The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MADEQLQLPPEQISVLRKAFDAFDREKSGSISTNMVEEILRLMGQPFNRRTLEELIDEVD
ADKSGRLEFDEFVTLAAKFIIEEDSEAMEKELREAFRLYDKEGNGYIPTSCLREILRELD
EQLTSDELDMMIEEIDADGSGTVDFDEFMEMMTG
Sequence Info Allergen Name Length Opt Bits Score E Value
ABB89298 Bla g 6.0301 154 988 155.4 6.4e-40
QBF67841 Der f 39.0101 153 712 115.0 9.3e-28
QXY82447 Der p 39.0101 153 709 114.6 1.3e-27
Q1M0Y3 Per a 6.0101 151 701 113.4 2.8e-27
D2DGW3 Tyr p 34.0101 153 699 113.1 3.5e-27
ACL36923 Tyr p 24.0101 153 699 113.1 3.5e-27
ABB89296 Bla g 6.0101 151 697 112.8 4.2e-27
ABB89297 Bla g 6.0201 151 676 109.7 3.5e-26
P29291 Hom a 6.0101 150 580 95.7 6e-22
ADV17344 Pen m 6.0101 150 561 92.9 4.1e-21
Q9M7R0 Ole e 8 171 291 53.4 3.7e-09
Q2KN25 Amb a 10.0101 160 289 53.1 4.2e-09
AAF31152 Ole e 8 171 289 53.1 4.6e-09
P85100 Bos d 13.0201 199 231 44.6 1.9e-06
P02604 Gal d 7.0101 192 214 42.1 1e-05
A0JNJ5 Bos d 13.0101 192 206 40.9 2.3e-05
J7HCX7 Pro c 5.0101 153 169 35.5 0.00079
O82040 Phl p 7 78 159 34.1 0.0011
P94092 Cyn d 7 80 156 33.6 0.0015
CAA62634 Cyn d 7 82 156 33.6 0.0015
AIO08852 Der f 26.0101 160 162 34.5 0.0017
O64943 Jun o 4 165 162 34.5 0.0017
A0A514C9K9 Scy p 3.0101 153 159 34.0 0.0022
ALE34025 Sal k 7.0101 86 152 33.1 0.0024
ABP87672 Cup a 4.0101 177 158 33.9 0.0028
P58171 Syr v 3 81 149 32.6 0.0031
Q39419 Bet v 4 85 149 32.6 0.0032
CAA73147 Bet v 4 85 149 32.6 0.0032
CAP05019 Par j 4.0101 84 148 32.5 0.0035
AAL92871 Che a 3 86 148 32.5 0.0036
O81092 Ole e 3 84 145 32.0 0.0048
P69197 Bra r 5.0101 79 144 31.9 0.005
O81701 Aln g 4 85 144 31.9 0.0054
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Bla g 6.0301 Sequence ID: ABB89298

 Score = 155.4 bits 988,  Expect = 6e-40
 Identities = 154/154 100%, Positives = 154/154 100%, Gaps = 0/154 0%
Query  1    MADEQLQLPPEQISVLRKAFDAFDREKSGSISTNMVEEILRLMGQPFNRRTLEELIDEVD 60
            MADEQLQLPPEQISVLRKAFDAFDREKSGSISTNMVEEILRLMGQPFNRRTLEELIDEVD
Sbjct  1    MADEQLQLPPEQISVLRKAFDAFDREKSGSISTNMVEEILRLMGQPFNRRTLEELIDEVD 60
Query  61   ADKSGRLEFDEFVTLAAKFIIEEDSEAMEKELREAFRLYDKEGNGYIPTSCLREILRELD 120
            ADKSGRLEFDEFVTLAAKFIIEEDSEAMEKELREAFRLYDKEGNGYIPTSCLREILRELD
Sbjct  61   ADKSGRLEFDEFVTLAAKFIIEEDSEAMEKELREAFRLYDKEGNGYIPTSCLREILRELD 120
Query  121  EQLTSDELDMMIEEIDADGSGTVDFDEFMEMMTG 154
            EQLTSDELDMMIEEIDADGSGTVDFDEFMEMMTG
Sbjct  121  EQLTSDELDMMIEEIDADGSGTVDFDEFMEMMTG 154

Sequence Alignment: 2. Allergen Name: Der f 39.0101 Sequence ID: QBF67841

 Score = 115.0 bits 712,  Expect = 9e-28
 Identities = 106/148 71%, Positives = 125/148 84%, Gaps = 0/148 0%
Query  7    QLPPEQISVLRKAFDAFDREKSGSISTNMVEEILRLMGQPFNRRTLEELIDEVDADKSGR 66
            +L  EQ+ +LRKAFD FDREK G I TNMV  ILR +GQ F  + L++LI E+DAD SG 
Sbjct  5    ELTKEQVQMLRKAFDMFDREKKGHIHTNMVSTILRTLGQTFEEKDLQQLITEIDADGSGE 64
Query  67   LEFDEFVTLAAKFIIEEDSEAMEKELREAFRLYDKEGNGYIPTSCLREILRELDEQLTSD 126
            LEFDEF+TL A+F++EED+EAM++ELREAFR+YDKEGNGYIPTS LREILR LD++LT+D
Sbjct  65   LEFDEFLTLTARFLVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTND 124
Query  127  ELDMMIEEIDADGSGTVDFDEFMEMMTG 154
            ELD MI EID DGSGTVDFDEFMEMMTG
Sbjct  125  ELDEMIAEIDTDGSGTVDFDEFMEMMTG 152

