The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE
EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVKA
Sequence Info Allergen Name Length Opt Bits Score E Value
Q90YK7 The c 1 109 693 121.0 7.1e-30
P59747 Sco j 1 109 604 106.9 1.3e-25
A0A1B1V0G7 Ras k 1.0101 109 597 105.7 2.9e-25
FM202668 Xip g 1.0101 109 578 102.7 2.3e-24
CAM56786 Gad m 1.0202 109 560 99.8 1.7e-23
QCY53440 Cten i 1.0101 109 558 99.5 2.1e-23
Q90YK9 Gad m 1.0201 109 554 98.9 3.3e-23
AAK63087 Gad m 1.0201 109 554 98.9 3.3e-23
XP_026772003 Pan h 1.0101 109 552 98.6 4.1e-23
CAQ72969 Seb m 1.0201 110 549 98.1 5.8e-23
Q5IRB2 Lat c 1.0101 109 547 97.8 7.2e-23
CAC83658 Cyp c 1.01 109 544 97.3 1e-22
CAC83659 Cyp c 1.02 109 543 97.1 1.1e-22
Q6ITU9 Lat c 1.0201 109 540 96.7 1.5e-22
CAQ72971 Clu h 1.0201 110 537 96.2 2.2e-22
AAK63086 Gad m 1.0101 109 520 93.5 1.4e-21
CAQ72967 Thu a 1.0101 109 518 93.2 1.8e-21
CAA66404 Sal s 1 108 516 92.8 2.2e-21
CAM56785 Gad m 1.0102 109 514 92.5 2.7e-21
Q91483 Sal s 1 107 509 91.7 4.7e-21
FM177701 Sar sa 1.0101 109 500 90.3 1.3e-20
CAQ72972 Clu h 1.0301 109 500 90.3 1.3e-20
CAQ72970 Clu h 1.0101 109 487 88.2 5.4e-20
XP_019397705 Cro p 1.0101 109 479 86.9 1.3e-19
CAQ72968 Seb m 1.0101 109 476 86.5 1.8e-19
AM904681 Lep w 1.0101 109 466 84.9 5.5e-19
Q91482 Sal s 1 109 463 84.4 7.6e-19
CAC95152 Ran e 2 109 452 82.6 2.6e-18
P02622 Gad c 1 113 419 77.4 1e-16
P86432 Onc m 1.0201 107 412 76.3 2.1e-16
P86431 Onc m 1.0101 108 408 75.6 3.3e-16
C1L370 Gal d 8.0101 110 373 70.1 1.6e-14
XP_019400389 Cro p 2.0101 110 372 69.9 1.8e-14
XP_026803769 Pan h 1.0201 109 370 69.6 2.2e-14
CAC83046 Ran e 1 110 358 67.7 8.3e-14
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: The c 1 Sequence ID: Q90YK7

 Score = 121.0 bits 693,  Expect = 7e-30
 Identities = 109/109 100%, Positives = 109/109 100%, Gaps = 0/109 0%
Query  1    MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE 60
            MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE
Sbjct  1    MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE 60
Query  61   EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVKA 109
            EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVKA
Sbjct  61   EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVKA 109

Sequence Alignment: 2. Allergen Name: Sco j 1 Sequence ID: P59747

 Score = 106.9 bits 604,  Expect = 1e-25
 Identities = 90/108 83%, Positives = 100/108 92%, Gaps = 0/108 0%
Query  1    MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE 60
            MAFA +LKDAEV AAL+ CK+AGSFDH KFFK+CGL+GKS+D+VKKAF IIDQD+S FIE
Sbjct  1    MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE 60
Query  61   EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVK 108
            EEELKLFLQNF A ARALSDAETKAFLKAGDSDGDGKIG+DEFAAM+K
Sbjct  61   EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIK 108

