The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE
EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVKA
Sequence Info Allergen Name Length Opt Bits Score E Value
QCY53440 Cten i 1.0101 109 687 96.9 1.3e-22
CAC83659 Cyp c 1.02 109 636 90.6 1e-20
XP_026772003 Pan h 1.0101 109 619 88.5 4.5e-20
CAC83658 Cyp c 1.01 109 616 88.1 5.8e-20
Q5IRB2 Lat c 1.0101 109 599 86.0 2.5e-19
CAM56786 Gad m 1.0202 109 579 83.5 1.4e-18
Q90YK9 Gad m 1.0201 109 577 83.3 1.6e-18
AAK63087 Gad m 1.0201 109 577 83.3 1.6e-18
CAQ72967 Thu a 1.0101 109 576 83.2 1.8e-18
CAA66404 Sal s 1 108 572 82.7 2.5e-18
Q91483 Sal s 1 107 565 81.8 4.5e-18
AAK63086 Gad m 1.0101 109 565 81.8 4.6e-18
FM202668 Xip g 1.0101 109 564 81.7 5e-18
CAQ72971 Clu h 1.0201 110 562 81.4 5.9e-18
CAM56785 Gad m 1.0102 109 559 81.1 7.6e-18
Q90YK7 The c 1 109 558 80.9 8.3e-18
P59747 Sco j 1 109 557 80.8 9.1e-18
A0A1B1V0G7 Ras k 1.0101 109 556 80.7 9.9e-18
CAQ72972 Clu h 1.0301 109 547 79.6 2.1e-17
Q6ITU9 Lat c 1.0201 109 544 79.2 2.8e-17
FM177701 Sar sa 1.0101 109 540 78.7 3.9e-17
CAQ72970 Clu h 1.0101 109 532 77.7 7.7e-17
CAQ72969 Seb m 1.0201 110 524 76.7 1.5e-16
CAQ72968 Seb m 1.0101 109 523 76.6 1.7e-16
XP_019397705 Cro p 1.0101 109 505 74.4 7.8e-16
Q91482 Sal s 1 109 485 71.9 4.3e-15
P86432 Onc m 1.0201 107 483 71.7 5.1e-15
CAC95152 Ran e 2 109 478 71.1 7.9e-15
P02622 Gad c 1 113 462 69.1 3.2e-14
AM904681 Lep w 1.0101 109 461 69.0 3.4e-14
P86431 Onc m 1.0101 108 431 65.2 4.4e-13
XP_019400389 Cro p 2.0101 110 416 63.4 1.6e-12
XP_026803769 Pan h 1.0201 109 401 61.5 5.8e-12
C1L370 Gal d 8.0101 110 399 61.3 6.9e-12
CAC83046 Ran e 1 110 356 56.0 2.7e-10
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Cten i 1.0101 Sequence ID: QCY53440

 Score = 96.9 bits 687,  Expect = 1e-22
 Identities = 109/109 100%, Positives = 109/109 100%, Gaps = 0/109 0%
Query  1    MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE 60
            MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE
Sbjct  1    MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE 60
Query  61   EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVKA 109
            EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVKA
Sbjct  61   EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVKA 109

Sequence Alignment: 2. Allergen Name: Cyp c 1.02 Sequence ID: CAC83659

 Score = 90.6 bits 636,  Expect = 1e-20
 Identities = 99/109 90%, Positives = 102/109 93%, Gaps = 0/109 0%
Query  1    MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE 60
            MAFAG+LNDADI AALEACKAADSFNHK FFAKVGL++KS DDVKKAFAIIDQDKSGFIE
Sbjct  1    MAFAGVLNDADITAALEACKAADSFNHKTFFAKVGLTSKSADDVKKAFAIIDQDKSGFIE 60
Query  61   EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVKA 109
            EDELKLFLQNFKA ARALTD ETK FLKAGDSDGDGKIGVDEF ALVKA
Sbjct  61   EDELKLFLQNFKAGARALTDGETKTFLKAGDSDGDGKIGVDEFTALVKA 109

