The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MADLRPPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSVAKNGWEKKKGQK
FMTFEEFLPIYSQVKKDKDCGAFEDLVEGLKVYDKAENGTMMEAELAHVLLSLGEKLTDA
EVEEIIKTCGGGCDDEGFMKYETFIKNVMAGPFPEEAGKS
Sequence Info Allergen Name Length Opt Bits Score E Value
AIO08852 Der f 26.0101 160 1080 224.2 1.3e-60
QAT18638 Der p 26.0101 121 731 154.8 7.7e-40
A0A514C9K9 Scy p 3.0101 153 516 111.9 8.2e-27
J7HCX7 Pro c 5.0101 153 516 111.9 8.2e-27
A7L499 Art fr 5.0101 144 472 103.2 3.3e-24
P85100 Bos d 13.0201 199 393 87.3 2.8e-19
P02604 Gal d 7.0101 192 379 84.5 1.8e-18
A0JNJ5 Bos d 13.0101 192 355 79.7 5e-17
Q2KN25 Amb a 10.0101 160 192 47.3 2.3e-07
ACL36923 Tyr p 24.0101 153 188 46.6 3.8e-07
D2DGW3 Tyr p 34.0101 153 188 46.6 3.8e-07
QBF67841 Der f 39.0101 153 181 45.2 1e-06
ADV17344 Pen m 6.0101 150 180 45.0 1.1e-06
QXY82447 Der p 39.0101 153 178 44.6 1.5e-06
ABB89296 Bla g 6.0101 151 177 44.4 1.7e-06
Q9M7R0 Ole e 8 171 174 43.7 3.1e-06
AAF31152 Ole e 8 171 174 43.7 3.1e-06
ABB89297 Bla g 6.0201 151 170 43.0 4.5e-06
O64943 Jun o 4 165 166 42.1 8.8e-06
ABB89298 Bla g 6.0301 154 162 41.4 1.4e-05
P29291 Hom a 6.0101 150 161 41.2 1.5e-05
ABP87672 Cup a 4.0101 177 161 41.1 1.9e-05
H6WP59 Per a 8.0101 208 120 32.9 0.0069
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Der f 26.0101 Sequence ID: AIO08852

 Score = 224.2 bits 1080,  Expect = 1e-60
 Identities = 160/160 100%, Positives = 160/160 100%, Gaps = 0/160 0%
Query  1    MADLRPPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSVAKNGWEKKKGQK 60
            MADLRPPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSVAKNGWEKKKGQK
Sbjct  1    MADLRPPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSVAKNGWEKKKGQK 60
Query  61   FMTFEEFLPIYSQVKKDKDCGAFEDLVEGLKVYDKAENGTMMEAELAHVLLSLGEKLTDA 120
            FMTFEEFLPIYSQVKKDKDCGAFEDLVEGLKVYDKAENGTMMEAELAHVLLSLGEKLTDA
Sbjct  61   FMTFEEFLPIYSQVKKDKDCGAFEDLVEGLKVYDKAENGTMMEAELAHVLLSLGEKLTDA 120
Query  121  EVEEIIKTCGGGCDDEGFMKYETFIKNVMAGPFPEEAGKS 160
            EVEEIIKTCGGGCDDEGFMKYETFIKNVMAGPFPEEAGKS
Sbjct  121  EVEEIIKTCGGGCDDEGFMKYETFIKNVMAGPFPEEAGKS 160

Sequence Alignment: 2. Allergen Name: Der p 26.0101 Sequence ID: QAT18638

 Score = 154.8 bits 731,  Expect = 8e-40
 Identities = 108/115 93%, Positives = 112/115 97%, Gaps = 0/115 0%
Query  1    MADLRPPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSVAKNGWEKKKGQK 60
            MADLRPPEVEKARLHFDIYDF+GQ KVDYH LGDLLRSLDLRPTQ+ VAKNGWEKKKGQK
Sbjct  1    MADLRPPEVEKARLHFDIYDFEGQGKVDYHLLGDLLRSLDLRPTQEMVAKNGWEKKKGQK 60
Query  61   FMTFEEFLPIYSQVKKDKDCGAFEDLVEGLKVYDKAENGTMMEAELAHVLLSLGE 115
            +MTFEEFLPIYSQVKKDKDCGA+EDLVEGLKVYDKAENGTMMEAELAHVLLSLGE
Sbjct  61   YMTFEEFLPIYSQVKKDKDCGAYEDLVEGLKVYDKAENGTMMEAELAHVLLSLGE 115