Sequence Alignment: 3. Allergen Name: Ras k 1.0101 Sequence ID: A0A1B1V0G7

 Score = 105.7 bits 597,  Expect = 3e-25
 Identities = 89/108 82%, Positives = 97/108 89%, Gaps = 0/108 0%
Query  1    MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE 60
            MAFA +LKDAE+ AAL+ CK+ GSFDH KFFK+CGLAGKS DDVKKAF IIDQD+S FIE
Sbjct  1    MAFASVLKDAEITAALDGCKADGSFDHKKFFKACGLAGKSGDDVKKAFAIIDQDKSGFIE 60
Query  61   EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVK 108
            EEELKLFLQNF A AR LSDAETKAFLKAGD+DGDGKIGVDEFAAM+K
Sbjct  61   EEELKLFLQNFKAGARTLSDAETKAFLKAGDTDGDGKIGVDEFAAMIK 108

Sequence Alignment: 4. Allergen Name: Xip g 1.0101 Sequence ID: FM202668

 Score = 102.7 bits 578,  Expect = 2e-24
 Identities = 87/109 79%, Positives = 99/109 90%, Gaps = 0/109 0%
Query  1    MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE 60
            MAFAG+L DA+VAAALEACK AG+FD+ KFFKSCGLA KS+DDVKKAF IIDQD+S FIE
Sbjct  1    MAFAGVLSDADVAAALEACKDAGTFDYKKFFKSCGLAAKSTDDVKKAFAIIDQDKSGFIE 60
Query  61   EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVKA 109
            E+ELKLFLQNF A+AR L+DAET+AFLKAGDSDGDGKIG +EFAA+V A
Sbjct  61   EDELKLFLQNFKAAARPLTDAETEAFLKAGDSDGDGKIGAEEFAALVTA 109

Sequence Alignment: 5. Allergen Name: Gad m 1.0202 Sequence ID: CAM56786

 Score = 99.8 bits 560,  Expect = 2e-23
 Identities = 85/109 77%, Positives = 93/109 85%, Gaps = 0/109 0%
Query  1    MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE 60
            MAFAGIL DA++ AAL ACK+ GSFDH  FF   GLA KSS D+KK F IIDQD+SDF+E
Sbjct  1    MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSSADIKKVFEIIDQDKSDFVE 60
Query  61   EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVKA 109
            E+ELKLFLQNFSA ARALSDAETK FLKAGDSDGDGKIGVDEF AM+KA
Sbjct  61   EDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA 109

Sequence Alignment: 6. Allergen Name: Cten i 1.0101 Sequence ID: QCY53440

 Score = 99.5 bits 558,  Expect = 2e-23
 Identities = 86/109 78%, Positives = 95/109 87%, Gaps = 0/109 0%
Query  1    MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE 60
            MAFAGIL DA++AAALEACK+A SF+H  FF   GL+ KS DDVKKAF IIDQD+S FIE
Sbjct  1    MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE 60
Query  61   EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVKA 109
            E+ELKLFLQNF A ARAL+DAETK FLKAGDSDGDGKIGVDEFAA+VKA
Sbjct  61   EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVKA 109

Sequence Alignment: 7. Allergen Name: Gad m 1.0201 Sequence ID: Q90YK9

 Score = 98.9 bits 554,  Expect = 3e-23
 Identities = 84/109 77%, Positives = 92/109 84%, Gaps = 0/109 0%
Query  1    MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE 60
            MAFAGIL DA++ AAL ACK+ GSFDH  FF   GLA KS  D+KK F IIDQD+SDF+E
Sbjct  1    MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSPADIKKVFEIIDQDKSDFVE 60
Query  61   EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVKA 109
            E+ELKLFLQNFSA ARALSDAETK FLKAGDSDGDGKIGVDEF AM+KA
Sbjct  61   EDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA 109

Sequence Alignment: 8. Allergen Name: Gad m 1.0201 Sequence ID: AAK63087

 Score = 98.9 bits 554,  Expect = 3e-23
 Identities = 84/109 77%, Positives = 92/109 84%, Gaps = 0/109 0%
Query  1    MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE 60
            MAFAGIL DA++ AAL ACK+ GSFDH  FF   GLA KS  D+KK F IIDQD+SDF+E
Sbjct  1    MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSPADIKKVFEIIDQDKSDFVE 60
Query  61   EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVKA 109
            E+ELKLFLQNFSA ARALSDAETK FLKAGDSDGDGKIGVDEF AM+KA
Sbjct  61   EDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA 109