Sequence Alignment: 3. Allergen Name: Pan h 1.0101 Sequence ID: XP_026772003

 Score = 88.5 bits 619,  Expect = 4e-20
 Identities = 95/109 87%, Positives = 103/109 94%, Gaps = 0/109 0%
Query  1    MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE 60
            MAFAG+LNDADIAAAL+ACKA  SF+HKAFF KVGL+ KS DDVKKAF+IIDQDKSGFIE
Sbjct  1    MAFAGVLNDADIAAALDACKADGSFDHKAFFTKVGLTGKSADDVKKAFSIIDQDKSGFIE 60
Query  61   EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVKA 109
            EDELKLFLQNFK+DARALTD ETKIFLKAGD+DGDGKIGVDEFA+LVKA
Sbjct  61   EDELKLFLQNFKSDARALTDNETKIFLKAGDTDGDGKIGVDEFASLVKA 109

Sequence Alignment: 4. Allergen Name: Cyp c 1.01 Sequence ID: CAC83658

 Score = 88.1 bits 616,  Expect = 6e-20
 Identities = 95/109 87%, Positives = 103/109 94%, Gaps = 0/109 0%
Query  1    MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE 60
            MAFAGILNDADI AAL+ C+AADSF++K+FFAKVGLSAK+ DD+KKAFA+IDQDKSGFIE
Sbjct  1    MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIE 60
Query  61   EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVKA 109
            EDELKLFLQNF A ARALTDAETK FLKAGDSDGDGKIGVDEFAALVKA
Sbjct  61   EDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVKA 109

Sequence Alignment: 5. Allergen Name: Lat c 1.0101 Sequence ID: Q5IRB2

 Score = 86.0 bits 599,  Expect = 2e-19
 Identities = 94/108 87%, Positives = 98/108 90%, Gaps = 0/108 0%
Query  1    MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE 60
            MAFAGILN+ADI AAL AC+AADSF HK FF KVGL+ KS DDVKKAFA+IDQDKSGFIE
Sbjct  1    MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIE 60
Query  61   EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVK 108
            EDELKLFLQNF A ARALTDAETK FLKAGDSDGDGKIGVDEFAALVK
Sbjct  61   EDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVK 108

Sequence Alignment: 6. Allergen Name: Gad m 1.0202 Sequence ID: CAM56786

 Score = 83.5 bits 579,  Expect = 1e-18
 Identities = 88/109 80%, Positives = 96/109 88%, Gaps = 0/109 0%
Query  1    MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE 60
            MAFAGILNDADI AAL ACKA  SF+HKAFF KVGL+AKS  D+KK F IIDQDKS F+E
Sbjct  1    MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSSADIKKVFEIIDQDKSDFVE 60
Query  61   EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVKA 109
            EDELKLFLQNF A ARAL+DAETK+FLKAGDSDGDGKIGVDEF A++KA
Sbjct  61   EDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA 109

Sequence Alignment: 7. Allergen Name: Gad m 1.0201 Sequence ID: Q90YK9

 Score = 83.3 bits 577,  Expect = 2e-18
 Identities = 88/109 80%, Positives = 96/109 88%, Gaps = 0/109 0%
Query  1    MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE 60
            MAFAGILNDADI AAL ACKA  SF+HKAFF KVGL+AKS  D+KK F IIDQDKS F+E
Sbjct  1    MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSPADIKKVFEIIDQDKSDFVE 60
Query  61   EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVKA 109
            EDELKLFLQNF A ARAL+DAETK+FLKAGDSDGDGKIGVDEF A++KA
Sbjct  61   EDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA 109

