The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MADRDRPHPHQIQVHPQHPHRYEGGVKSLLPQKGPSTTQILAIITLLPISGTLLCLAGIT
LVGTLIGLAVATPVFVIFSPVLVPAAILIAGAVTAFLTSGAFGLTGLSSLSWVLNSFRRA
TGQGPLEYAKRGVQEGTLYVGEKTKQAGEAIKSTAKEGGREGTART
Sequence Info Allergen Name Length Opt Bits Score E Value
AAG23840 Ses i 4 166 1068 250.5 1.7e-68
AAO67349 Cor a 12.0101 159 554 133.4 3e-33
Q647G5 Ara h 10.0101 169 483 117.2 2.4e-28
Q6J1J8 Ara h 14.0103 176 479 116.2 4.9e-28
Q9AXI1 Ara h 14.0101 176 475 115.3 9.1e-28
Q9AXI0 Ara h 14.0102 176 466 113.3 3.8e-27
Q647G4 Ara h 10.0102 150 462 112.5 5.7e-27
QZM06934 Fag t 6.01 173 418 102.3 7.3e-24
Q45W87 Ara h 11.0101 137 284 72.0 8.1e-15
AAO65960 Cor a 13.0101 140 272 69.2 5.6e-14
AAD42942 Ses i 5 145 265 67.6 1.8e-13
Q647G3 Ara h 15.0101 166 264 67.3 2.5e-13
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ses i 4 Sequence ID: AAG23840

 Score = 250.5 bits 1068,  Expect = 2e-68
 Identities = 166/166 100%, Positives = 166/166 100%, Gaps = 0/166 0%
Query  1    MADRDRPHPHQIQVHPQHPHRYEGGVKSLLPQKGPSTTQILAIITLLPISGTLLCLAGIT 60
            MADRDRPHPHQIQVHPQHPHRYEGGVKSLLPQKGPSTTQILAIITLLPISGTLLCLAGIT
Sbjct  1    MADRDRPHPHQIQVHPQHPHRYEGGVKSLLPQKGPSTTQILAIITLLPISGTLLCLAGIT 60
Query  61   LVGTLIGLAVATPVFVIFSPVLVPAAILIAGAVTAFLTSGAFGLTGLSSLSWVLNSFRRA 120
            LVGTLIGLAVATPVFVIFSPVLVPAAILIAGAVTAFLTSGAFGLTGLSSLSWVLNSFRRA
Sbjct  61   LVGTLIGLAVATPVFVIFSPVLVPAAILIAGAVTAFLTSGAFGLTGLSSLSWVLNSFRRA 120
Query  121  TGQGPLEYAKRGVQEGTLYVGEKTKQAGEAIKSTAKEGGREGTART 166
            TGQGPLEYAKRGVQEGTLYVGEKTKQAGEAIKSTAKEGGREGTART
Sbjct  121  TGQGPLEYAKRGVQEGTLYVGEKTKQAGEAIKSTAKEGGREGTART 166

Sequence Alignment: 2. Allergen Name: Cor a 12.0101 Sequence ID: AAO67349

 Score = 133.4 bits 554,  Expect = 3e-33
 Identities = 89/153 58%, Positives = 124/153 81%, Gaps = 12/153 7%
Query  1    MADRDRPHPHQIQVHPQHPH-RYEGGVKSLLPQKG--PSTTQILAIITLLPISGTLLCLA 57
            MADR    P+Q+QVHPQ  H  YEGG+K+   Q+G  PS  +++A++  LP+ GTLL LA
Sbjct  1    MADR----PQQLQVHPQRGHGHYEGGIKN---QRGGGPSAVKVMAVLAALPVGGTLLALA 53
Query  58   GITLVGTLIGLAVATPVFVIFSPVLVPAAILIAGAVTAFLTSGAFGLTGLSSLSWVLNSF 117
            G+TL G++IGL V +P+F+IFSPVLVPAAI++  AV +FL+SGA+GLTGLSSLSWVLN +
Sbjct  54   GLTLAGSVIGLLVTSPLFIIFSPVLVPAAIVVGLAVASFLSSGALGLTGLSSLSWVLNYL 113
Query  118  RRATGQGP--LEYAKRGVQEGTLYVGEKTKQAGEAIKSTAKEGGR 160
            R A+   P  ++ AKR +Q+   +VG+KT++ G+ I+S A+EG R
Sbjct  114  RCASQSLPREMDQAKRRMQDMAAFVGQKTREVGQEIQSRAQEGRR 158