Sequence Alignment: 9. Allergen Name: Pan h 1.0101 Sequence ID: XP_026772003

 Score = 98.6 bits 552,  Expect = 4e-23
 Identities = 82/109 75%, Positives = 95/109 87%, Gaps = 0/109 0%
Query  1    MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE 60
            MAFAG+L DA++AAAL+ACK+ GSFDH  FF   GL GKS+DDVKKAF IIDQD+S FIE
Sbjct  1    MAFAGVLNDADIAAALDACKADGSFDHKAFFTKVGLTGKSADDVKKAFSIIDQDKSGFIE 60
Query  61   EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVKA 109
            E+ELKLFLQNF + ARAL+D ETK FLKAGD+DGDGKIGVDEFA++VKA
Sbjct  61   EDELKLFLQNFKSDARALTDNETKIFLKAGDTDGDGKIGVDEFASLVKA 109

Sequence Alignment: 10. Allergen Name: Seb m 1.0201 Sequence ID: CAQ72969

 Score = 98.1 bits 549,  Expect = 6e-23
 Identities = 85/108 78%, Positives = 94/108 87%, Gaps = 1/108 0%
Query  1    MAFAGI-LKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFI 59
            MAFA + LKDA++AAAL+ CK AG F+H  FFK+CGL+GKSSD+VKKAF IIDQD S FI
Sbjct  1    MAFASVGLKDADIAAALDGCKDAGKFNHKTFFKTCGLSGKSSDEVKKAFAIIDQDISGFI 60
Query  60   EEEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVK 108
            EEEELKLFLQ F A ARALSDAETK FLKAGDSDGDGKIG DE+AAMVK
Sbjct  61   EEEELKLFLQTFKAGARALSDAETKEFLKAGDSDGDGKIGADEWAAMVK 109

Sequence Alignment: 11. Allergen Name: Lat c 1.0101 Sequence ID: Q5IRB2

 Score = 97.8 bits 547,  Expect = 7e-23
 Identities = 84/108 77%, Positives = 94/108 87%, Gaps = 0/108 0%
Query  1    MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE 60
            MAFAGIL +A++ AAL AC++A SF H  FF   GLAGKS DDVKKAF +IDQD+S FIE
Sbjct  1    MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIE 60
Query  61   EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVK 108
            E+ELKLFLQNFSASARAL+DAETK FLKAGDSDGDGKIGVDEFAA+VK
Sbjct  61   EDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVK 108

Sequence Alignment: 12. Allergen Name: Cyp c 1.01 Sequence ID: CAC83658

 Score = 97.3 bits 544,  Expect = 1e-22
 Identities = 81/109 74%, Positives = 95/109 87%, Gaps = 0/109 0%
Query  1    MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE 60
            MAFAGIL DA++ AAL+ C++A SFD+  FF   GL+ K+ DD+KKAF +IDQD+S FIE
Sbjct  1    MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIE 60
Query  61   EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVKA 109
            E+ELKLFLQNFSA ARAL+DAETKAFLKAGDSDGDGKIGVDEFAA+VKA
Sbjct  61   EDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVKA 109

Sequence Alignment: 13. Allergen Name: Cyp c 1.02 Sequence ID: CAC83659

 Score = 97.1 bits 543,  Expect = 1e-22
 Identities = 82/109 75%, Positives = 92/109 84%, Gaps = 0/109 0%
Query  1    MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE 60
            MAFAG+L DA++ AALEACK+A SF+H  FF   GL  KS+DDVKKAF IIDQD+S FIE
Sbjct  1    MAFAGVLNDADITAALEACKAADSFNHKTFFAKVGLTSKSADDVKKAFAIIDQDKSGFIE 60
Query  61   EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVKA 109
            E+ELKLFLQNF A ARAL+D ETK FLKAGDSDGDGKIGVDEF A+VKA
Sbjct  61   EDELKLFLQNFKAGARALTDGETKTFLKAGDSDGDGKIGVDEFTALVKA 109