Sequence Alignment: 8. Allergen Name: Gad m 1.0201 Sequence ID: AAK63087

 Score = 83.3 bits 577,  Expect = 2e-18
 Identities = 88/109 80%, Positives = 96/109 88%, Gaps = 0/109 0%
Query  1    MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE 60
            MAFAGILNDADI AAL ACKA  SF+HKAFF KVGL+AKS  D+KK F IIDQDKS F+E
Sbjct  1    MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSPADIKKVFEIIDQDKSDFVE 60
Query  61   EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVKA 109
            EDELKLFLQNF A ARAL+DAETK+FLKAGDSDGDGKIGVDEF A++KA
Sbjct  61   EDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA 109

Sequence Alignment: 9. Allergen Name: Thu a 1.0101 Sequence ID: CAQ72967

 Score = 83.2 bits 576,  Expect = 2e-18
 Identities = 89/109 81%, Positives = 98/109 89%, Gaps = 0/109 0%
Query  1    MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE 60
            MAFAGIL +ADI AAL AC+AADSF +K FF KVGL+AK+ +D+KKAFA+IDQDKSGFIE
Sbjct  1    MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIE 60
Query  61   EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVKA 109
            EDELKLFLQNF A ARALTDAETK FL AGDSDGDGKIG+DEFAALVKA
Sbjct  61   EDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVKA 109

Sequence Alignment: 10. Allergen Name: Sal s 1 Sequence ID: CAA66404

 Score = 82.7 bits 572,  Expect = 3e-18
 Identities = 89/107 83%, Positives = 96/107 89%, Gaps = 1/107 0%
Query  1    MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE 60
            M+FAG LNDAD+AAAL AC AADSFNHKAFFAKVGL++KS DDVKKAF +IDQDKSGFIE
Sbjct  1    MSFAG-LNDADVAAALAACTAADSFNHKAFFAKVGLASKSSDDVKKAFYVIDQDKSGFIE 59
Query  61   EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVK 108
            EDELKLFLQNF A ARALTDAETK FL  GD DGDG IGVDEFAA++K
Sbjct  60   EDELKLFLQNFSASARALTDAETKAFLADGDKDGDGMIGVDEFAAMIK 107

Sequence Alignment: 11. Allergen Name: Sal s 1 Sequence ID: Q91483

 Score = 81.8 bits 565,  Expect = 5e-18
 Identities = 88/106 83%, Positives = 95/106 89%, Gaps = 1/106 0%
Query  2    AFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIEE 61
            +FAG LNDAD+AAAL AC AADSFNHKAFFAKVGL++KS DDVKKAF +IDQDKSGFIEE
Sbjct  1    SFAG-LNDADVAAALAACTAADSFNHKAFFAKVGLASKSSDDVKKAFYVIDQDKSGFIEE 59
Query  62   DELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVK 108
            DELKLFLQNF A ARALTDAETK FL  GD DGDG IGVDEFAA++K
Sbjct  60   DELKLFLQNFSASARALTDAETKAFLADGDKDGDGMIGVDEFAAMIK 106

Sequence Alignment: 12. Allergen Name: Gad m 1.0101 Sequence ID: AAK63086

 Score = 81.8 bits 565,  Expect = 5e-18
 Identities = 89/109 81%, Positives = 98/109 89%, Gaps = 0/109 0%
Query  1    MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE 60
            MAFAGIL DAD AAA++AC+AA+SF++KAFFAK GLS KS DD+KKAF +IDQDKSGFIE
Sbjct  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
Query  61   EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVKA 109
            EDELKLFLQ FKA ARALTDAETK FLKAGDSDGDG IGVDE+A LVKA
Sbjct  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVKA 109