Sequence Alignment: 3. Allergen Name: Scy p 3.0101 Sequence ID: A0A514C9K9

 Score = 111.9 bits 516,  Expect = 8e-27
 Identities = 75/147 51%, Positives = 109/147 74%, Gaps = 0/147 0%
Query  2    ADLRPPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSVAKNGWEKKKGQKF 61
            ADL   +VE+A++ F IYDF+G+  +D  Y+GD LR+L+L PT   + K G + KK +K 
Sbjct  3    ADLSARDVERAKFAFSIYDFEGKGTMDAFYVGDCLRALNLNPTLAVIEKVGGKTKKKEKM 62
Query  62   MTFEEFLPIYSQVKKDKDCGAFEDLVEGLKVYDKAENGTMMEAELAHVLLSLGEKLTDAE 121
            +  ++FLPI++QVKKDKD G+FED++E LK+YDK ENGTM+ AEL H+LLSLGE+L  +E
Sbjct  63   LKVDDFLPIFAQVKKDKDAGSFEDFMEVLKLYDKTENGTMLYAELEHILLSLGERLEKSE 122
Query  122  VEEIIKTCGGGCDDEGFMKYETFIKNV 148
            +E ++K C    D++GF+ YE F+K +
Sbjct  123  LEPVLKDCCDEEDEDGFIPYEPFLKKL 149

Sequence Alignment: 4. Allergen Name: Pro c 5.0101 Sequence ID: J7HCX7

 Score = 111.9 bits 516,  Expect = 8e-27
 Identities = 74/147 50%, Positives = 110/147 74%, Gaps = 0/147 0%
Query  2    ADLRPPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSVAKNGWEKKKGQKF 61
            ADL   +VE+ ++ F IYDF+G   +D  Y+GD LR+L+L PT   + K G ++K+ +K 
Sbjct  3    ADLSARDVERVKFAFSIYDFEGNGTMDAFYIGDCLRALNLNPTLAIIEKVGGKEKRKEKI 62
Query  62   MTFEEFLPIYSQVKKDKDCGAFEDLVEGLKVYDKAENGTMMEAELAHVLLSLGEKLTDAE 121
            + +EEF+PI++QVKKDKD G++ED++E LK+YDK+ENGTMM AEL H+LLSLGE+L  +E
Sbjct  63   IKLEEFIPIFAQVKKDKDAGSYEDFMEVLKLYDKSENGTMMYAELEHILLSLGERLEKSE 122
Query  122  VEEIIKTCGGGCDDEGFMKYETFIKNV 148
            +E ++K C    D++GF+ YE F+K +
Sbjct  123  LEPVLKECCNEEDEDGFIPYEPFLKKM 149

Sequence Alignment: 5. Allergen Name: Art fr 5.0101 Sequence ID: A7L499

 Score = 103.2 bits 472,  Expect = 3e-24
 Identities = 70/125 56%, Positives = 94/125 75%, Gaps = 0/125 0%
Query  31   YLGDLLRSLDLRPTQDSVAKNGWEKKKGQKFMTFEEFLPIYSQVKKDKDCGAFEDLVEGL 90
            YLGD LR+L+L PT   + K G  KKK +K +  EEFLPI+SQVKK+KD G +ED++E +
Sbjct  18   YLGDCLRALNLNPTLAQIEKLGGTKKKNEKKLKVEEFLPIFSQVKKEKDHGTLEDFIECM 77
Query  91   KVYDKAENGTMMEAELAHVLLSLGEKLTDAEVEEIIKTCGGGCDDEGFMKYETFIKNVMA 150
            K+YDK+ENGTMM AEL H+LL+LGEKL D++V+ I K C    DDEG + Y  F+K ++A
Sbjct  78   KLYDKSENGTMMLAELNHILLALGEKLEDSQVDSIFKECMDPEDDEGNIPYTPFLKRLLA 137
Query  151  GPFPE 155
            GP+P+
Sbjct  138  GPYPD 142

