The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MADLRPPEVEKARLHFDIYDFEGQGKVDYHLLGDLLRSLDLRPTQEMVAKNGWEKKKGQK
YMTFEEFLPIYSQVKKDKDCGAYEDLVEGLKVYDKAENGTMMEAELAHVLLSLGENWMIR
K
Sequence Info Allergen Name Length Opt Bits Score E Value
QAT18638 Der p 26.0101 121 817 182.9 2.1e-48
AIO08852 Der f 26.0101 160 731 164.5 9.8e-43
J7HCX7 Pro c 5.0101 153 435 101.3 9.7e-24
A0A514C9K9 Scy p 3.0101 153 427 99.6 3.2e-23
A7L499 Art fr 5.0101 144 333 79.5 3.2e-17
P85100 Bos d 13.0201 199 297 71.7 1e-14
A0JNJ5 Bos d 13.0101 192 281 68.3 1e-13
P02604 Gal d 7.0101 192 279 67.9 1.4e-13
Q2KN25 Amb a 10.0101 160 158 42.1 6.5e-06
O64943 Jun o 4 165 155 41.5 1.1e-05
ABP87672 Cup a 4.0101 177 150 40.4 2.4e-05
Q9M7R0 Ole e 8 171 133 36.8 0.00029
AAF31152 Ole e 8 171 133 36.8 0.00029
O81092 Ole e 3 84 103 30.6 0.0099
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Der p 26.0101 Sequence ID: QAT18638

 Score = 182.9 bits 817,  Expect = 2e-48
 Identities = 121/121 100%, Positives = 121/121 100%, Gaps = 0/121 0%
Query  1    MADLRPPEVEKARLHFDIYDFEGQGKVDYHLLGDLLRSLDLRPTQEMVAKNGWEKKKGQK 60
            MADLRPPEVEKARLHFDIYDFEGQGKVDYHLLGDLLRSLDLRPTQEMVAKNGWEKKKGQK
Sbjct  1    MADLRPPEVEKARLHFDIYDFEGQGKVDYHLLGDLLRSLDLRPTQEMVAKNGWEKKKGQK 60
Query  61   YMTFEEFLPIYSQVKKDKDCGAYEDLVEGLKVYDKAENGTMMEAELAHVLLSLGENWMIR 120
            YMTFEEFLPIYSQVKKDKDCGAYEDLVEGLKVYDKAENGTMMEAELAHVLLSLGENWMIR
Sbjct  61   YMTFEEFLPIYSQVKKDKDCGAYEDLVEGLKVYDKAENGTMMEAELAHVLLSLGENWMIR 120
Query  121  K 121
            K
Sbjct  121  K 121

Sequence Alignment: 2. Allergen Name: Der f 26.0101 Sequence ID: AIO08852

 Score = 164.5 bits 731,  Expect = 1e-42
 Identities = 108/115 93%, Positives = 112/115 97%, Gaps = 0/115 0%
Query  1    MADLRPPEVEKARLHFDIYDFEGQGKVDYHLLGDLLRSLDLRPTQEMVAKNGWEKKKGQK 60
            MADLRPPEVEKARLHFDIYDF+GQ KVDYH LGDLLRSLDLRPTQ+ VAKNGWEKKKGQK
Sbjct  1    MADLRPPEVEKARLHFDIYDFDGQSKVDYHYLGDLLRSLDLRPTQDSVAKNGWEKKKGQK 60
Query  61   YMTFEEFLPIYSQVKKDKDCGAYEDLVEGLKVYDKAENGTMMEAELAHVLLSLGE 115
            +MTFEEFLPIYSQVKKDKDCGA+EDLVEGLKVYDKAENGTMMEAELAHVLLSLGE
Sbjct  61   FMTFEEFLPIYSQVKKDKDCGAFEDLVEGLKVYDKAENGTMMEAELAHVLLSLGE 115