Sequence Alignment: 3. Allergen Name: Ara h 10.0101 Sequence ID: Q647G5

 Score = 117.2 bits 483,  Expect = 2e-28
 Identities = 77/153 50%, Positives = 105/153 68%, Gaps = 3/153 1%
Query  5    DRPHPHQIQVHPQHPHRYEGGVKS-LLPQKGPSTTQILAIITLLPISGTLLCLAGITLVG 63
            DR +PH +QVH       +    +   P +GPST++++A+IT LPI GTLL +AG+ L G
Sbjct  3    DRTQPHTVQVHTTAGRFGDTAAGTNRYPDRGPSTSKVIAVITGLPIGGTLLLFAGLALAG 62
Query  64   TLIGLAVATPVFVIFSPVLVPAAILIAGAVTAFLTSGAFGLTGLSSLSWVLNSFRRATGQ 123
            TL+GLAV TP+F++FSPV+VPA I++  +V  FLTSGA GLTGLSS+SWV+N  R+  G 
Sbjct  63   TLLGLAVTTPLFILFSPVIVPAIIVVGLSVAGFLTSGACGLTGLSSFSWVMNYIRQTHGS 122
Query  124  GP--LEYAKRGVQEGTLYVGEKTKQAGEAIKSTAKE 157
             P  LE AK  + +   YVG+KTK  G+  K   +E
Sbjct  123  VPEQLEMAKHRMADVAGYVGQKTKDVGQKTKEVGQE 158

Sequence Alignment: 4. Allergen Name: Ara h 14.0103 Sequence ID: Q6J1J8

 Score = 116.2 bits 479,  Expect = 5e-28
 Identities = 83/158 52%, Positives = 118/158 74%, Gaps = 14/158 8%
Query  5    DRPHPHQIQVHPQHPHRYE----------GGVKSLLPQKGPSTTQILAIITLLPISGTLL 54
            DR  PHQ+QVH    +R +          GG+K+LLP++GPST+QI+A++  +P  GTLL
Sbjct  6    DRA-PHQVQVHTPTTQRVDVPRRGYDVSGGGIKTLLPERGPSTSQIIAVLVGVPTGGTLL 64
Query  55   CLAGITLVGTLIGLAVATPVFVIFSPVLVPAAILIAGAVTAFLTSGAFGLTGLSSLSWVL 114
             L+G++L+GT+IGLA+ATPVF+ FSPV+VPA + I  AVT  LT+GA GLTGL SLSW++
Sbjct  65   LLSGLSLLGTIIGLAIATPVFIFFSPVIVPAVVTIGLAVTGILTAGACGLTGLMSLSWMI 124
Query  115  NSFRRATGQG-P--LEYAKRGVQEGTLYVGEKTKQAGEAIKSTAKEGGREGT 163
            N  R+  G   P  L+  KR + +   YVG+KTK AG+ I++ A++  R  +
Sbjct  125  NFIRQVHGTTVPDQLDSVKRRMADMADYVGQKTKDAGQEIQTKAQDVKRSSS 176

Sequence Alignment: 5. Allergen Name: Ara h 14.0101 Sequence ID: Q9AXI1

 Score = 115.3 bits 475,  Expect = 9e-28
 Identities = 83/158 52%, Positives = 117/158 74%, Gaps = 14/158 8%
Query  5    DRPHPHQIQVHPQHPHRYE----------GGVKSLLPQKGPSTTQILAIITLLPISGTLL 54
            DR  PHQ+QVH    +R +          GG+K+LLP++GPST+QI+A++  +P  GTLL
Sbjct  6    DRA-PHQVQVHTPTTQRVDVPRRGYDVSGGGIKTLLPERGPSTSQIIAVLVGVPTGGTLL 64
Query  55   CLAGITLVGTLIGLAVATPVFVIFSPVLVPAAILIAGAVTAFLTSGAFGLTGLSSLSWVL 114
             L+G++L+GT+IGLA+ATPVF  FSPV+VPA + I  AVT  LT+GA GLTGL SLSW++
Sbjct  65   LLSGLSLLGTIIGLAIATPVFTFFSPVIVPAVVTIGLAVTGILTAGACGLTGLMSLSWMI 124
Query  115  NSFRRATGQG-P--LEYAKRGVQEGTLYVGEKTKQAGEAIKSTAKEGGREGT 163
            N  R+  G   P  L+  KR + +   YVG+KTK AG+ I++ A++  R  +
Sbjct  125  NFIRQVHGTTVPDQLDSVKRRMADMADYVGQKTKDAGQQIQTKAQDVKRSSS 176