Sequence Alignment: 6. Allergen Name: Bos d 13.0201 Sequence ID: P85100

 Score = 87.3 bits 393,  Expect = 3e-19
 Identities = 65/146 44%, Positives = 99/146 67%, Gaps = 8/146 5%
Query  3    DLRPPEVEKARLHFDIYDFDGQS--KVDYHYLGDLLRSLDLRPTQDSVAKN-GWEKKK-- 57
            ++ P ++E+ +  F ++D   +   K+ Y   GD+LR+L   PTQ  V +  G  K++  
Sbjct  49   EFTPEQIEEFKEAFTLFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEEL 108
Query  58   GQKFMTFEEFLPIYSQVKKDKDCGAFEDLVEGLKVYDKAENGTMMEAELAHVLLSLGEKL 117
              K M F+ FLP+  ++ K+KD G +ED+VEGL+V+DK  NGT+M AEL HVL +LGEKL
Sbjct  109  NSKMMDFDTFLPMLQHISKNKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKL 168
Query  118  TDAEVEEIIKTCGGGCDDEGFMKYETFIKNVMAG 151
            T+ EVE+++    G  D  G + YE F+K++MAG
Sbjct  169  TEDEVEKLM---AGQEDSNGCINYEAFVKHIMAG 199

Sequence Alignment: 7. Allergen Name: Gal d 7.0101 Sequence ID: P02604

 Score = 84.5 bits 379,  Expect = 2e-18
 Identities = 61/132 46%, Positives = 90/132 68%, Gaps = 6/132 4%
Query  16   FDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSVAK---NGWEKKKGQKFMTFEEFLPIYS 72
            F ++D  G +K+    +GD++R+L   PT   + K   N  +++   K +TFEEFLP+  
Sbjct  57   FLLFDRTGDAKITLSQVGDIVRALGQNPTNAEINKILGNPSKEEMNAKKITFEEFLPMLQ 116
Query  73   QVKKDKDCGAFEDLVEGLKVYDKAENGTMMEAELAHVLLSLGEKLTDAEVEEIIKTCGGG 132
                +KD G FED+VEGL+V+DK  NGT+M AEL HVL +LGEK+T+ EVEE++K   G 
Sbjct  117  AAANNKDQGTFEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMTEEEVEELMK---GQ 173
Query  133  CDDEGFMKYETFIKNVMA 150
             D  G + YE F+K++M+
Sbjct  174  EDSNGCINYEAFVKHIMS 191

Sequence Alignment: 8. Allergen Name: Bos d 13.0101 Sequence ID: A0JNJ5

 Score = 79.7 bits 355,  Expect = 5e-17
 Identities = 57/132 43%, Positives = 86/132 65%, Gaps = 6/132 4%
Query  16   FDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSVAK---NGWEKKKGQKFMTFEEFLPIYS 72
            F ++D  G+ K+    +GD+LR+L   PT   V K   N   ++   K + FE+FLP+  
Sbjct  57   FLLFDRTGECKITLSQVGDVLRALGTNPTNAEVKKVLGNPSNEEMNAKKIEFEQFLPMLQ 116
Query  73   QVKKDKDCGAFEDLVEGLKVYDKAENGTMMEAELAHVLLSLGEKLTDAEVEEIIKTCGGG 132
             +  +KD G +ED+VEGL+V+DK  NGT+M AEL HVL +LGEK+ + EVE ++    G 
Sbjct  117  AISNNKDQGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALM---AGQ 173
Query  133  CDDEGFMKYETFIKNVMA 150
             D  G + YE F+K++M+
Sbjct  174  EDSNGCINYEAFVKHIMS 191

Sequence Alignment: 9. Allergen Name: Amb a 10.0101 Sequence ID: Q2KN25

 Score = 47.3 bits 192,  Expect = 2e-07
 Identities = 39/137 28%, Positives = 70/137 51%, Gaps = 5/137 3%
Query  6    PPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSVAKNGWE-KKKGQKFMTF 64
            P + E+    F+ +D +G  ++    L  +L+SL    + D V +   E    G  F+++
Sbjct  12   PTDKEEVTKIFNRFDTNGDGQISEDELFAILKSLGSDTSPDEVKRVMAEIDADGDGFISL 71
Query  65   EEFLPIYSQVKKDKDCGAFEDLVEGLKVYDKAENGTMMEAELAHVLLSLGEKLTDAEVEE 124
            +EF+     ++ + D     DL E +K YD+  NG +   EL ++L  LGE  +     +
Sbjct  72   DEFILFCKGIESEGD--EINDLKEAFKFYDQNNNGVISANELHQILGRLGENYSVESCAD 129
Query  125  IIKTCGGGCDDEGFMKYETFIK 146
            +IK+     D +GF+ +E F K
Sbjct  130  MIKSVDS--DGDGFVDFEEFRK 149