Sequence Alignment: 3. Allergen Name: Der p 39.0101 Sequence ID: QXY82447

 Score = 114.6 bits 709,  Expect = 1e-27
 Identities = 106/148 71%, Positives = 124/148 83%, Gaps = 0/148 0%
Query  7    QLPPEQISVLRKAFDAFDREKSGSISTNMVEEILRLMGQPFNRRTLEELIDEVDADKSGR 66
            +L  EQ+ +LRKAFD FDREK G I TNMV  ILR +GQ F  + L+ LI E+DAD SG 
Sbjct  5    ELTKEQVQMLRKAFDMFDREKKGHIHTNMVSTILRTLGQTFEEKDLQTLITEIDADGSGE 64
Query  67   LEFDEFVTLAAKFIIEEDSEAMEKELREAFRLYDKEGNGYIPTSCLREILRELDEQLTSD 126
            LEFDEF+TL A+F++EED+EAM++ELREAFR+YDKEGNGYIPTS LREILR LD++LT+D
Sbjct  65   LEFDEFLTLTARFLVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTND 124
Query  127  ELDMMIEEIDADGSGTVDFDEFMEMMTG 154
            ELD MI EID DGSGTVDFDEFMEMMTG
Sbjct  125  ELDEMIAEIDTDGSGTVDFDEFMEMMTG 152

Sequence Alignment: 4. Allergen Name: Per a 6.0101 Sequence ID: Q1M0Y3

 Score = 113.4 bits 701,  Expect = 3e-27
 Identities = 105/148 70%, Positives = 132/148 89%, Gaps = 0/148 0%
Query  7    QLPPEQISVLRKAFDAFDREKSGSISTNMVEEILRLMGQPFNRRTLEELIDEVDADKSGR 66
            +LP EQI +L+KAFDAFDREK+G IST+MV  IL ++G+P++   LEE+I EVDAD SG 
Sbjct  3    ELPDEQIQLLKKAFDAFDREKNGFISTDMVGTILEMLGHPLDDDMLEEIIAEVDADGSGE 62
Query  67   LEFDEFVTLAAKFIIEEDSEAMEKELREAFRLYDKEGNGYIPTSCLREILRELDEQLTSD 126
            LEF EFVTLAA+F++EED+EAM++EL+EAFRLYDKEGNGYI T+ LREIL+ELD++LT++
Sbjct  63   LEFQEFVTLAARFLVEEDAEAMQQELKEAFRLYDKEGNGYITTTVLREILKELDDKLTNE 122
Query  127  ELDMMIEEIDADGSGTVDFDEFMEMMTG 154
            +LD MIEEID+DGSGTVDFDEFME+MTG
Sbjct  123  DLDAMIEEIDSDGSGTVDFDEFMEVMTG 150

Sequence Alignment: 5. Allergen Name: Tyr p 34.0101 Sequence ID: D2DGW3

 Score = 113.1 bits 699,  Expect = 3e-27
 Identities = 105/148 70%, Positives = 123/148 83%, Gaps = 0/148 0%
Query  7    QLPPEQISVLRKAFDAFDREKSGSISTNMVEEILRLMGQPFNRRTLEELIDEVDADKSGR 66
            +L  EQ+ +LRKAFD FDR+K G I TNMV  ILR +GQ F    L++LI E+DAD SG 
Sbjct  5    ELSKEQVQMLRKAFDMFDRDKKGYIHTNMVSTILRTLGQTFEENDLQQLIIEIDADGSGE 64
Query  67   LEFDEFVTLAAKFIIEEDSEAMEKELREAFRLYDKEGNGYIPTSCLREILRELDEQLTSD 126
            LEFDEF+TL A+F++EED+EAM++ELREAFR+YDKEGNGYIPTS LREILR LD++LT D
Sbjct  65   LEFDEFLTLTARFLVEEDTEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTED 124
Query  127  ELDMMIEEIDADGSGTVDFDEFMEMMTG 154
            ELD MI EID DGSGTVDFDEFMEMMTG
Sbjct  125  ELDEMIAEIDTDGSGTVDFDEFMEMMTG 152