Sequence Alignment: 14. Allergen Name: Lat c 1.0201 Sequence ID: Q6ITU9

 Score = 96.7 bits 540,  Expect = 2e-22
 Identities = 78/108 72%, Positives = 91/108 84%, Gaps = 0/108 0%
Query  1    MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE 60
            MAF+ +L D++VAAAL+ CK AG+FDH KFF +CGL+ K+SDDVKKAF IIDQD+S FIE
Sbjct  1    MAFSNVLSDSDVAAALDGCKDAGTFDHKKFFSACGLSNKTSDDVKKAFAIIDQDKSGFIE 60
Query  61   EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVK 108
            EEELKLFLQNF A AR L+D ET  FLKAGD+DGDGKIG DEF A+VK
Sbjct  61   EEELKLFLQNFKADARVLTDVETSTFLKAGDTDGDGKIGADEFTALVK 108

Sequence Alignment: 15. Allergen Name: Clu h 1.0201 Sequence ID: CAQ72971

 Score = 96.2 bits 537,  Expect = 2e-22
 Identities = 83/109 76%, Positives = 92/109 84%, Gaps = 0/109 0%
Query  1    MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE 60
            MAFAG+L DA++AAAL AC +A +FDH  FFK  GL+GKS+DDVKK F IIDQD+S FIE
Sbjct  1    MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE 60
Query  61   EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVKA 109
            EEELKLFLQNF A ARALSD ETKAFL AGD+DGDG IGVDEFA MVKA
Sbjct  61   EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVKA 109

Sequence Alignment: 16. Allergen Name: Gad m 1.0101 Sequence ID: AAK63086

 Score = 93.5 bits 520,  Expect = 1e-21
 Identities = 79/109 72%, Positives = 94/109 86%, Gaps = 0/109 0%
Query  1    MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE 60
            MAFAGIL DA+ AAA++AC++A SF +  FF  CGL+GKS+DD+KKAF +IDQD+S FIE
Sbjct  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
Query  61   EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVKA 109
            E+ELKLFLQ F A ARAL+DAETKAFLKAGDSDGDG IGVDE+A +VKA
Sbjct  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVKA 109

Sequence Alignment: 17. Allergen Name: Thu a 1.0101 Sequence ID: CAQ72967

 Score = 93.2 bits 518,  Expect = 2e-21
 Identities = 78/109 71%, Positives = 93/109 85%, Gaps = 0/109 0%
Query  1    MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE 60
            MAFAGIL +A++ AAL AC++A SF +  FF   GLA K+ +D+KKAF +IDQD+S FIE
Sbjct  1    MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIE 60
Query  61   EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVKA 109
            E+ELKLFLQNFSA ARAL+DAETKAFL AGDSDGDGKIG+DEFAA+VKA
Sbjct  61   EDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVKA 109

Sequence Alignment: 18. Allergen Name: Sal s 1 Sequence ID: CAA66404

 Score = 92.8 bits 516,  Expect = 2e-21
 Identities = 82/107 76%, Positives = 91/107 85%, Gaps = 1/107 0%
Query  1    MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE 60
            M+FAG L DA+VAAAL AC +A SF+H  FF   GLA KSSDDVKKAF +IDQD+S FIE
Sbjct  1    MSFAG-LNDADVAAALAACTAADSFNHKAFFAKVGLASKSSDDVKKAFYVIDQDKSGFIE 59
Query  61   EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVK 108
            E+ELKLFLQNFSASARAL+DAETKAFL  GD DGDG IGVDEFAAM+K
Sbjct  60   EDELKLFLQNFSASARALTDAETKAFLADGDKDGDGMIGVDEFAAMIK 107

Sequence Alignment: 19. Allergen Name: Gad m 1.0102 Sequence ID: CAM56785

 Score = 92.5 bits 514,  Expect = 3e-21
 Identities = 78/109 71%, Positives = 94/109 86%, Gaps = 0/109 0%
Query  1    MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE 60
            MAFAGIL DA+ AAA++AC++A SF +  FF  CGL+GKS+DD+KKAF +IDQD+S FIE
Sbjct  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
Query  61   EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVKA 109
            E+ELKLFLQ F A ARAL+DAETKAFLKAGDSDGDG IGV+E+A +VKA
Sbjct  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVEEWAVLVKA 109