Sequence Alignment: 10. Allergen Name: Tyr p 24.0101 Sequence ID: ACL36923

 Score = 46.6 bits 188,  Expect = 4e-07
 Identities = 40/146 27%, Positives = 81/146 55%, Gaps = 5/146 3%
Query  3    DLRPPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSVAKNGWE-KKKGQKF 61
            +L   +V+  R  FD++D D +  +  + +  +LR+L     ++ + +   E    G   
Sbjct  5    ELSKEQVQMLRKAFDMFDRDKKGYIHTNMVSTILRTLGQTFEENDLQQLIIEIDADGSGE 64
Query  62   MTFEEFLPIYSQVKKDKDCGAF-EDLVEGLKVYDKAENGTMMEAELAHVLLSLGEKLTDA 120
            + F+EFL + ++   ++D  A  E+L E +++YDK  NG +  + L  +L +L +KLT+ 
Sbjct  65   LEFDEFLTLTARFLVEEDTEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTED 124
Query  121  EVEEIIKTCGGGCDDEGFMKYETFIKNVMAG 151
            E++E+I       D  G + ++ F++ +M G
Sbjct  125  ELDEMIAEID--TDGSGTVDFDEFME-MMTG 152

Sequence Alignment: 11. Allergen Name: Tyr p 34.0101 Sequence ID: D2DGW3

 Score = 46.6 bits 188,  Expect = 4e-07
 Identities = 40/146 27%, Positives = 81/146 55%, Gaps = 5/146 3%
Query  3    DLRPPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSVAKNGWE-KKKGQKF 61
            +L   +V+  R  FD++D D +  +  + +  +LR+L     ++ + +   E    G   
Sbjct  5    ELSKEQVQMLRKAFDMFDRDKKGYIHTNMVSTILRTLGQTFEENDLQQLIIEIDADGSGE 64
Query  62   MTFEEFLPIYSQVKKDKDCGAF-EDLVEGLKVYDKAENGTMMEAELAHVLLSLGEKLTDA 120
            + F+EFL + ++   ++D  A  E+L E +++YDK  NG +  + L  +L +L +KLT+ 
Sbjct  65   LEFDEFLTLTARFLVEEDTEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTED 124
Query  121  EVEEIIKTCGGGCDDEGFMKYETFIKNVMAG 151
            E++E+I       D  G + ++ F++ +M G
Sbjct  125  ELDEMIAEID--TDGSGTVDFDEFME-MMTG 152

Sequence Alignment: 12. Allergen Name: Der f 39.0101 Sequence ID: QBF67841

 Score = 45.2 bits 181,  Expect = 1e-06
 Identities = 39/146 26%, Positives = 80/146 54%, Gaps = 5/146 3%
Query  3    DLRPPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSVAKNGWE-KKKGQKF 61
            +L   +V+  R  FD++D + +  +  + +  +LR+L     +  + +   E    G   
Sbjct  5    ELTKEQVQMLRKAFDMFDREKKGHIHTNMVSTILRTLGQTFEEKDLQQLITEIDADGSGE 64
Query  62   MTFEEFLPIYSQVKKDKDCGAF-EDLVEGLKVYDKAENGTMMEAELAHVLLSLGEKLTDA 120
            + F+EFL + ++   ++D  A  E+L E +++YDK  NG +  + L  +L +L +KLT+ 
Sbjct  65   LEFDEFLTLTARFLVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTND 124
Query  121  EVEEIIKTCGGGCDDEGFMKYETFIKNVMAG 151
            E++E+I       D  G + ++ F++ +M G
Sbjct  125  ELDEMIAEID--TDGSGTVDFDEFME-MMTG 152