Sequence Alignment: 6. Allergen Name: Tyr p 24.0101 Sequence ID: ACL36923

 Score = 113.1 bits 699,  Expect = 3e-27
 Identities = 105/148 70%, Positives = 123/148 83%, Gaps = 0/148 0%
Query  7    QLPPEQISVLRKAFDAFDREKSGSISTNMVEEILRLMGQPFNRRTLEELIDEVDADKSGR 66
            +L  EQ+ +LRKAFD FDR+K G I TNMV  ILR +GQ F    L++LI E+DAD SG 
Sbjct  5    ELSKEQVQMLRKAFDMFDRDKKGYIHTNMVSTILRTLGQTFEENDLQQLIIEIDADGSGE 64
Query  67   LEFDEFVTLAAKFIIEEDSEAMEKELREAFRLYDKEGNGYIPTSCLREILRELDEQLTSD 126
            LEFDEF+TL A+F++EED+EAM++ELREAFR+YDKEGNGYIPTS LREILR LD++LT D
Sbjct  65   LEFDEFLTLTARFLVEEDTEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTED 124
Query  127  ELDMMIEEIDADGSGTVDFDEFMEMMTG 154
            ELD MI EID DGSGTVDFDEFMEMMTG
Sbjct  125  ELDEMIAEIDTDGSGTVDFDEFMEMMTG 152

Sequence Alignment: 7. Allergen Name: Bla g 6.0101 Sequence ID: ABB89296

 Score = 112.8 bits 697,  Expect = 4e-27
 Identities = 103/148 69%, Positives = 132/148 89%, Gaps = 0/148 0%
Query  7    QLPPEQISVLRKAFDAFDREKSGSISTNMVEEILRLMGQPFNRRTLEELIDEVDADKSGR 66
            +LPPEQI +L+KAFDAFDREK G IST MV  IL ++G+ ++   L+E+I EVDAD SG 
Sbjct  3    ELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDMLQEIIAEVDADGSGE 62
Query  67   LEFDEFVTLAAKFIIEEDSEAMEKELREAFRLYDKEGNGYIPTSCLREILRELDEQLTSD 126
            LEF+EFV+LA++F++EED+EAM++ELREAFRLYDKEGNGYI T+ LREIL+ELD+++T++
Sbjct  63   LEFEEFVSLASRFLVEEDAEAMQQELREAFRLYDKEGNGYITTNVLREILKELDDKITAE 122
Query  127  ELDMMIEEIDADGSGTVDFDEFMEMMTG 154
            +LDMMIEEID+DGSGTVDFDEFME+MTG
Sbjct  123  DLDMMIEEIDSDGSGTVDFDEFMEVMTG 150

Sequence Alignment: 8. Allergen Name: Bla g 6.0201 Sequence ID: ABB89297

 Score = 109.7 bits 676,  Expect = 4e-26
 Identities = 100/148 67%, Positives = 129/148 87%, Gaps = 0/148 0%
Query  7    QLPPEQISVLRKAFDAFDREKSGSISTNMVEEILRLMGQPFNRRTLEELIDEVDADKSGR 66
            ++P EQ+ +L+KAFDAFDREK G IST MV  IL ++G  +++  L+E+I EVDAD SG 
Sbjct  3    EIPAEQVVLLKKAFDAFDREKKGCISTEMVGTILEMLGTRLDQDMLDEIIAEVDADGSGE 62
Query  67   LEFDEFVTLAAKFIIEEDSEAMEKELREAFRLYDKEGNGYIPTSCLREILRELDEQLTSD 126
            LEF+EF TLA++F++EED+EAM+ ELREAFRLYDKEGNGYI T+ LREIL+ELD+++T++
Sbjct  63   LEFEEFCTLASRFLVEEDAEAMQHELREAFRLYDKEGNGYITTAVLREILKELDDKITAE 122
Query  127  ELDMMIEEIDADGSGTVDFDEFMEMMTG 154
            +LDMMIEEID+DGSGTVDFDEFME+MTG
Sbjct  123  DLDMMIEEIDSDGSGTVDFDEFMEVMTG 150

Sequence Alignment: 9. Allergen Name: Hom a 6.0101 Sequence ID: P29291

 Score = 95.7 bits 580,  Expect = 6e-22
 Identities = 88/147 59%, Positives = 113/147 76%, Gaps = 0/147 0%
Query  8    LPPEQISVLRKAFDAFDREKSGSISTNMVEEILRLMGQPFNRRTLEELIDEVDADKSGRL 67
            L  EQ+S L+KAFD+FD +  G I+   V  ILR+MG   + + L+E+I E D D SG L
Sbjct  4    LDAEQLSALQKAFDSFDTDSKGFITPETVGVILRMMGVKISEKNLQEVISETDEDGSGEL 63
Query  68   EFDEFVTLAAKFIIEEDSEAMEKELREAFRLYDKEGNGYIPTSCLREILRELDEQLTSDE 127
            EF+EFV LAAKF+IEED EA++ ELREAFR+YD+ GNGYI T  L+EILRELD +LT ++
Sbjct  64   EFEEFVELAAKFLIEEDEEALKAELREAFRVYDRGGNGYITTDVLKEILRELDNRLTEED 123
Query  128  LDMMIEEIDADGSGTVDFDEFMEMMTG 154
            LD +IEE+D DGSGT+DF+EFM+MM G
Sbjct  124  LDSIIEEVDEDGSGTLDFNEFMQMMNG 150