Sequence Alignment: 3. Allergen Name: Pro c 5.0101 Sequence ID: J7HCX7

 Score = 101.3 bits 435,  Expect = 1e-23
 Identities = 64/114 56%, Positives = 89/114 78%, Gaps = 0/114 0%
Query  2    ADLRPPEVEKARLHFDIYDFEGQGKVDYHLLGDLLRSLDLRPTQEMVAKNGWEKKKGQKY 61
            ADL   +VE+ ++ F IYDFEG G +D   +GD LR+L+L PT  ++ K G ++K+ +K 
Sbjct  3    ADLSARDVERVKFAFSIYDFEGNGTMDAFYIGDCLRALNLNPTLAIIEKVGGKEKRKEKI 62
Query  62   MTFEEFLPIYSQVKKDKDCGAYEDLVEGLKVYDKAENGTMMEAELAHVLLSLGE 115
            + +EEF+PI++QVKKDKD G+YED++E LK+YDK+ENGTMM AEL H+LLSLGE
Sbjct  63   IKLEEFIPIFAQVKKDKDAGSYEDFMEVLKLYDKSENGTMMYAELEHILLSLGE 116

Sequence Alignment: 4. Allergen Name: Scy p 3.0101 Sequence ID: A0A514C9K9

 Score = 99.6 bits 427,  Expect = 3e-23
 Identities = 63/114 55%, Positives = 88/114 77%, Gaps = 0/114 0%
Query  2    ADLRPPEVEKARLHFDIYDFEGQGKVDYHLLGDLLRSLDLRPTQEMVAKNGWEKKKGQKY 61
            ADL   +VE+A++ F IYDFEG+G +D   +GD LR+L+L PT  ++ K G + KK +K 
Sbjct  3    ADLSARDVERAKFAFSIYDFEGKGTMDAFYVGDCLRALNLNPTLAVIEKVGGKTKKKEKM 62
Query  62   MTFEEFLPIYSQVKKDKDCGAYEDLVEGLKVYDKAENGTMMEAELAHVLLSLGE 115
            +  ++FLPI++QVKKDKD G++ED++E LK+YDK ENGTM+ AEL H+LLSLGE
Sbjct  63   LKVDDFLPIFAQVKKDKDAGSFEDFMEVLKLYDKTENGTMLYAELEHILLSLGE 116

Sequence Alignment: 5. Allergen Name: Art fr 5.0101 Sequence ID: A7L499

 Score = 79.5 bits 333,  Expect = 3e-17
 Identities = 51/84 60%, Positives = 65/84 77%, Gaps = 0/84 0%
Query  32   LGDLLRSLDLRPTQEMVAKNGWEKKKGQKYMTFEEFLPIYSQVKKDKDCGAYEDLVEGLK 91
            LGD LR+L+L PT   + K G  KKK +K +  EEFLPI+SQVKK+KD G  ED++E +K
Sbjct  19   LGDCLRALNLNPTLAQIEKLGGTKKKNEKKLKVEEFLPIFSQVKKEKDHGTLEDFIECMK 78
Query  92   VYDKAENGTMMEAELAHVLLSLGE 115
            +YDK+ENGTMM AEL H+LL+LGE
Sbjct  79   LYDKSENGTMMLAELNHILLALGE 102

Sequence Alignment: 6. Allergen Name: Bos d 13.0201 Sequence ID: P85100

 Score = 71.7 bits 297,  Expect = 1e-14
 Identities = 50/113 44%, Positives = 76/113 67%, Gaps = 5/113 4%
Query  3    DLRPPEVEKARLHFDIYDF--EGQGKVDYHLLGDLLRSLDLRPTQEMVAKN-GWEKKK-- 57
            ++ P ++E+ +  F ++D   + + K+ Y   GD+LR+L   PTQ  V +  G  K++  
Sbjct  49   EFTPEQIEEFKEAFTLFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEEL 108
Query  58   GQKYMTFEEFLPIYSQVKKDKDCGAYEDLVEGLKVYDKAENGTMMEAELAHVLLSLGE 115
              K M F+ FLP+  ++ K+KD G YED+VEGL+V+DK  NGT+M AEL HVL +LGE
Sbjct  109  NSKMMDFDTFLPMLQHISKNKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGE 166

