The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAEHYGQQQQTRAPHLQLQPRAQRVVKAATAVTAGGSLLVLSGLTLAGTVIALTIATPLL
VIFSPVLVPAVITIFLLGAGFLASGGFGVAALSVLSWIYRYLTGKHPPGADQLESAKTKL
ASKAREMKDRAEQFSQQPVAGSQTS
Sequence Info Allergen Name Length Opt Bits Score E Value
AAD42942 Ses i 5 145 909 258.5 5.2e-71
AAO65960 Cor a 13.0101 140 657 188.5 5.8e-50
Q45W87 Ara h 11.0101 137 583 168.0 8.6e-44
Q647G3 Ara h 15.0101 166 443 129.0 5.6e-32
Q647G5 Ara h 10.0101 169 318 94.3 1.6e-21
QZM06934 Fag t 6.01 173 318 94.3 1.7e-21
Q647G4 Ara h 10.0102 150 312 92.7 4.4e-21
AAO67349 Cor a 12.0101 159 303 90.2 2.7e-20
Q9AXI1 Ara h 14.0101 176 298 88.7 8.1e-20
Q9AXI0 Ara h 14.0102 176 297 88.5 9.8e-20
Q6J1J8 Ara h 14.0103 176 297 88.5 9.8e-20
AAG23840 Ses i 4 166 265 79.6 4.3e-17
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ses i 5 Sequence ID: AAD42942

 Score = 258.5 bits 909,  Expect = 5e-71
 Identities = 145/145 100%, Positives = 145/145 100%, Gaps = 0/145 0%
Query  1    MAEHYGQQQQTRAPHLQLQPRAQRVVKAATAVTAGGSLLVLSGLTLAGTVIALTIATPLL 60
            MAEHYGQQQQTRAPHLQLQPRAQRVVKAATAVTAGGSLLVLSGLTLAGTVIALTIATPLL
Sbjct  1    MAEHYGQQQQTRAPHLQLQPRAQRVVKAATAVTAGGSLLVLSGLTLAGTVIALTIATPLL 60
Query  61   VIFSPVLVPAVITIFLLGAGFLASGGFGVAALSVLSWIYRYLTGKHPPGADQLESAKTKL 120
            VIFSPVLVPAVITIFLLGAGFLASGGFGVAALSVLSWIYRYLTGKHPPGADQLESAKTKL
Sbjct  61   VIFSPVLVPAVITIFLLGAGFLASGGFGVAALSVLSWIYRYLTGKHPPGADQLESAKTKL 120
Query  121  ASKAREMKDRAEQFSQQPVAGSQTS 145
            ASKAREMKDRAEQFSQQPVAGSQTS
Sbjct  121  ASKAREMKDRAEQFSQQPVAGSQTS 145

Sequence Alignment: 2. Allergen Name: Cor a 13.0101 Sequence ID: AAO65960

 Score = 188.5 bits 657,  Expect = 6e-50
 Identities = 109/140 77%, Positives = 122/140 87%, Gaps = 5/140 3%
Query  1    MAEHYGQQQQTRAPHLQLQPRAQRVVKAATAVTAGGSLLVLSGLTLAGTVIALTIATPLL 60
            MAEH  Q Q     H   QPR+++VVKAATA TAGGSLLV SGL LAGTVIALT+ATPL+
Sbjct  1    MAEHPRQLQDP--AH---QPRSHQVVKAATAATAGGSLLVPSGLILAGTVIALTLATPLF 55
Query  61   VIFSPVLVPAVITIFLLGAGFLASGGFGVAALSVLSWIYRYLTGKHPPGADQLESAKTKL 120
            VIFSPVLVPAVIT+ L+  GFLASGGFGVAA++VLSWIYRY+TG+HPPGADQL+ A+ KL
Sbjct  56   VIFSPVLVPAVITVSLIIMGFLASGGFGVAAVTVLSWIYRYVTGRHPPGADQLDHARMKL 115
Query  121  ASKAREMKDRAEQFSQQPVAGSQTS 145
            ASKAREMKDRAEQF QQ V GSQ S
Sbjct  116  ASKAREMKDRAEQFGQQHVTGSQGS 140