Sequence Alignment: 10. Allergen Name: Pen m 6.0101 Sequence ID: ADV17344

 Score = 92.9 bits 561,  Expect = 4e-21
 Identities = 88/147 59%, Positives = 111/147 75%, Gaps = 0/147 0%
Query  8    LPPEQISVLRKAFDAFDREKSGSISTNMVEEILRLMGQPFNRRTLEELIDEVDADKSGRL 67
            L  EQI  LRKAF++FD E +GSI+   V  ILR+MG   + + L+E+I E D D SG L
Sbjct  4    LDEEQIETLRKAFNSFDTEGAGSINAETVGVILRMMGVKISEKNLQEVIAETDEDGSGML 63
Query  68   EFDEFVTLAAKFIIEEDSEAMEKELREAFRLYDKEGNGYIPTSCLREILRELDEQLTSDE 127
            EF+EF  LAAKF+IEED EA++ ELREAFR+YDK+  GYI T  L+EIL ELD +LT  +
Sbjct  64   EFEEFAELAAKFLIEEDEEALKAELREAFRIYDKDCQGYITTDILKEILVELDPKLTPTD 123
Query  128  LDMMIEEIDADGSGTVDFDEFMEMMTG 154
            L+ +IEE+D DGSGT+DFDEFMEMM+G
Sbjct  124  LEGIIEEVDEDGSGTLDFDEFMEMMSG 150

Sequence Alignment: 11. Allergen Name: Ole e 8 Sequence ID: Q9M7R0

 Score = 53.4 bits 291,  Expect = 4e-09
 Identities = 50/144 34%, Positives = 79/144 54%, Gaps = 4/144 2%
Query  6    LQLPPEQISVLRKAFDAFDREKSGSISTNMVEEILRLMGQPFNRRTLEELIDEVDADKSG 65
            LQ P E    ++  F+ FD    G IS + +  +L+ +G   ++  +  +++E+D DK G
Sbjct  15   LQEPNE----VQGVFNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDG 70
Query  66   RLEFDEFVTLAAKFIIEEDSEAMEKELREAFRLYDKEGNGYIPTSCLREILRELDEQLTS 125
             +   EF  +         S   E EL+EAF LYD++ NG I +  L +IL  L E+   
Sbjct  71   FINVQEFAAFVKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERYAE 130
Query  126  DELDMMIEEIDADGSGTVDFDEFMEMMT 153
             +   MI+ +D+DG G V F+EF +MMT
Sbjct  131  HDCVEMIKSVDSDGDGYVSFEEFKKMMT 158

Sequence Alignment: 12. Allergen Name: Amb a 10.0101 Sequence ID: Q2KN25

 Score = 53.1 bits 289,  Expect = 4e-09
 Identities = 51/141 36%, Positives = 81/141 57%, Gaps = 3/141 2%
Query  10   PEQISVLRKAFDAFDREKSGSISTNMVEEILRLMGQPFNRRTLEELIDEVDADKSGRLEF 69
            P     + K F+ FD    G IS + +  IL+ +G   +   ++ ++ E+DAD  G + +
Sbjct  12   PTDKEEVTKIFNRFDTNGDGQISEDELFAILKSLGSDTSPDEVKRVMAEIDADGDGFISL 71
Query  70   DEFVTLAAKFIIEEDSEAMEKELREAFRLYDKEGNGYIPTSCLREILRELDEQLTSDELD 129
            DEF+ L  K I  E  E    +L+EAF++YD+  NG I  + L +IL  L E  + +   
Sbjct  72   DEFI-LFCKGIESEGDEI--NDLKEAFKFYDQNNNGVISANELHQILGRLGENYSVESCA 128
Query  130  MMIEEIDADGSGTVDFDEFMEMMT 153
             MI+ +D+DG G VDF+EF +MM+
Sbjct  129  DMIKSVDSDGDGFVDFEEFRKMMS 152

Sequence Alignment: 13. Allergen Name: Ole e 8 Sequence ID: AAF31152

 Score = 53.1 bits 289,  Expect = 5e-09
 Identities = 50/144 34%, Positives = 78/144 54%, Gaps = 4/144 2%
Query  6    LQLPPEQISVLRKAFDAFDREKSGSISTNMVEEILRLMGQPFNRRTLEELIDEVDADKSG 65
            LQ P E    ++  F+ FD    G IS + +   L+ +G   ++  +  +++E+D DK G
Sbjct  15   LQEPNE----VQGVFNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDG 70
Query  66   RLEFDEFVTLAAKFIIEEDSEAMEKELREAFRLYDKEGNGYIPTSCLREILRELDEQLTS 125
             +   EF  +         S   E EL+EAF LYD++ NG I +  L +IL  L E+   
Sbjct  71   FINVQEFAAFVKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERYAE 130
Query  126  DELDMMIEEIDADGSGTVDFDEFMEMMT 153
             +   MI+ +D+DG G V F+EF +MMT
Sbjct  131  HDCVEMIKSVDSDGDGYVSFEEFKKMMT 158