Sequence Alignment: 7. Allergen Name: Bos d 13.0101 Sequence ID: A0JNJ5

 Score = 68.3 bits 281,  Expect = 1e-13
 Identities = 46/100 46%, Positives = 65/100 65%, Gaps = 3/100 3%
Query  16   FDIYDFEGQGKVDYHLLGDLLRSLDLRPTQEMVAK---NGWEKKKGQKYMTFEEFLPIYS 72
            F ++D  G+ K+    +GD+LR+L   PT   V K   N   ++   K + FE+FLP+  
Sbjct  57   FLLFDRTGECKITLSQVGDVLRALGTNPTNAEVKKVLGNPSNEEMNAKKIEFEQFLPMLQ 116
Query  73   QVKKDKDCGAYEDLVEGLKVYDKAENGTMMEAELAHVLLSLGE 115
             +  +KD G YED+VEGL+V+DK  NGT+M AEL HVL +LGE
Sbjct  117  AISNNKDQGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGE 159

Sequence Alignment: 8. Allergen Name: Gal d 7.0101 Sequence ID: P02604

 Score = 67.9 bits 279,  Expect = 1e-13
 Identities = 45/100 45%, Positives = 65/100 65%, Gaps = 3/100 3%
Query  16   FDIYDFEGQGKVDYHLLGDLLRSLDLRPTQEMVAK---NGWEKKKGQKYMTFEEFLPIYS 72
            F ++D  G  K+    +GD++R+L   PT   + K   N  +++   K +TFEEFLP+  
Sbjct  57   FLLFDRTGDAKITLSQVGDIVRALGQNPTNAEINKILGNPSKEEMNAKKITFEEFLPMLQ 116
Query  73   QVKKDKDCGAYEDLVEGLKVYDKAENGTMMEAELAHVLLSLGE 115
                +KD G +ED+VEGL+V+DK  NGT+M AEL HVL +LGE
Sbjct  117  AAANNKDQGTFEDFVEGLRVFDKEGNGTVMGAELRHVLATLGE 159

Sequence Alignment: 9. Allergen Name: Amb a 10.0101 Sequence ID: Q2KN25

 Score = 42.1 bits 158,  Expect = 6e-06
 Identities = 31/112 27%, Positives = 58/112 51%, Gaps = 3/112 2%
Query  6    PPEVEKARLHFDIYDFEGQGKVDYHLLGDLLRSLDLRPTQEMVAKNGWE-KKKGQKYMTF 64
            P + E+    F+ +D  G G++    L  +L+SL    + + V +   E    G  ++++
Sbjct  12   PTDKEEVTKIFNRFDTNGDGQISEDELFAILKSLGSDTSPDEVKRVMAEIDADGDGFISL 71
Query  65   EEFLPIYSQVKKDKDCGAYEDLVEGLKVYDKAENGTMMEAELAHVLLSLGENWMI 119
            +EF+     ++ + D     DL E +K YD+  NG +   EL ++L  LGEN+ +
Sbjct  72   DEFILFCKGIESEGD--EINDLKEAFKFYDQNNNGVISANELHQILGRLGENYSV 124

Sequence Alignment: 10. Allergen Name: Jun o 4 Sequence ID: O64943

 Score = 41.5 bits 155,  Expect = 1e-05
 Identities = 35/92 38%, Positives = 54/92 58%, Gaps = 11/92 11%
Query  16   FDIYDFEGQGKVDYHLLGDLLRSLDLRPTQEMVAKNGWEKKK--GQKYMTFEEFLPIYSQ 73
            F  +D  G GK+    L D+LRSL      E   K   E+    G  Y++++EF+ + ++
Sbjct  31   FKKFDANGDGKISGSELADILRSLG-SDVGEAEVKAMMEEADADGDGYVSLQEFVDLNNK 89
Query  74   VKKDKDCGA-YEDLVEGLKVYDKAENGTMMEAELAHVLLSLGE 115
                   GA  +DL   +KV+D+  NG++  AEL H L S+GE
Sbjct  90   -------GASVKDLKNAFKVFDRDCNGSISAAELCHTLESVGE 125