Sequence Alignment: 6. Allergen Name: Ara h 14.0102 Sequence ID: Q9AXI0

 Score = 113.3 bits 466,  Expect = 4e-27
 Identities = 83/158 52%, Positives = 116/158 73%, Gaps = 14/158 8%
Query  5    DRPHPHQIQVHPQHPHRYE----------GGVKSLLPQKGPSTTQILAIITLLPISGTLL 54
            DR  PHQ+QVH    +R +          GGVK++LP +GPST+QI+A++  +P  GTLL
Sbjct  6    DRA-PHQVQVHTPTTQRVDVQRRGYDVSGGGVKTFLPDRGPSTSQIIAVLVGVPTGGTLL 64
Query  55   CLAGITLVGTLIGLAVATPVFVIFSPVLVPAAILIAGAVTAFLTSGAFGLTGLSSLSWVL 114
             L+G++L+GT+IGLA+ATPVF  FSPV+VPA + I  AV   LT+GA GLTGL SLSW++
Sbjct  65   LLSGLSLLGTIIGLAIATPVFTFFSPVIVPAVVTIGLAVIGILTAGACGLTGLMSLSWMI 124
Query  115  NSFRRATGQG-P--LEYAKRGVQEGTLYVGEKTKQAGEAIKSTAKEGGREGT 163
            N  R+  G   P  L+ AKR + +   YVG+KTK AG+ I++ A++  R  +
Sbjct  125  NFIRQVHGTTVPDQLDSAKRRMADMADYVGQKTKDAGQEIQTKAQDVKRSSS 176

Sequence Alignment: 7. Allergen Name: Ara h 10.0102 Sequence ID: Q647G4

 Score = 112.5 bits 462,  Expect = 6e-27
 Identities = 74/145 51%, Positives = 101/145 69%, Gaps = 3/145 2%
Query  5    DRPHPHQIQVHPQHPHRYEGGVKS-LLPQKGPSTTQILAIITLLPISGTLLCLAGITLVG 63
            DR +PH +QVH       +    +     +GPST++++A+IT LPI GTLL +AG+ L G
Sbjct  3    DRTQPHAVQVHTTAGRFGDTAAGTNRYADRGPSTSKVIAVITGLPIGGTLLLFAGLALAG 62
Query  64   TLIGLAVATPVFVIFSPVLVPAAILIAGAVTAFLTSGAFGLTGLSSLSWVLNSFRRATGQ 123
            TL+GLAV TP+F++FSPV+VPA I++  +V  FLTSGA GLTGLSS+SWV+N  R+  G 
Sbjct  63   TLLGLAVTTPLFILFSPVIVPATIVVGLSVAGFLTSGACGLTGLSSFSWVMNYIRQTHGS 122
Query  124  GP--LEYAKRGVQEGTLYVGEKTKQAGE 149
             P  LE AK  + +   YVG+KTK  G+
Sbjct  123  VPEQLEMAKHRMADVAGYVGQKTKDVGQ 150

Sequence Alignment: 8. Allergen Name: Fag t 6.01 Sequence ID: QZM06934

 Score = 102.3 bits 418,  Expect = 7e-24
 Identities = 75/161 46%, Positives = 107/161 66%, Gaps = 9/161 5%
Query  5    DRPHPHQIQVHP----QHPHRYEGGVKSLLPQKGPSTTQILAIITLLPISGTLLCLAGIT 60
            D+ + HQ + H     QH ++    +   L +K P T +I+A   L+P+ G +L LA +T
Sbjct  3    DQHYYHQAKDHTNQAQQHGQQALSNMAGYLQEKTPPTQHIIAAAALIPLGGFMLVLAALT 62
Query  61   LVGTLIGLAVATPVFVIFSPVLVPAAILIAGAVTAFLTSGAFGLTGLSSLSWVLNSFR-- 118
            L GT+IGLAVATP+FVIFSPVLVPAA+ +  A   F+ SGA+GLT LS+LSW+++  R  
Sbjct  63   LTGTVIGLAVATPLFVIFSPVLVPAALALGLATMGFIVSGALGLTALSALSWMISYIRQI 122
Query  119  RATGQGP--LEYAKRGVQEGTLYVGEKTKQAGEAIKSTAKEGGREGTART 166
            RA+G GP  ++ A+  VQ+G   +GEKTK  G+ I+  A +       RT
Sbjct  123  RASG-GPGIIDEARWRVQQGIDRLGEKTKDLGQGIQDRAYDARAHEVGRT 171