Sequence Alignment: 13. Allergen Name: Pen m 6.0101 Sequence ID: ADV17344

 Score = 45.0 bits 180,  Expect = 1e-06
 Identities = 38/148 25%, Positives = 81/148 54%, Gaps = 5/148 3%
Query  1    MADLRPPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSVAKNGWEKKK-GQ 59
            M  L   ++E  R  F+ +D +G   ++   +G +LR + ++ ++ ++ +   E  + G 
Sbjct  1    MDSLDEEQIETLRKAFNSFDTEGAGSINAETVGVILRMMGVKISEKNLQEVIAETDEDGS 60
Query  60   KFMTFEEFLPIYSQVKKDKDCGAFE-DLVEGLKVYDKAENGTMMEAELAHVLLSLGEKLT 118
              + FEEF  + ++   ++D  A++ +L E +++YDK   G +    L  +L+ L  KLT
Sbjct  61   GMLEFEEFAELAAKFLIEEDEEALKAELREAFRIYDKDCQGYITTDILKEILVELDPKLT 120
Query  119  DAEVEEIIKTCGGGCDDEGFMKYETFIKNVMAG 151
              ++E II+      D  G + ++ F++ +M+G
Sbjct  121  PTDLEGIIEEVD--EDGSGTLDFDEFME-MMSG 150

Sequence Alignment: 14. Allergen Name: Der p 39.0101 Sequence ID: QXY82447

 Score = 44.6 bits 178,  Expect = 2e-06
 Identities = 39/146 26%, Positives = 79/146 54%, Gaps = 5/146 3%
Query  3    DLRPPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSVAKNGWE-KKKGQKF 61
            +L   +V+  R  FD++D + +  +  + +  +LR+L     +  +     E    G   
Sbjct  5    ELTKEQVQMLRKAFDMFDREKKGHIHTNMVSTILRTLGQTFEEKDLQTLITEIDADGSGE 64
Query  62   MTFEEFLPIYSQVKKDKDCGAF-EDLVEGLKVYDKAENGTMMEAELAHVLLSLGEKLTDA 120
            + F+EFL + ++   ++D  A  E+L E +++YDK  NG +  + L  +L +L +KLT+ 
Sbjct  65   LEFDEFLTLTARFLVEEDAEAMQEELREAFRMYDKEGNGYIPTSALREILRALDDKLTND 124
Query  121  EVEEIIKTCGGGCDDEGFMKYETFIKNVMAG 151
            E++E+I       D  G + ++ F++ +M G
Sbjct  125  ELDEMIAEID--TDGSGTVDFDEFME-MMTG 152

Sequence Alignment: 15. Allergen Name: Bla g 6.0101 Sequence ID: ABB89296

 Score = 44.4 bits 177,  Expect = 2e-06
 Identities = 39/148 26%, Positives = 77/148 52%, Gaps = 5/148 3%
Query  1    MADLRPPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSVAKNGWE-KKKGQ 59
            M +L P +++  +  FD +D + +  +    +G +L  L  R   D + +   E    G 
Sbjct  1    MDELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDMLQEIIAEVDADGS 60
Query  60   KFMTFEEFLPIYSQVKKDKDCGAFE-DLVEGLKVYDKAENGTMMEAELAHVLLSLGEKLT 118
              + FEEF+ + S+   ++D  A + +L E +++YDK  NG +    L  +L  L +K+T
Sbjct  61   GELEFEEFVSLASRFLVEEDAEAMQQELREAFRLYDKEGNGYITTNVLREILKELDDKIT 120
Query  119  DAEVEEIIKTCGGGCDDEGFMKYETFIKNVMAG 151
              +++ +I+      D  G + ++ F++ VM G
Sbjct  121  AEDLDMMIEEIDS--DGSGTVDFDEFME-VMTG 150

Sequence Alignment: 16. Allergen Name: Ole e 8 Sequence ID: Q9M7R0

 Score = 43.7 bits 174,  Expect = 3e-06
 Identities = 35/136 25%, Positives = 70/136 51%, Gaps = 7/136 5%
Query  6    PPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSVAKNGWEKKKGQK-FMTF 64
            P EV+     F+ +D +G  K+    L  +L++L    +++ + +   E    +  F+  
Sbjct  18   PNEVQGV---FNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGFINV 74
Query  65   EEFLP-IYSQVKKDKDCGAFEDLVEGLKVYDKAENGTMMEAELAHVLLSLGEKLTDAEVE 123
            +EF   + ++       G   +L E +++YD+  NG +   EL  +L  LGE+  + +  
Sbjct  75   QEFAAFVKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERYAEHDCV 134
Query  124  EIIKTCGGGCDDEGFMKYETFIK 146
            E+IK+     D +G++ +E F K
Sbjct  135  EMIKSVDS--DGDGYVSFEEFKK 155