Sequence Alignment: 20. Allergen Name: Sal s 1 Sequence ID: Q91483

 Score = 91.7 bits 509,  Expect = 5e-21
 Identities = 81/106 76%, Positives = 90/106 84%, Gaps = 1/106 0%
Query  2    AFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIEE 61
            +FAG L DA+VAAAL AC +A SF+H  FF   GLA KSSDDVKKAF +IDQD+S FIEE
Sbjct  1    SFAG-LNDADVAAALAACTAADSFNHKAFFAKVGLASKSSDDVKKAFYVIDQDKSGFIEE 59
Query  62   EELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVK 108
            +ELKLFLQNFSASARAL+DAETKAFL  GD DGDG IGVDEFAAM+K
Sbjct  60   DELKLFLQNFSASARALTDAETKAFLADGDKDGDGMIGVDEFAAMIK 106

Sequence Alignment: 21. Allergen Name: Sar sa 1.0101 Sequence ID: FM177701

 Score = 90.3 bits 500,  Expect = 1e-20
 Identities = 74/108 68%, Positives = 91/108 84%, Gaps = 0/108 0%
Query  1    MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE 60
            MA+AG++K+A++ AALEACK+A SFDH  FF   G++GKS+D++KKAF IIDQD+S FIE
Sbjct  1    MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAIIDQDKSGFIE 60
Query  61   EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVK 108
            EEELKLFLQNF   ARAL+D ETK FLKAGD+ GDGKIG+DEF  +VK
Sbjct  61   EEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGIDEFNHLVK 108

Sequence Alignment: 22. Allergen Name: Clu h 1.0301 Sequence ID: CAQ72972

 Score = 90.3 bits 500,  Expect = 1e-20
 Identities = 76/107 71%, Positives = 86/107 80%, Gaps = 0/107 0%
Query  1    MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE 60
            MAFA  LK+A++ AAL ACK A SFDH  FF   GL GKS D++KKAF IIDQD+S FIE
Sbjct  1    MAFAAFLKEADITAALGACKGADSFDHKAFFAKVGLKGKSGDELKKAFEIIDQDKSGFIE 60
Query  61   EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMV 107
            EEELKLFLQNF   ARAL+D ETK FLKAGDSD DGKIG+DEFAA++
Sbjct  61   EEELKLFLQNFCKGARALTDGETKKFLKAGDSDNDGKIGIDEFAALI 107

Sequence Alignment: 23. Allergen Name: Clu h 1.0101 Sequence ID: CAQ72970

 Score = 88.2 bits 487,  Expect = 5e-20
 Identities = 76/108 70%, Positives = 89/108 82%, Gaps = 0/108 0%
Query  1    MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE 60
            MA+A +LK A++ AAL+AC++  SF H  FF   GLA KS+ D+KKAF IIDQD+S FIE
Sbjct  1    MALASLLKGADIDAALKACEAKDSFKHKDFFAKIGLATKSAADLKKAFEIIDQDKSGFIE 60
Query  61   EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVK 108
            EEELKLFLQNF A ARAL+DAETKAFLKAGD+DGDG IGVDEFA M+K
Sbjct  61   EEELKLFLQNFKAGARALTDAETKAFLKAGDADGDGMIGVDEFAVMIK 108

Sequence Alignment: 24. Allergen Name: Cro p 1.0101 Sequence ID: XP_019397705

 Score = 86.9 bits 479,  Expect = 1e-19
 Identities = 72/109 66%, Positives = 90/109 82%, Gaps = 0/109 0%
Query  1    MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE 60
            MA   IL   ++ AAL +C++A SF++  FF + GL GKS+D VKK FGI+DQD+S FIE
Sbjct  1    MAITDILSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIE 60
Query  61   EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVKA 109
            E+EL+LFL+NFS+SARAL+DAETKAFL AGD+DGDGKIGVDEF A+VKA
Sbjct  61   EDELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVKA 109