Sequence Alignment: 9. Allergen Name: Ara h 11.0101 Sequence ID: Q45W87

 Score = 72.0 bits 284,  Expect = 8e-15
 Identities = 47/98 47%, Positives = 65/98 66%, Gaps = 6/98 6%
Query  22   YEGGVKSLLPQKGPSTTQILAIITLLPISGTLLCLAGITLVGTLIGLAVATPVFVIFSPV 81
            Y GG +    Q+ P +TQ++   T +   G+LL LAG+ L GT+IGL   TP+FVIFSPV
Sbjct  6    YYGGRQR---QEQPRSTQLVKATTAVVAGGSLLILAGLVLAGTVIGLTTITPLFVIFSPV 62
Query  82   LVPAAILIAGAVTAFLTSGAFGLTGLSSLSWVLNSFRRATGQGP 125
            LVPA I +A     FL SG FG+  ++ L+W+   +R  TG+ P
Sbjct  63   LVPAVITVALLGLGFLASGGFGVAAITVLTWI---YRYVTGKHP 103

Sequence Alignment: 10. Allergen Name: Cor a 13.0101 Sequence ID: AAO65960

 Score = 69.2 bits 272,  Expect = 6e-14
 Identities = 47/124 37%, Positives = 77/124 62%, Gaps = 14/124 11%
Query  17   QHPHRYEGGVKSLLPQKGPSTTQILAIITLLPISGTLLCLAGITLVGTLIGLAVATPVFV 76
            +HP + +       P   P + Q++   T     G+LL  +G+ L GT+I L +ATP+FV
Sbjct  3    EHPRQLQD------PAHQPRSHQVVKAATAATAGGSLLVPSGLILAGTVIALTLATPLFV 56
Query  77   IFSPVLVPAAILIAGAVTAFLTSGAFGLTGLSSLSWVLNSFRRATGQGP-----LEYAKR 131
            IFSPVLVPA I ++  +  FL SG FG+  ++ LSW+   +R  TG+ P     L++A+ 
Sbjct  57   IFSPVLVPAVITVSLIIMGFLASGGFGVAAVTVLSWI---YRYVTGRHPPGADQLDHARM 113
Query  132  GVQEGTLYVGEKTKQAGE 149
             +      + ++ +Q G+
Sbjct  114  KLASKAREMKDRAEQFGQ 131

Sequence Alignment: 11. Allergen Name: Ses i 5 Sequence ID: AAD42942

 Score = 67.6 bits 265,  Expect = 2e-13
 Identities = 49/112 43%, Positives = 69/112 61%, Gaps = 8/112 7%
Query  32   QKGPSTTQILAIITLLPISGTLLCLAGITLVGTLIGLAVATPVFVIFSPVLVPAAILIAG 91
            Q  P   +++   T +   G+LL L+G+TL GT+I L +ATP++VIFSPVLVPA I I  
Sbjct  17   QLQPRAQRVVKAATAVTAGGSLLVLSGLTLAGTVIALTIATPLLVIFSPVLVPAVITIFL 76
Query  92   AVTAFLTSGAFGLTGLSSLSWVLNSFRRATGQGP-----LEYAKRGVQEGTLYVGEKTKQ 146
                FL SG FG+  LS LSW+   +R  TG+ P     LE AK  +      + ++ +Q
Sbjct  77   LGAGFLASGGFGVAALSVLSWI---YRYLTGKHPPGADQLESAKTKLASKAREMKDRAEQ 133

Sequence Alignment: 12. Allergen Name: Ara h 15.0101 Sequence ID: Q647G3

 Score = 67.3 bits 264,  Expect = 3e-13
 Identities = 51/126 40%, Positives = 77/126 61%, Gaps = 10/126 7%
Query  31   PQKGPSTTQILAIITLLPISGTLLCLAGITLVGTLIGLAVATPVFVIFSPVLVPAAILIA 90
            P       Q +  +T   I  ++L L+G+ L GT+IGL +ATP++VIFSP+LVPAAI +A
Sbjct  35   PSTNQPIRQAIKFMTASTIGVSFLILSGLILTGTVIGLIIATPLLVIFSPILVPAAITLA 94
Query  91   GAVTAFLTSGAFGLTGLSSLSWVLN--SFRRATGQGPLEYAKRGVQEGTLYVGEKTKQAG 148
             A   FL SG  G+  +++LSW+ +  + +   G   L+YAK GV      + +K +   
Sbjct  95   LAAGGFLFSGGCGVAAIAALSWLYSYVTGKHPAGSDRLDYAK-GV------IADKARDVK 147
Query  149  EAIKSTAKEG-GREGT 163
            +  K  A  G  +EGT
Sbjct  148  DRAKDYAGAGRAQEGT 163

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.