Sequence Alignment: 3. Allergen Name: Ara h 11.0101 Sequence ID: Q45W87

 Score = 168.0 bits 583,  Expect = 9e-44
 Identities = 96/135 71%, Positives = 117/135 86%, Gaps = 12/135 8%
Query  1    MAE--HYGQQQQTRAPHLQLQPRAQRVVKAATAVTAGGSLLVLSGLTLAGTVIALTIATP 58
            MAE  +YG +Q+      Q QPR+ ++VKA TAV AGGSLL+L+GL LAGTVI LT  TP
Sbjct  1    MAEALYYGGRQR------QEQPRSTQLVKATTAVVAGGSLLILAGLVLAGTVIGLTTITP 54
Query  59   LLVIFSPVLVPAVITIFLLGAGFLASGGFGVAALSVLSWIYRYLTGKHPPGADQLESAKT 118
            L+VIFSPVLVPAVIT+ LLG GFLASGGFGVAA++VL+WIYRY+TGKHPPGA+QL++A+ 
Sbjct  55   LFVIFSPVLVPAVITVALLGLGFLASGGFGVAAITVLTWIYRYVTGKHPPGANQLDTARH 114
Query  119  KLASKAREMKDRAEQFSQQPVAGSQTS 145
            KL  KARE+KD    F QQ  +G+Q S
Sbjct  115  KLMGKAREIKD----FGQQQTSGAQAS 137

Sequence Alignment: 4. Allergen Name: Ara h 15.0101 Sequence ID: Q647G3

 Score = 129.0 bits 443,  Expect = 6e-32
 Identities = 73/130 56%, Positives = 93/130 71%, Gaps = 1/130 0%
Query  5    YGQQQQTRAPHLQLQPRAQRVVKAATAVTAGGSLLVLSGLTLAGTVIALTIATPLLVIFS 64
            YG    T       QP  ++ +K  TA T G S+L+LSGL L GTVI L IATPLLVIFS
Sbjct  25   YGSSYGTSYDPSTNQP-IRQAIKFMTASTIGVSFLILSGLILTGTVIGLIIATPLLVIFS 83
Query  65   PVLVPAVITIFLLGAGFLASGGFGVAALSVLSWIYRYLTGKHPPGADQLESAKTKLASKA 124
            P+LVPA IT+ L   GFL SGG GVAA++ LSW+Y Y+TGKHP G+D+L+ AK  +A KA
Sbjct  84   PILVPAAITLALAAGGFLFSGGCGVAAIAALSWLYSYVTGKHPAGSDRLDYAKGVIADKA 143
Query  125  REMKDRAEQFS 135
            R++KDRA+ ++
Sbjct  144  RDVKDRAKDYA 154

Sequence Alignment: 5. Allergen Name: Ara h 10.0101 Sequence ID: Q647G5

 Score = 94.3 bits 318,  Expect = 2e-21
 Identities = 47/118 39%, Positives = 74/118 62%, Gaps = 0/118 0%
Query  20   PRAQRVVKAATAVTAGGSLLVLSGLTLAGTVIALTIATPLLVIFSPVLVPAVITIFLLGA 79
            P   +V+   T +  GG+LL+++GL LAGT++ L + TPL+++FSPV+VPA+I + L  A
Sbjct  34   PSTSKVIAVITGLPIGGTLLLFAGLALAGTLLGLAVTTPLFILFSPVIVPAIIVVGLSVA 93
Query  80   GFLASGGFGVAALSVLSWIYRYLTGKHPPGADQLESAKTKLASKAREMKDRAEQFSQQ 137
            GFL SG  G+  LS +SW+  Y+   H    +QLE AK ++A  A  +  + +   Q+
Sbjct  94   GFLTSGACGLTGLSSFSWVMNYIRQTHGSVPEQLEMAKHRMADVAGYVGQKTKDVGQK 151