Sequence Alignment: 25. Allergen Name: Seb m 1.0101 Sequence ID: CAQ72968

 Score = 86.5 bits 476,  Expect = 2e-19
 Identities = 73/108 67%, Positives = 86/108 79%, Gaps = 0/108 0%
Query  1    MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE 60
            MA+A  L  A++ AAL AC    +F H  FF   GL+ KS+DD+K AF +IDQD+S FIE
Sbjct  1    MALAASLNAADITAALAACSGVDTFKHKDFFGKVGLSAKSADDIKNAFKVIDQDKSGFIE 60
Query  61   EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVK 108
            EEELKLFLQNFSA+ARAL++AET AFLKAGDSDGDG IG+DEFAAMVK
Sbjct  61   EEELKLFLQNFSATARALTEAETTAFLKAGDSDGDGMIGMDEFAAMVK 108

Sequence Alignment: 26. Allergen Name: Lep w 1.0101 Sequence ID: AM904681

 Score = 84.9 bits 466,  Expect = 5e-19
 Identities = 72/108 66%, Positives = 88/108 81%, Gaps = 1/108 0%
Query  1    MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE 60
            M FAG L  AE+ AAL+ C +A SFD+ KFF +CGLA KS+++VK AF  IDQD+S FIE
Sbjct  1    MTFAG-LDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIE 59
Query  61   EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVKA 109
            E+ELKLFLQNFSASARAL+D ET  FLKAGD DGDGKIG++EF  +V++
Sbjct  60   EDELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVRS 108

Sequence Alignment: 27. Allergen Name: Sal s 1 Sequence ID: Q91482

 Score = 84.4 bits 463,  Expect = 8e-19
 Identities = 71/108 65%, Positives = 85/108 78%, Gaps = 0/108 0%
Query  1    MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE 60
            MA A + K+A++  ALEACK+A +F    FF + G+A KS+DDVKKAF +IDQD S FIE
Sbjct  1    MACAHLCKEADIKTALEACKAADTFSFKTFFHTIGFASKSADDVKKAFKVIDQDASGFIE 60
Query  61   EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVK 108
             EELKLFLQNF   AR L+DAETKAFLKAGD+DGDG IG+DEFA +VK
Sbjct  61   VEELKLFLQNFCPKARELTDAETKAFLKAGDADGDGMIGIDEFAVLVK 108

Sequence Alignment: 28. Allergen Name: Ran e 2 Sequence ID: CAC95152

 Score = 82.6 bits 452,  Expect = 3e-18
 Identities = 70/109 64%, Positives = 88/109 80%, Gaps = 0/109 0%
Query  1    MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE 60
            M+   I+ + ++ AALE+ K+AGSF++  FF+  GLAGKS+ D KK F I+D+D+S FIE
Sbjct  1    MSITDIVSEKDIDAALESVKAAGSFNYKIFFQKVGLAGKSAADAKKVFEILDRDKSGFIE 60
Query  61   EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVKA 109
            ++EL LFLQNF ASAR LSDAET AFLKAGDSDGDGKIGV+EF A+VKA
Sbjct  61   QDELGLFLQNFRASARVLSDAETSAFLKAGDSDGDGKIGVEEFQALVKA 109

Sequence Alignment: 29. Allergen Name: Gad c 1 Sequence ID: P02622

 Score = 77.4 bits 419,  Expect = 1e-16
 Identities = 66/106 62%, Positives = 79/106 74%, Gaps = 0/106 0%
Query  2    AFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIEE 61
            AF GIL +A++ AA  AC   GSFD   F+   GL   S+D++KK F I D+D+  FIEE
Sbjct  1    AFKGILSNADIKAAEAACFKEGSFDEDGFYAKVGLDAFSADELKKLFKIADEDKEGFIEE 60
Query  62   EELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMV 107
            +ELKLFL  F+A  RAL+DAETKAFLKAGDSDGDGKIGVDEF A+V
Sbjct  61   DELKLFLIAFAADLRALTDAETKAFLKAGDSDGDGKIGVDEFGALV 106

Sequence Alignment: 30. Allergen Name: Onc m 1.0201 Sequence ID: P86432

 Score = 76.3 bits 412,  Expect = 2e-16
 Identities = 66/106 62%, Positives = 80/106 75%, Gaps = 1/106 0%
Query  2    AFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIEE 61
            +FAG L DA+VAAAL AC +A SF+H  FF        S DD+KK    +DQD+S F+EE
Sbjct  1    SFAG-LNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEE 59
Query  62   EELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVK 108
            +ELKLFLQNFSASARAL+DAETK    AGD+DGDG +G+DEFA +VK
Sbjct  60   DELKLFLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVK 106