Sequence Alignment: 17. Allergen Name: Ole e 8 Sequence ID: AAF31152

 Score = 43.7 bits 174,  Expect = 3e-06
 Identities = 36/136 26%, Positives = 70/136 51%, Gaps = 7/136 5%
Query  6    PPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSVAKNGWEKKKGQK-FMTF 64
            P EV+     F+ +D +G  K+    L   L++L    +++ +A+   E    +  F+  
Sbjct  18   PNEVQGV---FNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFINV 74
Query  65   EEFLP-IYSQVKKDKDCGAFEDLVEGLKVYDKAENGTMMEAELAHVLLSLGEKLTDAEVE 123
            +EF   + ++       G   +L E +++YD+  NG +   EL  +L  LGE+  + +  
Sbjct  75   QEFAAFVKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERYAEHDCV 134
Query  124  EIIKTCGGGCDDEGFMKYETFIK 146
            E+IK+     D +G++ +E F K
Sbjct  135  EMIKSVDS--DGDGYVSFEEFKK 155

Sequence Alignment: 18. Allergen Name: Bla g 6.0201 Sequence ID: ABB89297

 Score = 43.0 bits 170,  Expect = 5e-06
 Identities = 40/148 27%, Positives = 76/148 51%, Gaps = 5/148 3%
Query  1    MADLRPPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSVAKNGWE-KKKGQ 59
            M ++   +V   +  FD +D + +  +    +G +L  L  R  QD + +   E    G 
Sbjct  1    MDEIPAEQVVLLKKAFDAFDREKKGCISTEMVGTILEMLGTRLDQDMLDEIIAEVDADGS 60
Query  60   KFMTFEEFLPIYSQVKKDKDCGAFE-DLVEGLKVYDKAENGTMMEAELAHVLLSLGEKLT 118
              + FEEF  + S+   ++D  A + +L E +++YDK  NG +  A L  +L  L +K+T
Sbjct  61   GELEFEEFCTLASRFLVEEDAEAMQHELREAFRLYDKEGNGYITTAVLREILKELDDKIT 120
Query  119  DAEVEEIIKTCGGGCDDEGFMKYETFIKNVMAG 151
              +++ +I+      D  G + ++ F++ VM G
Sbjct  121  AEDLDMMIEEIDS--DGSGTVDFDEFME-VMTG 150

Sequence Alignment: 19. Allergen Name: Jun o 4 Sequence ID: O64943

 Score = 42.1 bits 166,  Expect = 9e-06
 Identities = 40/119 33%, Positives = 66/119 55%, Gaps = 13/119 10%
Query  16   FDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSVAKNGWEKKK--GQKFMTFEEFLPIYSQ 73
            F  +D +G  K+    L D+LRSL      ++  K   E+    G  +++++EF+ + ++
Sbjct  31   FKKFDANGDGKISGSELADILRSLG-SDVGEAEVKAMMEEADADGDGYVSLQEFVDLNNK 89
Query  74   VKKDKDCGA-FEDLVEGLKVYDKAENGTMMEAELAHVLLSLGEKLTDAEVEEIIKTCGGG 132
                   GA  +DL   +KV+D+  NG++  AEL H L S+GE  T  E + II      
Sbjct  90   -------GASVKDLKNAFKVFDRDCNGSISAAELCHTLESVGEPCTIEESKNIIHNVDKN 142
Query  133  CDDEGFMKYETF 144
             D  G++  E F
Sbjct  143  GD--GLISVEEF 152

Sequence Alignment: 20. Allergen Name: Bla g 6.0301 Sequence ID: ABB89298

 Score = 41.4 bits 162,  Expect = 1e-05
 Identities = 42/146 28%, Positives = 81/146 55%, Gaps = 13/146 8%
Query  1    MADLR---PPE-VEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDL---RPTQDSVAKNGW 53
            MAD +   PPE +   R  FD +D +    +  + + ++LR +     R T + +     
Sbjct  1    MADEQLQLPPEQISVLRKAFDAFDREKSGSISTNMVEEILRLMGQPFNRRTLEELIDEVD 60
Query  54   EKKKGQKFMTFEEFLPIYSQVKKDKDCGAFE-DLVEGLKVYDKAENGTMMEAELAHVLLS 112
              K G+  + F+EF+ + ++   ++D  A E +L E +++YDK  NG +  + L  +L  
Sbjct  61   ADKSGR--LEFDEFVTLAAKFIIEEDSEAMEKELREAFRLYDKEGNGYIPTSCLREILRE 118
Query  113  LGEKLTDAEVEEIIKTCGGGCDDEGFMKYETFIKNVMAG 151
            L E+LT  E++ +I+      D  G + ++ F++ +M G
Sbjct  119  LDEQLTSDELDMMIEEIDA--DGSGTVDFDEFME-MMTG 154