Sequence Alignment: 14. Allergen Name: Bos d 13.0201 Sequence ID: P85100

 Score = 44.6 bits 231,  Expect = 2e-06
 Identities = 44/148 29%, Positives = 85/148 57%, Gaps = 7/148 4%
Query  5    QLQLPPEQISVLRKAFDAFDREKSG--SISTNMVEEILRLMGQ-PFNRRTLEELIDEVDA 61
            ++++ PEQI  +++AF  FDR       I+     ++LR +GQ P     L  L      
Sbjct  47   KIEFTPEQIEEFKEAFTLFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQE 106
Query  62   DKSGRL-EFDEFVTLAAKFIIEEDSEAMEKELREAFRLYDKEGNGYIPTSCLREILRELD 120
            + + ++ +FD F+ +       +D+   E ++ E +R++DKEGNG +  + LR +L  L 
Sbjct  107  ELNSKMMDFDTFLPMLQHISKNKDTGTYE-DFVEGLRVFDKEGNGTVMGAELRHVLATLG 165
Query  121  EQLTSDELDMMIEEIDADGSGTVDFDEFME-MMTG 154
            E+LT DE++ ++     D +G ++++ F++ +M G
Sbjct  166  EKLTEDEVEKLMAG-QEDSNGCINYEAFVKHIMAG 199

Sequence Alignment: 15. Allergen Name: Gal d 7.0101 Sequence ID: P02604

 Score = 42.1 bits 214,  Expect = 1e-05
 Identities = 36/146 24%, Positives = 85/146 58%, Gaps = 4/146 2%
Query  5    QLQLPPEQISVLRKAFDAFDREKSGSISTNMVEEILRLMGQPFNRRTLEELIDEVDADK- 63
            ++++  EQ   +++AF  FDR     I+ + V +I+R +GQ      + +++     ++ 
Sbjct  42   KIEFSKEQQDDFKEAFLLFDRTGDAKITLSQVGDIVRALGQNPTNAEINKILGNPSKEEM 101
Query  64   -SGRLEFDEFVTLAAKFIIEEDSEAMEKELREAFRLYDKEGNGYIPTSCLREILRELDEQ 122
             + ++ F+EF+ +       +D    E ++ E +R++DKEGNG +  + LR +L  L E+
Sbjct  102  NAKKITFEEFLPMLQAAANNKDQGTFE-DFVEGLRVFDKEGNGTVMGAELRHVLATLGEK 160
Query  123  LTSDELDMMIEEIDADGSGTVDFDEFMEMM 152
            +T +E++ +++    D +G ++++ F++ +
Sbjct  161  MTEEEVEELMKG-QEDSNGCINYEAFVKHI 189

Sequence Alignment: 16. Allergen Name: Bos d 13.0101 Sequence ID: A0JNJ5

 Score = 40.9 bits 206,  Expect = 2e-05
 Identities = 36/146 24%, Positives = 84/146 57%, Gaps = 4/146 2%
Query  5    QLQLPPEQISVLRKAFDAFDREKSGSISTNMVEEILRLMG-QPFNRRTLEELIDEVDADK 63
            ++++  +Q   +++AF  FDR     I+ + V ++LR +G  P N    + L +  + + 
Sbjct  42   KIEFSKQQQDEFKEAFLLFDRTGECKITLSQVGDVLRALGTNPTNAEVKKVLGNPSNEEM 101
Query  64   SGR-LEFDEFVTLAAKFIIEEDSEAMEKELREAFRLYDKEGNGYIPTSCLREILRELDEQ 122
            + + +EF++F+ +       +D    E ++ E +R++DKEGNG +  + LR +L  L E+
Sbjct  102  NAKKIEFEQFLPMLQAISNNKDQGTYE-DFVEGLRVFDKEGNGTVMGAELRHVLATLGEK 160
Query  123  LTSDELDMMIEEIDADGSGTVDFDEFMEMM 152
            +  +E++ ++     D +G ++++ F++ +
Sbjct  161  MKEEEVEALMAG-QEDSNGCINYEAFVKHI 189

