 79/84 94%, Gaps = 1/84 1%
Query  1    MADD-PQEVAEHERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEIDTDGDG 59
            MADD PQ+ AE ERIFKRFDANGDGKIS++ELGE LKTLGS+TP+E++ MMAEIDTDGDG
Sbjct  1    MADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDG 60
Query  60   FISFEEFTVFARANRGLVKDVAKIF 84
            FISF+EFT FARANRGL+KDVAKIF
Sbjct  61   FISFQEFTDFARANRGLLKDVAKIF 85

Sequence Alignment: 5. Allergen Name: Che a 3 Sequence ID: AAL92871

 Score = 78.6 bits 458,  Expect = 3e-17
 Identities = 68/82 82%, Positives = 77/82 93%, Gaps = 0/82 0%
Query  3    DDPQEVAEHERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEIDTDGDGFIS 62
            D PQ++A+ ERIFKRFD NGDGKISSSELG+ LKTLGSVTP+E++RMMAEIDTDGDGFIS
Sbjct  5    DTPQDIADRERIFKRFDTNGDGKISSSELGDALKTLGSVTPDEVRRMMAEIDTDGDGFIS 64
Query  63   FEEFTVFARANRGLVKDVAKIF 84
            F+EFT FARANRGLVKDV+KIF
Sbjct  65   FDEFTDFARANRGLVKDVSKIF 86

Sequence Alignment: 6. Allergen Name: Bet v 4 Sequence ID: Q39419

 Score = 77.8 bits 453,  Expect = 4e-17
 Identities = 69/84 82%, Positives = 78/84 92%, Gaps = 1/84 1%
Query  1    MADD-PQEVAEHERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEIDTDGDG 59
            MADD PQ+ AE ERIFKRFDANGDGKIS++ELGE LKTLGS+TP+E++ MMAEIDTDGDG
Sbjct  1    MADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDG 60
Query  60   FISFEEFTVFARANRGLVKDVAKIF 84
            FISF+EFT F RANRGL+KDVAKIF
Sbjct  61   FISFQEFTDFGRANRGLLKDVAKIF 85

Sequence Alignment: 7. Allergen Name: Sal k 7.0101 Sequence ID: ALE34025

 Score = 77.2 bits 449,  Expect = 7e-17
 Identities = 69/82 84%, Positives = 75/82 91%, Gaps = 0/82 0%
Query  3    DDPQEVAEHERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEIDTDGDGFIS 62
            D PQ++A+ ERIFKRFD NGDGKISSSELG+ LKTLGSVT +EI RMMAEIDTDGDGFIS
Sbjct  5    DTPQDLADRERIFKRFDTNGDGKISSSELGDALKTLGSVTSDEIVRMMAEIDTDGDGFIS 64
Query  63   FEEFTVFARANRGLVKDVAKIF 84
            FEEFT FARANRGL+KDVAKIF
Sbjct  65   FEEFTEFARANRGLIKDVAKIF 86

Sequence Alignment: 8. Allergen Name: Par j 4.0101 Sequence ID: CAP05019

 Score = 72.0 bits 414,  Expect = 2e-15
 Identities = 64/84 76%, Positives = 74/84 88%, Gaps = 0/84 0%
Query  1    MADDPQEVAEHERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEIDTDGDGF 60
            MAD   + AE+ERIFKRFD+NGDGKISSSELGE LK LGSVT +E++RMMAEIDTDGDG 
Sbjct  1    MADKQIDRAEQERIFKRFDSNGDGKISSSELGEALKALGSVTADEVHRMMAEIDTDGDGA 60
Query  61   ISFEEFTVFARANRGLVKDVAKIF 84
            IS+EEF+ FA ANRGL+KD+AKIF
Sbjct  61   ISLEEFSSFADANRGLIKDIAKIF 84

Sequence Alignment: 9. Allergen Name: Bra n 2 Sequence ID: BAA09633

 Score = 70.8 bits 406,  Expect = 6e-15
 Identities = 61/81 75%, Positives = 73/81 90%, Gaps = 0/81 0%
Query  4    DPQEVAEHERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEIDTDGDGFISF 63
            D  E AEH+RIFK+FDANGDGKIS+SELG+ LK LGSVT ++I+RMMAEIDTDGDG+IS+
Sbjct  2    DATEKAEHDRIFKKFDANGDGKISASELGDALKNLGSVTHDDIKRMMAEIDTDGDGYISY 61
Query  64   EEFTVFARANRGLVKDVAKIF 84
            +EF+ FA ANRGL+KDVAKIF
Sbjct  62   QEFSDFASANRGLMKDVAKIF 82