Sequence Alignment: 6. Allergen Name: Fag t 6.01 Sequence ID: QZM06934

 Score = 94.3 bits 318,  Expect = 2e-21
 Identities = 54/135 40%, Positives = 85/135 62%, Gaps = 3/135 2%
Query  2    AEHYGQQQQTR-APHLQLQ-PRAQRVVKAATAVTAGGSLLVLSGLTLAGTVIALTIATPL 59
            A+++GQQ  +  A +LQ + P  Q ++ AA  +  GG +LVL+ LTL GTVI L +ATPL
Sbjct  17   AQQHGQQALSNMAGYLQEKTPPTQHIIAAAALIPLGGFMLVLAALTLTGTVIGLAVATPL 76
Query  60   LVIFSPVLVPAVITIFLLGAGFLASGGFGVAALSVLSWIYRYLTG-KHPPGADQLESAKT 118
            +VIFSPVLVPA + + L   GF+ SG +G+ ALS LSW+  Y+   +   G   ++ A+ 
Sbjct  77   FVIFSPVLVPAALALGLATMGFIVSGALGLTALSALSWMISYIRQIRASGGPGIIDEARW 136
Query  119  KLASKAREMKDRAEQFSQ 136
            ++      + ++ + + Q
Sbjct  137  RVQQGIDRLGEKTKDLGQ 154

Sequence Alignment: 7. Allergen Name: Ara h 10.0102 Sequence ID: Q647G4

 Score = 92.7 bits 312,  Expect = 4e-21
 Identities = 47/117 40%, Positives = 72/117 61%, Gaps = 0/117 0%
Query  20   PRAQRVVKAATAVTAGGSLLVLSGLTLAGTVIALTIATPLLVIFSPVLVPAVITIFLLGA 79
            P   +V+   T +  GG+LL+++GL LAGT++ L + TPL+++FSPV+VPA I + L  A
Sbjct  34   PSTSKVIAVITGLPIGGTLLLFAGLALAGTLLGLAVTTPLFILFSPVIVPATIVVGLSVA 93
Query  80   GFLASGGFGVAALSVLSWIYRYLTGKHPPGADQLESAKTKLASKAREMKDRAEQFSQ 136
            GFL SG  G+  LS +SW+  Y+   H    +QLE AK ++A  A  +  + +   Q
Sbjct  94   GFLTSGACGLTGLSSFSWVMNYIRQTHGSVPEQLEMAKHRMADVAGYVGQKTKDVGQ 150

Sequence Alignment: 8. Allergen Name: Cor a 12.0101 Sequence ID: AAO67349

 Score = 90.2 bits 303,  Expect = 3e-20
 Identities = 48/118 40%, Positives = 72/118 61%, Gaps = 0/118 0%
Query  20   PRAQRVVKAATAVTAGGSLLVLSGLTLAGTVIALTIATPLLVIFSPVLVPAVITIFLLGA 79
            P A +V+    A+  GG+LL L+GLTLAG+VI L + +PL++IFSPVLVPA I + L  A
Sbjct  31   PSAVKVMAVLAALPVGGTLLALAGLTLAGSVIGLLVTSPLFIIFSPVLVPAAIVVGLAVA 90
Query  80   GFLASGGFGVAALSVLSWIYRYLTGKHPPGADQLESAKTKLASKAREMKDRAEQFSQQ 137
             FL+SG +G+  LS LSW+  YL         +++ AK ++   A  +  +  +  Q+
Sbjct  91   SFLSSGALGLTGLSSLSWVLNYLRCASQSLPREMDQAKRRMQDMAAFVGQKTREVGQE 148