Sequence Alignment: 17. Allergen Name: Pro c 5.0101 Sequence ID: J7HCX7

 Score = 35.5 bits 169,  Expect = 0.0008
 Identities = 36/144 25%, Positives = 78/144 54%, Gaps = 4/144 2%
Query  8    LPPEQISVLRKAFDAFDREKSGSISTNMVEEILRLMGQPFNRRTLEELIDEVDADKSGRL 67
            L    +  ++ AF  +D E +G++    + + LR +        +E+ +   +  K   +
Sbjct  5    LSARDVERVKFAFSIYDFEGNGTMDAFYIGDCLRALNLNPTLAIIEK-VGGKEKRKEKII 63
Query  68   EFDEFVTLAAKFIIEEDSEAMEKELREAFRLYDKEGNGYIPTSCLREILRELDEQLTSDE 127
            +++EF+ + A+   ++D+ + E ++ E ++LYDK  NG +  + L  IL  L E+L   E
Sbjct  64   KLEEFIPIFAQVKKDKDAGSYE-DFMEVLKLYDKSENGTMMYAELEHILLSLGERLEKSE 122
Query  128  LDMMIEEI--DADGSGTVDFDEFMEMMT 153
            L+ +++E   + D  G + ++ F++ MT
Sbjct  123  LEPVLKECCNEEDEDGFIPYEPFLKKMT 150

Sequence Alignment: 18. Allergen Name: Phl p 7 Sequence ID: O82040

 Score = 34.1 bits 159,  Expect = 0.001
 Identities = 24/61 39%, Positives = 37/61 60%, Gaps = 1/61 1%
Query  88   MEKELREAFRLYDKEGNGYIPTSCLREILRELDEQLTSDELDMMIEEIDADGSGTVDFDE 147
            M  ++   F+ +D  G+G I  S L + LR L    ++DE+  M+ EID DG G +DF+E
Sbjct  1    MADDMERIFKRFDTNGDGKISLSELTDALRTLG-STSADEVQRMMAEIDTDGDGFIDFNE 59
Query  148  FM 149
            F+
Sbjct  60   FI 61

Sequence Alignment: 19. Allergen Name: Cyn d 7 Sequence ID: P94092

 Score = 33.6 bits 156,  Expect = 0.001
 Identities = 23/58 39%, Positives = 36/58 62%, Gaps = 1/58 1%
Query  91   ELREAFRLYDKEGNGYIPTSCLREILRELDEQLTSDELDMMIEEIDADGSGTVDFDEFM 149
            ++   F+ +D  G+G I  + L + LR L    ++DE+  M+ EID DG G +DFDEF+
Sbjct  6    DMEHIFKRFDTNGDGKISLAELTDALRTLG-STSADEVQRMMAEIDTDGDGFIDFDEFI 63

Sequence Alignment: 20. Allergen Name: Cyn d 7 Sequence ID: CAA62634

 Score = 33.6 bits 156,  Expect = 0.002
 Identities = 23/58 39%, Positives = 36/58 62%, Gaps = 1/58 1%
Query  91   ELREAFRLYDKEGNGYIPTSCLREILRELDEQLTSDELDMMIEEIDADGSGTVDFDEFM 149
            ++   F+ +D  G+G I  + L + LR L    ++DE+  M+ EID DG G +DFDEF+
Sbjct  8    DMEHIFKRFDTNGDGKISLAELTDALRTLG-STSADEVQRMMAEIDTDGDGFIDFDEFI 65

Sequence Alignment: 21. Allergen Name: Der f 26.0101 Sequence ID: AIO08852

 Score = 34.5 bits 162,  Expect = 0.002
 Identities = 42/146 28%, Positives = 81/146 55%, Gaps = 13/146 8%
Query  1    MADEQLQLPPEQISVLRKAFDAFDREKSGSISTNMVEEILRLMGQPFNRRTLEELIDEVD 60
            MAD +   PPE +   R  FD +D +    +  + + ++LR +     R T + +     
Sbjct  1    MADLR---PPE-VEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDL---RPTQDSVAKNGW 53
Query  61   ADKSGR--LEFDEFVTLAAKFIIEEDSEAMEKELREAFRLYDKEGNGYIPTSCLREILRE 118
              K G+  + F+EF+ + ++   ++D  A E +L E +++YDK  NG +  + L  +L  
Sbjct  54   EKKKGQKFMTFEEFLPIYSQVKKDKDCGAFE-DLVEGLKVYDKAENGTMMEAELAHVLLS 112
Query  119  LDEQLTSDELDMMIEEIDA--DGSGTVDFDEFME-MMTG 154
            L E+LT  E++ +I+      D  G + ++ F++ +M G
Sbjct  113  LGEKLTDAEVEEIIKTCGGGCDDEGFMKYETFIKNVMAG 151

Sequence Alignment: 22. Allergen Name: Jun o 4 Sequence ID: O64943

 Score = 34.5 bits 162,  Expect = 0.002
 Identities = 44/136 32%, Positives = 73/136 53%, Gaps = 7/136 5%
Query  11   EQISVLRKAFDAFDREKSGSISTNMVEEILRLMGQPFNRRTLEELIDEVDADKSGRLEFD 70
            + +  L + F  FD    G IS + + +ILR +G       ++ +++E DAD  G + + 
Sbjct  22   QSVHELEEVFKKFDANGDGKISGSELADILRSLGSDVGEAEVKAMMEEADADGDGYVSLQ 81
Query  71   EFVTLAAKFIIEEDSEAMEKELREAFRLYDKEGNGYIPTSCLREILRELDEQLTSDELDM 130
            EFV L  K        A  K+L+ AF+++D++ NG I  + L   L  + E  T +E   
Sbjct  82   EFVDLNNK-------GASVKDLKNAFKVFDRDCNGSISAAELCHTLESVGEPCTIEESKN 134
Query  131  MIEEIDADGSGTVDFDEFMEMMT 153
            +I  +D +G G +  +EF  MMT
Sbjct  135  IIHNVDKNGDGLISVEEFQTMMT 157