Sequence Alignment: 10. Allergen Name: Bra n 2 Sequence ID: Q39406

 Score = 70.8 bits 406,  Expect = 6e-15
 Identities = 61/81 75%, Positives = 73/81 90%, Gaps = 0/81 0%
Query  4    DPQEVAEHERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEIDTDGDGFISF 63
            D  E AEH+RIFK+FDANGDGKIS+SELG+ LK LGSVT ++I+RMMAEIDTDGDG+IS+
Sbjct  3    DATEKAEHDRIFKKFDANGDGKISASELGDALKNLGSVTHDDIKRMMAEIDTDGDGYISY 62
Query  64   EEFTVFARANRGLVKDVAKIF 84
            +EF+ FA ANRGL+KDVAKIF
Sbjct  63   QEFSDFASANRGLMKDVAKIF 83

Sequence Alignment: 11. Allergen Name: Bra r 5.0101 Sequence ID: P69197

 Score = 65.5 bits 371,  Expect = 2e-13
 Identities = 56/76 73%, Positives = 67/76 88%, Gaps = 0/76 0%
Query  9    AEHERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEIDTDGDGFISFEEFTV 68
            AEHERIFK+FD +GDGKIS++EL E LK LGSVTP+++ RMMA+IDTDGDG ISF+EFT 
Sbjct  4    AEHERIFKKFDTDGDGKISAAELEEALKKLGSVTPDDVTRMMAKIDTDGDGNISFQEFTE 63
Query  69   FARANRGLVKDVAKIF 84
            FA AN GL+KDVAK+F
Sbjct  64   FASANPGLMKDVAKVF 79

Sequence Alignment: 12. Allergen Name: Art v 5.0101 Sequence ID: AY904434

 Score = 63.4 bits 357,  Expect = 9e-13
 Identities = 55/82 67%, Positives = 68/82 82%, Gaps = 2/82 2%
Query  1    MADDPQEVAEHERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEIDTDGDGF 60
            MAD+ +  AE +RIF  FD NGDGKIS++ELGE+L  LGSV+PEE+Q MM E+DTDGDG+
Sbjct  1    MADEDK--AECDRIFGAFDKNGDGKISAAELGESLTKLGSVSPEEVQTMMDELDTDGDGY 58
Query  61   ISFEEFTVFARANRGLVKDVAKIF 84
            IS++EF  F  ANRGL+KDV KIF
Sbjct  59   ISYDEFAEFFNANRGLMKDVGKIF 82

Sequence Alignment: 13. Allergen Name: Phl p 7 Sequence ID: O82040

 Score = 63.3 bits 356,  Expect = 1e-12
 Identities = 57/78 73%, Positives = 64/78 82%, Gaps = 6/78 7%
Query  1    MADDPQEVAEHERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEIDTDGDGF 60
            MADD       ERIFKRFD NGDGKIS SEL + L+TLGS + +E+QRMMAEIDTDGDGF
Sbjct  1    MADD------MERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGF 54
Query  61   ISFEEFTVFARANRGLVKDVAKIF 84
            I F EF  F  AN GL+KDVAK+F
Sbjct  55   IDFNEFISFCNANPGLMKDVAKVF 78

Sequence Alignment: 14. Allergen Name: Cyn d 7 Sequence ID: P94092

 Score = 61.6 bits 345,  Expect = 3e-12
 Identities = 51/78 65%, Positives = 62/78 79%, Gaps = 0/78 0%
Query  7    EVAEHERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEIDTDGDGFISFEEF 66
            +  + E IFKRFD NGDGKIS +EL + L+TLGS + +E+QRMMAEIDTDGDGFI F+EF
Sbjct  3    DTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFDEF 62
Query  67   TVFARANRGLVKDVAKIF 84
              F  AN GL+KDVAK+F
Sbjct  63   ISFCNANPGLMKDVAKVF 80

Sequence Alignment: 15. Allergen Name: Cyn d 7 Sequence ID: CAA62634

 Score = 61.6 bits 345,  Expect = 3e-12
 Identities = 51/78 65%, Positives = 62/78 79%, Gaps = 0/78 0%
Query  7    EVAEHERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEIDTDGDGFISFEEF 66
            +  + E IFKRFD NGDGKIS +EL + L+TLGS + +E+QRMMAEIDTDGDGFI F+EF
Sbjct  5    DTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFDEF 64
Query  67   TVFARANRGLVKDVAKIF 84
              F  AN GL+KDVAK+F
Sbjct  65   ISFCNANPGLMKDVAKVF 82