Sequence Alignment: 9. Allergen Name: Ara h 14.0101 Sequence ID: Q9AXI1

 Score = 88.7 bits 298,  Expect = 8e-20
 Identities = 48/118 40%, Positives = 70/118 59%, Gaps = 1/118 0%
Query  20   PRAQRVVKAATAVTAGGSLLVLSGLTLAGTVIALTIATPLLVIFSPVLVPAVITIFLLGA 79
            P   +++     V  GG+LL+LSGL+L GT+I L IATP++  FSPV+VPAV+TI L   
Sbjct  45   PSTSQIIAVLVGVPTGGTLLLLSGLSLLGTIIGLAIATPVFTFFSPVIVPAVVTIGLAVT 104
Query  80   GFLASGGFGVAALSVLSWIYRYLTGKHPPGA-DQLESAKTKLASKAREMKDRAEQFSQQ 137
            G L +G  G+  L  LSW+  ++   H     DQL+S K ++A  A  +  + +   QQ
Sbjct  105  GILTAGACGLTGLMSLSWMINFIRQVHGTTVPDQLDSVKRRMADMADYVGQKTKDAGQQ 163

Sequence Alignment: 10. Allergen Name: Ara h 14.0102 Sequence ID: Q9AXI0

 Score = 88.5 bits 297,  Expect = 1e-19
 Identities = 48/118 40%, Positives = 71/118 60%, Gaps = 1/118 0%
Query  20   PRAQRVVKAATAVTAGGSLLVLSGLTLAGTVIALTIATPLLVIFSPVLVPAVITIFLLGA 79
            P   +++     V  GG+LL+LSGL+L GT+I L IATP++  FSPV+VPAV+TI L   
Sbjct  45   PSTSQIIAVLVGVPTGGTLLLLSGLSLLGTIIGLAIATPVFTFFSPVIVPAVVTIGLAVI 104
Query  80   GFLASGGFGVAALSVLSWIYRYLTGKHPPGA-DQLESAKTKLASKAREMKDRAEQFSQQ 137
            G L +G  G+  L  LSW+  ++   H     DQL+SAK ++A  A  +  + +   Q+
Sbjct  105  GILTAGACGLTGLMSLSWMINFIRQVHGTTVPDQLDSAKRRMADMADYVGQKTKDAGQE 163

Sequence Alignment: 11. Allergen Name: Ara h 14.0103 Sequence ID: Q6J1J8

 Score = 88.5 bits 297,  Expect = 1e-19
 Identities = 47/118 39%, Positives = 71/118 60%, Gaps = 1/118 0%
Query  20   PRAQRVVKAATAVTAGGSLLVLSGLTLAGTVIALTIATPLLVIFSPVLVPAVITIFLLGA 79
            P   +++     V  GG+LL+LSGL+L GT+I L IATP+++ FSPV+VPAV+TI L   
Sbjct  45   PSTSQIIAVLVGVPTGGTLLLLSGLSLLGTIIGLAIATPVFIFFSPVIVPAVVTIGLAVT 104
Query  80   GFLASGGFGVAALSVLSWIYRYLTGKHPPGA-DQLESAKTKLASKAREMKDRAEQFSQQ 137
            G L +G  G+  L  LSW+  ++   H     DQL+S K ++A  A  +  + +   Q+
Sbjct  105  GILTAGACGLTGLMSLSWMINFIRQVHGTTVPDQLDSVKRRMADMADYVGQKTKDAGQE 163

Sequence Alignment: 12. Allergen Name: Ses i 4 Sequence ID: AAG23840

 Score = 79.6 bits 265,  Expect = 4e-17
 Identities = 49/112 43%, Positives = 69/112 61%, Gaps = 8/112 7%
Query  17   QLQPRAQRVVKAATAVTAGGSLLVLSGLTLAGTVIALTIATPLLVIFSPVLVPAVITIFL 76
            Q  P   +++   T +   G+LL L+G+TL GT+I L +ATP++VIFSPVLVPA I I  
Sbjct  32   QKGPSTTQILAIITLLPISGTLLCLAGITLVGTLIGLAVATPVFVIFSPVLVPAAILIAG 91
Query  77   LGAGFLASGGFGVAALSVLSWI---YRYLTGKHPPGADQLESAKTKLASKAREMKDRAEQ 133
                FL SG FG+  LS LSW+   +R  TG+ P     LE AK  +      + ++ +Q
Sbjct  92   AVTAFLTSGAFGLTGLSSLSWVLNSFRRATGQGP-----LEYAKRGVQEGTLYVGEKTKQ 146

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.