Sequence Alignment: 11. Allergen Name: Cup a 4.0101 Sequence ID: ABP87672

 Score = 40.4 bits 150,  Expect = 2e-05
 Identities = 35/92 38%, Positives = 54/92 58%, Gaps = 11/92 11%
Query  16   FDIYDFEGQGKVDYHLLGDLLRSLDLRPTQEMVAKNGWEKKK--GQKYMTFEEFLPIYSQ 73
            F  +D  G GK+    L D+LRS+      E   K   E+    G  Y++++EF+ +   
Sbjct  43   FKKFDANGDGKISGSELADILRSMG-SEVDEAEVKAMMEEADTDGDGYVSLQEFVDL--N 99
Query  74   VKKDKDCGA-YEDLVEGLKVYDKAENGTMMEAELAHVLLSLGE 115
            +K     GA  +DL   +KV+D+  NGT+  AEL + L S+GE
Sbjct  100  IK-----GATVKDLKNAFKVFDRDCNGTISPAELCQTLKSMGE 137

Sequence Alignment: 12. Allergen Name: Ole e 8 Sequence ID: Q9M7R0

 Score = 36.8 bits 133,  Expect = 0.0003
 Identities = 28/109 25%, Positives = 54/109 49%, Gaps = 5/109 4%
Query  6    PPEVEKARLHFDIYDFEGQGKVDYHLLGDLLRSLDLRPTQEMVAKNGWEKKKGQK-YMTF 64
            P EV+     F+ +D  G GK+    L  +L++L    ++E + +   E    +  ++  
Sbjct  18   PNEVQGV---FNRFDANGDGKISGDELAGVLKALGSNTSKEEIGRIMEEIDTDKDGFINV 74
Query  65   EEFLP-IYSQVKKDKDCGAYEDLVEGLKVYDKAENGTMMEAELAHVLLSLGENW 117
            +EF   + ++       G   +L E +++YD+  NG +   EL  +L  LGE +
Sbjct  75   QEFAAFVKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERY 128

Sequence Alignment: 13. Allergen Name: Ole e 8 Sequence ID: AAF31152

 Score = 36.8 bits 133,  Expect = 0.0003
 Identities = 29/109 26%, Positives = 54/109 49%, Gaps = 5/109 4%
Query  6    PPEVEKARLHFDIYDFEGQGKVDYHLLGDLLRSLDLRPTQEMVAKNGWEKKKGQK-YMTF 64
            P EV+     F+ +D  G GK+    L   L++L    ++E +A+   E    +  ++  
Sbjct  18   PNEVQGV---FNRFDANGDGKISGDELACALKALGSNTSKEEIARMMEEIDTDKDGFINV 74
Query  65   EEFLP-IYSQVKKDKDCGAYEDLVEGLKVYDKAENGTMMEAELAHVLLSLGENW 117
            +EF   + ++       G   +L E +++YD+  NG +   EL  +L  LGE +
Sbjct  75   QEFAAFVKAETDPYPSSGGENELKEAFELYDQDHNGLISSVELHKILTRLGERY 128

Sequence Alignment: 14. Allergen Name: Ole e 3 Sequence ID: O81092

 Score = 30.6 bits 103,  Expect = 0.01
 Identities = 24/63 38%, Positives = 37/63 58%, Gaps = 7/63 11%
Query  1    MADLRPPEVEKARLHFDIYDFEGQGKVDYHLLGDLLRSL-DLRPT--QEMVAKNGWEKKK 57
            MAD  P EV +    F  +D  G GK+    LG+ L++L  + P   Q M+A+   +   
Sbjct  1    MAD-DPQEVAEHERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEIDTD--- 56
Query  58   GQKYMTFEEF 67
            G  +++FEEF
Sbjct  57   GDGFISFEEF 66

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.