Sequence Alignment: 21. Allergen Name: Hom a 6.0101 Sequence ID: P29291

 Score = 41.2 bits 161,  Expect = 2e-05
 Identities = 36/148 24%, Positives = 79/148 53%, Gaps = 5/148 3%
Query  1    MADLRPPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSVAKNGWEKKK-GQ 59
            M  L   ++   +  FD +D D +  +    +G +LR + ++ ++ ++ +   E  + G 
Sbjct  1    MDSLDAEQLSALQKAFDSFDTDSKGFITPETVGVILRMMGVKISEKNLQEVISETDEDGS 60
Query  60   KFMTFEEFLPIYSQVKKDKDCGAFE-DLVEGLKVYDKAENGTMMEAELAHVLLSLGEKLT 118
              + FEEF+ + ++   ++D  A++ +L E ++VYD+  NG +    L  +L  L  +LT
Sbjct  61   GELEFEEFVELAAKFLIEEDEEALKAELREAFRVYDRGGNGYITTDVLKEILRELDNRLT 120
Query  119  DAEVEEIIKTCGGGCDDEGFMKYETFIKNVMAG 151
            + +++ II+      D  G + +  F++ +M G
Sbjct  121  EEDLDSIIEEVD--EDGSGTLDFNEFMQ-MMNG 150

Sequence Alignment: 22. Allergen Name: Cup a 4.0101 Sequence ID: ABP87672

 Score = 41.1 bits 161,  Expect = 2e-05
 Identities = 40/119 33%, Positives = 66/119 55%, Gaps = 13/119 10%
Query  16   FDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSVAKNGWEKKK--GQKFMTFEEFLPIYSQ 73
            F  +D +G  K+    L D+LRS+      ++  K   E+    G  +++++EF+ +   
Sbjct  43   FKKFDANGDGKISGSELADILRSMG-SEVDEAEVKAMMEEADTDGDGYVSLQEFVDL--N 99
Query  74   VKKDKDCGA-FEDLVEGLKVYDKAENGTMMEAELAHVLLSLGEKLTDAEVEEIIKTCGGG 132
            +K     GA  +DL   +KV+D+  NGT+  AEL + L S+GE  T  E + II      
Sbjct  100  IK-----GATVKDLKNAFKVFDRDCNGTISPAELCQTLKSMGEPCTIEESKNIIHNVDKN 154
Query  133  CDDEGFMKYETF 144
             D  G++  E F
Sbjct  155  GD--GLISVEEF 164

Sequence Alignment: 23. Allergen Name: Per a 8.0101 Sequence ID: H6WP59

 Score = 32.9 bits 120,  Expect = 0.007
 Identities = 33/114 28%, Positives = 63/114 55%, Gaps = 13/114 11%
Query  40   DLRPTQDSVAKNGWEKKKGQKFMTFEEFLPI-YSQVKK---DKDCGAFED---LVEGLKV 92
            DLR T D + +   +K+  +  M  E   PI ++Q+      +  G  +D   ++  +K 
Sbjct  84   DLRATFDQLGRLAVDKELDE--MVNEAPGPINFTQLLTLFAGRMSGGSDDDEVVIAAFKS 141
Query  93   YDKAENGTMMEAELAHVLLSLGEKLTDAEVEEIIKTCGGGCDDEGFMKYETFIKNVMAGP 152
            +D  + G +   +L H L++ G+K++  EV++         DD+GF+    +I+ + A P
Sbjct  142  FD--DEGKIDSEKLRHALMTWGDKFSGEEVDDAYDNFE--IDDKGFINTAKLIQLLTASP 197
Query  153  FPEEAGK 159
              EE G+
Sbjct  198  EEEEGGE 204

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.