Sequence Alignment: 13. Allergen Name: Xip g 1.0101 Sequence ID: FM202668

 Score = 81.7 bits 564,  Expect = 5e-18
 Identities = 88/109 80%, Positives = 97/109 88%, Gaps = 0/109 0%
Query  1    MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE 60
            MAFAG+L+DAD+AAALEACK A +F++K FF   GL+AKS DDVKKAFAIIDQDKSGFIE
Sbjct  1    MAFAGVLSDADVAAALEACKDAGTFDYKKFFKSCGLAAKSTDDVKKAFAIIDQDKSGFIE 60
Query  61   EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVKA 109
            EDELKLFLQNFKA AR LTDAET+ FLKAGDSDGDGKIG +EFAALV A
Sbjct  61   EDELKLFLQNFKAAARPLTDAETEAFLKAGDSDGDGKIGAEEFAALVTA 109

Sequence Alignment: 14. Allergen Name: Clu h 1.0201 Sequence ID: CAQ72971

 Score = 81.4 bits 562,  Expect = 6e-18
 Identities = 87/109 79%, Positives = 96/109 88%, Gaps = 0/109 0%
Query  1    MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE 60
            MAFAG+L+DADIAAAL AC AAD+F+HK+FF KVGLS KS DDVKK F IIDQDKSGFIE
Sbjct  1    MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE 60
Query  61   EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVKA 109
            E+ELKLFLQNFKA ARAL+D ETK FL AGD+DGDG IGVDEFA +VKA
Sbjct  61   EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVKA 109

Sequence Alignment: 15. Allergen Name: Gad m 1.0102 Sequence ID: CAM56785

 Score = 81.1 bits 559,  Expect = 8e-18
 Identities = 88/109 80%, Positives = 98/109 89%, Gaps = 0/109 0%
Query  1    MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE 60
            MAFAGIL DAD AAA++AC+AA+SF++KAFFAK GLS KS DD+KKAF +IDQDKSGFIE
Sbjct  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
Query  61   EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVKA 109
            EDELKLFLQ FKA ARALTDAETK FLKAGDSDGDG IGV+E+A LVKA
Sbjct  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVEEWAVLVKA 109

Sequence Alignment: 16. Allergen Name: The c 1 Sequence ID: Q90YK7

 Score = 80.9 bits 558,  Expect = 8e-18
 Identities = 86/109 78%, Positives = 95/109 87%, Gaps = 0/109 0%
Query  1    MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE 60
            MAFAGIL DA++AAALEACK+A SF+H  FF   GL+ KS DDVKKAF IIDQD+S FIE
Sbjct  1    MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE 60
Query  61   EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVKA 109
            E+ELKLFLQNF A ARAL+DAETK FLKAGDSDGDGKIGVDEFAA+VKA
Sbjct  61   EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVKA 109

Sequence Alignment: 17. Allergen Name: Sco j 1 Sequence ID: P59747

 Score = 80.8 bits 557,  Expect = 9e-18
 Identities = 84/108 77%, Positives = 95/108 87%, Gaps = 0/108 0%
Query  1    MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE 60
            MAFA +L DA++ AAL+ CKAA SF+HK FF   GLS KS D+VKKAFAIIDQDKSGFIE
Sbjct  1    MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE 60
Query  61   EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVK 108
            E+ELKLFLQNFKA ARAL+DAETK FLKAGDSDGDGKIG+DEFAA++K
Sbjct  61   EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIK 108

Sequence Alignment: 18. Allergen Name: Ras k 1.0101 Sequence ID: A0A1B1V0G7

 Score = 80.7 bits 556,  Expect = 1e-17
 Identities = 84/108 77%, Positives = 94/108 87%, Gaps = 0/108 0%
Query  1    MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE 60
            MAFA +L DA+I AAL+ CKA  SF+HK FF   GL+ KSGDDVKKAFAIIDQDKSGFIE
Sbjct  1    MAFASVLKDAEITAALDGCKADGSFDHKKFFKACGLAGKSGDDVKKAFAIIDQDKSGFIE 60
Query  61   EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVK 108
            E+ELKLFLQNFKA AR L+DAETK FLKAGD+DGDGKIGVDEFAA++K
Sbjct  61   EEELKLFLQNFKAGARTLSDAETKAFLKAGDTDGDGKIGVDEFAAMIK 108