Sequence Alignment: 31. Allergen Name: Onc m 1.0101 Sequence ID: P86431

 Score = 75.6 bits 408,  Expect = 3e-16
 Identities = 63/107 58%, Positives = 79/107 73%, Gaps = 0/107 0%
Query  2    AFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIEE 61
            A A + K+A++  ALEACK+A SF+   FF + G+A K  DDVKK   ++DQD S F+E 
Sbjct  1    ACAHLCKEADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEV 60
Query  62   EELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVK 108
            EELKLFLQNF      L+DAETKAFLKAGD+DGDG +G+DEFA +VK
Sbjct  61   EELKLFLQNFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVK 107

Sequence Alignment: 32. Allergen Name: Gal d 8.0101 Sequence ID: C1L370

 Score = 70.1 bits 373,  Expect = 2e-14
 Identities = 59/107 55%, Positives = 75/107 70%, Gaps = 0/107 0%
Query  1    MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE 60
            MA   +L   ++  A+ A  +A SF++ KFF+  GL  KS +DVKK F I+D+D+S FIE
Sbjct  1    MAMTDVLSAEDIKKAVGAFSAAESFNYKKFFEMVGLKKKSPEDVKKVFHILDKDRSGFIE 60
Query  61   EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMV 107
            EEELK+ L+ F+   R LSD ETKA+L AGD DGDGKIG DEFA MV
Sbjct  61   EEELKFVLKGFTPDGRDLSDKETKALLAAGDKDGDGKIGADEFATMV 107

Sequence Alignment: 33. Allergen Name: Cro p 2.0101 Sequence ID: XP_019400389

 Score = 69.9 bits 372,  Expect = 2e-14
 Identities = 59/107 55%, Positives = 75/107 70%, Gaps = 0/107 0%
Query  1    MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE 60
            MA   +L   ++  A+ A  +A SF+H KFF+  GL  KS DDVKK F I+D+D+S FIE
Sbjct  1    MAMTDLLSADDIKKAVGAFAAAESFNHKKFFEMVGLKKKSQDDVKKVFHILDKDRSGFIE 60
Query  61   EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMV 107
            E+ELK  L+ F+  AR LSD ETK +L AGD DGDGKIGVDEF ++V
Sbjct  61   EDELKSVLKGFTPDARDLSDKETKELLAAGDKDGDGKIGVDEFTSLV 107

Sequence Alignment: 34. Allergen Name: Pan h 1.0201 Sequence ID: XP_026803769

 Score = 69.6 bits 370,  Expect = 2e-14
 Identities = 57/107 53%, Positives = 74/107 69%, Gaps = 0/107 0%
Query  1    MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE 60
            MA   +LK  ++  AL+  K A +FDH KFF+  GL   S+++VKK F ++D D S FIE
Sbjct  1    MAMQDLLKADDIKKALDTFKVADTFDHKKFFELVGLKAMSAENVKKVFSVLDVDASGFIE 60
Query  61   EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMV 107
            E+ELK+ L+ FS   R L+D ETKAFL A D DGDGKIG+DEF A+V
Sbjct  61   EDELKFVLKGFSKDGRDLTDKETKAFLTAADRDGDGKIGIDEFEAIV 107

Sequence Alignment: 35. Allergen Name: Ran e 1 Sequence ID: CAC83046

 Score = 67.7 bits 358,  Expect = 8e-14
 Identities = 54/107 50%, Positives = 73/107 68%, Gaps = 0/107 0%
Query  1    MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE 60
            M    +L   +++ A+ A  +  SF+H KFF+ CGL  KS + ++K F ++DQDQS FIE
Sbjct  1    MPMTDLLAAGDISKAVSAFAAPESFNHKKFFELCGLKSKSKEIMQKVFHVLDQDQSGFIE 60
Query  61   EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMV 107
            +EEL L L+ F+   R+LSD ET A+L AGD DGDGKIGVDEF  +V
Sbjct  61   KEELCLILKGFTPEGRSLSDKETTALLAAGDKDGDGKIGVDEFVTLV 107

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.