Sequence Alignment: 23. Allergen Name: Scy p 3.0101 Sequence ID: A0A514C9K9

 Score = 34.0 bits 159,  Expect = 0.002
 Identities = 35/133 26%, Positives = 72/133 54%, Gaps = 4/133 3%
Query  19   AFDAFDREKSGSISTNMVEEILRLMGQPFNRRTLEELIDEVDADKSGRLEFDEFVTLAAK 78
            AF  +D E  G++    V + LR +        +E++  +    K   L+ D+F+ + A+
Sbjct  16   AFSIYDFEGKGTMDAFYVGDCLRALNLNPTLAVIEKVGGKTKK-KEKMLKVDDFLPIFAQ 74
Query  79   FIIEEDSEAMEKELREAFRLYDKEGNGYIPTSCLREILRELDEQLTSDELDMMIEEI--D 136
               ++D+ + E ++ E ++LYDK  NG +  + L  IL  L E+L   EL+ ++++   +
Sbjct  75   VKKDKDAGSFE-DFMEVLKLYDKTENGTMLYAELEHILLSLGERLEKSELEPVLKDCCDE 133
Query  137  ADGSGTVDFDEFMEMMT 153
             D  G + ++ F++ +T
Sbjct  134  EDEDGFIPYEPFLKKLT 150

Sequence Alignment: 24. Allergen Name: Sal k 7.0101 Sequence ID: ALE34025

 Score = 33.1 bits 152,  Expect = 0.002
 Identities = 26/67 38%, Positives = 39/67 58%, Gaps = 1/67 1%
Query  83   EDSEAMEKELREAFRLYDKEGNGYIPTSCLREILRELDEQLTSDELDMMIEEIDADGSGT 142
            ED+     +    F+ +D  G+G I +S L + L+ L   +TSDE+  M+ EID DG G 
Sbjct  4    EDTPQDLADRERIFKRFDTNGDGKISSSELGDALKTLG-SVTSDEIVRMMAEIDTDGDGF 62
Query  143  VDFDEFME 150
            + F+EF E
Sbjct  63   ISFEEFTE 70

Sequence Alignment: 25. Allergen Name: Cup a 4.0101 Sequence ID: ABP87672

 Score = 33.9 bits 158,  Expect = 0.003
 Identities = 44/136 32%, Positives = 75/136 55%, Gaps = 7/136 5%
Query  11   EQISVLRKAFDAFDREKSGSISTNMVEEILRLMGQPFNRRTLEELIDEVDADKSGRLEFD 70
            + +  L + F  FD    G IS + + +ILR MG   +   ++ +++E D D  G + + 
Sbjct  34   QSVHELEEVFKKFDANGDGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQ 93
Query  71   EFVTLAAKFIIEEDSEAMEKELREAFRLYDKEGNGYIPTSCLREILRELDEQLTSDELDM 130
            EFV L  K        A  K+L+ AF+++D++ NG I  + L + L+ + E  T +E   
Sbjct  94   EFVDLNIK-------GATVKDLKNAFKVFDRDCNGTISPAELCQTLKSMGEPCTIEESKN 146
Query  131  MIEEIDADGSGTVDFDEFMEMMT 153
            +I  +D +G G +  +EF  MMT
Sbjct  147  IIHNVDKNGDGLISVEEFQTMMT 169

Sequence Alignment: 26. Allergen Name: Syr v 3 Sequence ID: P58171

 Score = 32.6 bits 149,  Expect = 0.003
 Identities = 24/57 42%, Positives = 35/57 61%, Gaps = 1/57 1%
Query  91   ELREAFRLYDKEGNGYIPTSCLREILRELDEQLTSDELDMMIEEIDADGSGTVDFDEF 148
            EL   F+ +D  G+G I +S L E L+ L   +T +E+  M+ EID DG G + F+EF
Sbjct  7    ELERIFKRFDANGDGKISSSELGETLKTLG-SVTPEEIQRMMAEIDTDGDGFISFEEF 63

Sequence Alignment: 27. Allergen Name: Bet v 4 Sequence ID: Q39419

 Score = 32.6 bits 149,  Expect = 0.003
 Identities = 26/66 39%, Positives = 37/66 56%, Gaps = 2/66 3%
Query  84   DSEAMEKELRE-AFRLYDKEGNGYIPTSCLREILRELDEQLTSDELDMMIEEIDADGSGT 142
            D    +K  RE  F+ +D  G+G I  + L E L+ L   +T DE+  M+ EID DG G 
Sbjct  3    DDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLG-SITPDEVKHMMAEIDTDGDGF 61
Query  143  VDFDEFME 150
            + F EF +
Sbjct  62   ISFQEFTD 69