Sequence Alignment: 16. Allergen Name: Amb a 10.0101 Sequence ID: Q2KN25

 Score = 48.3 bits 255,  Expect = 6e-08
 Identities = 38/67 56%, Positives = 51/67 76%, Gaps = 1/67 1%
Query  5    PQEVAEHERIFKRFDANGDGKISSSELGETLKTLGS-VTPEEIQRMMAEIDTDGDGFISF 63
            P +  E  +IF RFD NGDG+IS  EL   LK+LGS  +P+E++R+MAEID DGDGFIS+
Sbjct  12   PTDKEEVTKIFNRFDTNGDGQISEDELFAILKSLGSDTSPDEVKRVMAEIDADGDGFISL 71
Query  64   EEFTVFAR 71
            +EF +F +
Sbjct  72   DEFILFCK 79

Sequence Alignment: 17. Allergen Name: Jun o 4 Sequence ID: O64943

 Score = 47.8 bits 251,  Expect = 1e-07
 Identities = 42/77 54%, Positives = 56/77 72%, Gaps = 4/77 5%
Query  6    QEVAEHERIFKRFDANGDGKISSSELGETLKTLGS-VTPEEIQRMMAEIDTDGDGFISFE 64
            Q V E E +FK+FDANGDGKIS SEL + L++LGS V   E++ MM E D DGDG++S++
Sbjct  22   QSVHELEEVFKKFDANGDGKISGSELADILRSLGSDVGEAEVKAMMEEADADGDGYVSLQ 81
Query  65   EFTVFARANRGL-VKDVAKIF 84
            EF  +   N+G  VKD+   F
Sbjct  82   EFVDL--NNKGASVKDLKNAF 100

Sequence Alignment: 18. Allergen Name: Ole e 8 Sequence ID: AAF31152

 Score = 47.6 bits 250,  Expect = 1e-07
 Identities = 42/67 62%, Positives = 47/67 70%, Gaps = 1/67 1%
Query  6    QEVAEHERIFKRFDANGDGKISSSELGETLKTLGSVTP-EEIQRMMAEIDTDGDGFISFE 64
            QE  E + +F RFDANGDGKIS  EL   LK LGS T  EEI RMM EIDTD DGFI+ +
Sbjct  16   QEPNEVQGVFNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFINVQ 75
Query  65   EFTVFARA 72
            EF  F +A
Sbjct  76   EFAAFVKA 83

Sequence Alignment: 19. Allergen Name: Cup a 4.0101 Sequence ID: ABP87672

 Score = 47.5 bits 249,  Expect = 1e-07
 Identities = 41/78 52%, Positives = 54/78 69%, Gaps = 2/78 2%
Query  6    QEVAEHERIFKRFDANGDGKISSSELGETLKTLGSVTPE-EIQRMMAEIDTDGDGFISFE 64
            Q V E E +FK+FDANGDGKIS SEL + L+++GS   E E++ MM E DTDGDG++S++
Sbjct  34   QSVHELEEVFKKFDANGDGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQ 93
Query  65   EFTVFARANRGLVKDVAKIF 84
            EF V        VKD+   F
Sbjct  94   EF-VDLNIKGATVKDLKNAF 112

Sequence Alignment: 20. Allergen Name: Ole e 8 Sequence ID: Q9M7R0

 Score = 46.7 bits 244,  Expect = 2e-07
 Identities = 41/67 61%, Positives = 47/67 70%, Gaps = 1/67 1%
Query  6    QEVAEHERIFKRFDANGDGKISSSELGETLKTLGSVTP-EEIQRMMAEIDTDGDGFISFE 64
            QE  E + +F RFDANGDGKIS  EL   LK LGS T  EEI R+M EIDTD DGFI+ +
Sbjct  16   QEPNEVQGVFNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGFINVQ 75
Query  65   EFTVFARA 72
            EF  F +A
Sbjct  76   EFAAFVKA 83

Sequence Alignment: 21. Allergen Name: Tyr p 24.0101 Sequence ID: ACL36923

 Score = 34.5 bits 163,  Expect = 0.0008
 Identities = 27/64 42%, Positives = 41/64 64%, Gaps = 2/64 3%
Query  3    DDPQEVAEHER-IFKRFDANGDGKISSSELGETLKTLGS-VTPEEIQRMMAEIDTDGDGF 60
            +D + + E  R  F+ +D  G+G I +S L E L+ L   +T +E+  M+AEIDTDG G 
Sbjct  81   EDTEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTEDELDEMIAEIDTDGSGT 140
Query  61   ISFEEF 66
            + F+EF
Sbjct  141  VDFDEF 146

Sequence Alignment: 22. Allergen Name: Tyr p 34.0101 Sequence ID: D2DGW3

 Score = 34.5 bits 163,  Expect = 0.0008
 Identities = 27/64 42%, Positives = 41/64 64%, Gaps = 2/64 3%
Query  3    DDPQEVAEHER-IFKRFDANGDGKISSSELGETLKTLGS-VTPEEIQRMMAEIDTDGDGF 60
            +D + + E  R  F+ +D  G+G I +S L E L+ L   +T +E+  M+AEIDTDG G 
Sbjct  81   EDTEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTEDELDEMIAEIDTDGSGT 140
Query  61   ISFEEF 66
            + F+EF
Sbjct  141  VDFDEF 146