Sequence Alignment: 28. Allergen Name: Bet v 4 Sequence ID: CAA73147

 Score = 32.6 bits 149,  Expect = 0.003
 Identities = 26/66 39%, Positives = 37/66 56%, Gaps = 2/66 3%
Query  84   DSEAMEKELRE-AFRLYDKEGNGYIPTSCLREILRELDEQLTSDELDMMIEEIDADGSGT 142
            D    +K  RE  F+ +D  G+G I  + L E L+ L   +T DE+  M+ EID DG G 
Sbjct  3    DDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLG-SITPDEVKHMMAEIDTDGDGF 61
Query  143  VDFDEFME 150
            + F EF +
Sbjct  62   ISFQEFTD 69

Sequence Alignment: 29. Allergen Name: Par j 4.0101 Sequence ID: CAP05019

 Score = 32.5 bits 148,  Expect = 0.004
 Identities = 24/64 37%, Positives = 37/64 57%, Gaps = 1/64 1%
Query  84   DSEAMEKELREAFRLYDKEGNGYIPTSCLREILRELDEQLTSDELDMMIEEIDADGSGTV 143
            D +    E    F+ +D  G+G I +S L E L+ L   +T+DE+  M+ EID DG G +
Sbjct  3    DKQIDRAEQERIFKRFDSNGDGKISSSELGEALKALG-SVTADEVHRMMAEIDTDGDGAI 61
Query  144  DFDEF 148
             ++EF
Sbjct  62   SLEEF 66

Sequence Alignment: 30. Allergen Name: Che a 3 Sequence ID: AAL92871

 Score = 32.5 bits 148,  Expect = 0.004
 Identities = 25/67 37%, Positives = 38/67 56%, Gaps = 1/67 1%
Query  83   EDSEAMEKELREAFRLYDKEGNGYIPTSCLREILRELDEQLTSDELDMMIEEIDADGSGT 142
            ED+     +    F+ +D  G+G I +S L + L+ L   +T DE+  M+ EID DG G 
Sbjct  4    EDTPQDIADRERIFKRFDTNGDGKISSSELGDALKTLG-SVTPDEVRRMMAEIDTDGDGF 62
Query  143  VDFDEFME 150
            + FDEF +
Sbjct  63   ISFDEFTD 70

Sequence Alignment: 31. Allergen Name: Ole e 3 Sequence ID: O81092

 Score = 32.0 bits 145,  Expect = 0.005
 Identities = 25/66 37%, Positives = 39/66 59%, Gaps = 3/66 4%
Query  80   IIEEDSEAMEKELREAFRLYDKEGNGYIPTSCLREILRELDEQLTSDELDMMIEEIDADG 139
            + ++  E  E E    F+ +D  G+G I +S L E L+ L   +T +E+  M+ EID DG
Sbjct  1    MADDPQEVAEHE--RIFKRFDANGDGKISSSELGETLKTLG-SVTPEEIQRMMAEIDTDG 57
Query  140  SGTVDFDEF 148
             G + F+EF
Sbjct  58   DGFISFEEF 66

Sequence Alignment: 32. Allergen Name: Bra r 5.0101 Sequence ID: P69197

 Score = 31.9 bits 144,  Expect = 0.005
 Identities = 22/64 34%, Positives = 37/64 57%, Gaps = 1/64 1%
Query  89   EKELREAFRLYDKEGNGYIPTSCLREILRELDEQLTSDELDMMIEEIDADGSGTVDFDEF 148
            + E    F+ +D +G+G I  + L E L++L   +T D++  M+ +ID DG G + F EF
Sbjct  3    DAEHERIFKKFDTDGDGKISAAELEEALKKLG-SVTPDDVTRMMAKIDTDGDGNISFQEF 61
Query  149  MEMMT 153
             E  +
Sbjct  62   TEFAS 66

Sequence Alignment: 33. Allergen Name: Aln g 4 Sequence ID: O81701

 Score = 31.9 bits 144,  Expect = 0.005
 Identities = 24/67 35%, Positives = 36/67 53%, Gaps = 1/67 1%
Query  81   IEEDSEAMEKELREAFRLYDKEGNGYIPTSCLREILRELDEQLTSDELDMMIEEIDADGS 140
            + +D    + E    F+ +D  G+G I  S L + L+ L   +T DE+  M+ EID DG 
Sbjct  1    MADDHPQDQAEHERIFKCFDANGDGKISASELGDALKTLG-SVTPDEVKHMMAEIDTDGD 59
Query  141  GTVDFDEF 148
            G + F EF
Sbjct  60   GFISFQEF 67

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.