Sequence Alignment: 23. Allergen Name: Der f 39.0101 Sequence ID: QBF67841

 Score = 34.4 bits 162,  Expect = 0.0009
 Identities = 27/64 42%, Positives = 41/64 64%, Gaps = 2/64 3%
Query  3    DDPQEVAEHER-IFKRFDANGDGKISSSELGETLKTLGS-VTPEEIQRMMAEIDTDGDGF 60
            +D + + E  R  F+ +D  G+G I +S L E L+ L   +T +E+  M+AEIDTDG G 
Sbjct  81   EDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTNDELDEMIAEIDTDGSGT 140
Query  61   ISFEEF 66
            + F+EF
Sbjct  141  VDFDEF 146

Sequence Alignment: 24. Allergen Name: Der p 39.0101 Sequence ID: QXY82447

 Score = 34.4 bits 162,  Expect = 0.0009
 Identities = 27/64 42%, Positives = 41/64 64%, Gaps = 2/64 3%
Query  3    DDPQEVAEHER-IFKRFDANGDGKISSSELGETLKTLGS-VTPEEIQRMMAEIDTDGDGF 60
            +D + + E  R  F+ +D  G+G I +S L E L+ L   +T +E+  M+AEIDTDG G 
Sbjct  81   EDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTNDELDEMIAEIDTDGSGT 140
Query  61   ISFEEF 66
            + F+EF
Sbjct  141  VDFDEF 146

Sequence Alignment: 25. Allergen Name: Bla g 6.0201 Sequence ID: ABB89297

 Score = 33.9 bits 159,  Expect = 0.001
 Identities = 25/66 37%, Positives = 42/66 63%, Gaps = 3/66 4%
Query  1    MADDPQEVAEHE--RIFKRFDANGDGKISSSELGETLKTLGS-VTPEEIQRMMAEIDTDG 57
            + ++  E  +HE    F+ +D  G+G I+++ L E LK L   +T E++  M+ EID+DG
Sbjct  76   LVEEDAEAMQHELREAFRLYDKEGNGYITTAVLREILKELDDKITAEDLDMMIEEIDSDG 135
Query  58   DGFISFEEF 66
             G + F+EF
Sbjct  136  SGTVDFDEF 144

Sequence Alignment: 26. Allergen Name: Bla g 6.0101 Sequence ID: ABB89296

 Score = 32.6 bits 150,  Expect = 0.003
 Identities = 27/76 35%, Positives = 47/76 61%, Gaps = 3/76 3%
Query  5    PQEVAEHERIFKRFDANGDGKISSSELGETLKTLGSVTPEEI-QRMMAEIDTDGDGFISF 63
            P+++   ++ F  FD    G IS+  +G  L+ LG    +++ Q ++AE+D DG G + F
Sbjct  6    PEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDMLQEIIAEVDADGSGELEF 65
Query  64   EEFTVFARANRGLVKDVAK 82
            EEF  +A  +R LV++ A+
Sbjct  66   EEFVSLA--SRFLVEEDAE 82

Sequence Alignment: 27. Allergen Name: Per a 6.0101 Sequence ID: Q1M0Y3

 Score = 32.1 bits 147,  Expect = 0.004
 Identities = 24/66 36%, Positives = 42/66 63%, Gaps = 3/66 4%
Query  1    MADDPQEVAEHE--RIFKRFDANGDGKISSSELGETLKTLGS-VTPEEIQRMMAEIDTDG 57
            + ++  E  ++E    F+ +D  G+G I+++ L E LK L   +T E++  M+ EID+DG
Sbjct  76   LVEEDAEAMQQELKEAFRLYDKEGNGYITTTVLREILKELDDKLTNEDLDAMIEEIDSDG 135
Query  58   DGFISFEEF 66
             G + F+EF
Sbjct  136  SGTVDFDEF 144

Sequence Alignment: 28. Allergen Name: Bla g 6.0301 Sequence ID: ABB89298

 Score = 31.8 bits 145,  Expect = 0.005
 Identities = 25/66 37%, Positives = 39/66 59%, Gaps = 3/66 4%
Query  1    MADDPQEVAEHE--RIFKRFDANGDGKISSSELGETLKTLG-SVTPEEIQRMMAEIDTDG 57
            + ++  E  E E    F+ +D  G+G I +S L E L+ L   +T +E+  M+ EID DG
Sbjct  80   IIEEDSEAMEKELREAFRLYDKEGNGYIPTSCLREILRELDEQLTSDELDMMIEEIDADG 139
Query  58   DGFISFEEF 66
             G + F+EF
Sbjct  140  SGTVDFDEF 148

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.