Sequence Alignment: 19. Allergen Name: Clu h 1.0301 Sequence ID: CAQ72972

 Score = 79.6 bits 547,  Expect = 2e-17
 Identities = 85/107 79%, Positives = 92/107 85%, Gaps = 0/107 0%
Query  1    MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE 60
            MAFA  L +ADI AAL ACK ADSF+HKAFFAKVGL  KSGD++KKAF IIDQDKSGFIE
Sbjct  1    MAFAAFLKEADITAALGACKGADSFDHKAFFAKVGLKGKSGDELKKAFEIIDQDKSGFIE 60
Query  61   EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALV 107
            E+ELKLFLQNF   ARALTD ETK FLKAGDSD DGKIG+DEFAAL+
Sbjct  61   EEELKLFLQNFCKGARALTDGETKKFLKAGDSDNDGKIGIDEFAALI 107

Sequence Alignment: 20. Allergen Name: Lat c 1.0201 Sequence ID: Q6ITU9

 Score = 79.2 bits 544,  Expect = 3e-17
 Identities = 81/108 75%, Positives = 93/108 86%, Gaps = 0/108 0%
Query  1    MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE 60
            MAF+ +L+D+D+AAAL+ CK A +F+HK FF+  GLS K+ DDVKKAFAIIDQDKSGFIE
Sbjct  1    MAFSNVLSDSDVAAALDGCKDAGTFDHKKFFSACGLSNKTSDDVKKAFAIIDQDKSGFIE 60
Query  61   EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVK 108
            E+ELKLFLQNFKADAR LTD ET  FLKAGD+DGDGKIG DEF ALVK
Sbjct  61   EEELKLFLQNFKADARVLTDVETSTFLKAGDTDGDGKIGADEFTALVK 108

Sequence Alignment: 21. Allergen Name: Sar sa 1.0101 Sequence ID: FM177701

 Score = 78.7 bits 540,  Expect = 4e-17
 Identities = 84/108 77%, Positives = 95/108 87%, Gaps = 0/108 0%
Query  1    MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE 60
            MA+AG++ +ADI AALEACKAADSF+HKAFF KVG+S KS D++KKAFAIIDQDKSGFIE
Sbjct  1    MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAIIDQDKSGFIE 60
Query  61   EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVK 108
            E+ELKLFLQNF   ARALTD ETK FLKAGD+ GDGKIG+DEF  LVK
Sbjct  61   EEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGIDEFNHLVK 108

Sequence Alignment: 22. Allergen Name: Clu h 1.0101 Sequence ID: CAQ72970

 Score = 77.7 bits 532,  Expect = 8e-17
 Identities = 82/108 75%, Positives = 93/108 86%, Gaps = 0/108 0%
Query  1    MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE 60
            MA+A +L  ADI AAL+AC+A DSF HK FFAK+GL+ KS  D+KKAF IIDQDKSGFIE
Sbjct  1    MALASLLKGADIDAALKACEAKDSFKHKDFFAKIGLATKSAADLKKAFEIIDQDKSGFIE 60
Query  61   EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVK 108
            E+ELKLFLQNFKA ARALTDAETK FLKAGD+DGDG IGVDEFA ++K
Sbjct  61   EEELKLFLQNFKAGARALTDAETKAFLKAGDADGDGMIGVDEFAVMIK 108

Sequence Alignment: 23. Allergen Name: Seb m 1.0201 Sequence ID: CAQ72969

 Score = 76.7 bits 524,  Expect = 2e-16
 Identities = 84/108 77%, Positives = 91/108 84%, Gaps = 1/108 0%
Query  1    MAFAGI-LNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFI 59
            MAFA + L DADIAAAL+ CK A  FNHK FF   GLS KS D+VKKAFAIIDQD SGFI
Sbjct  1    MAFASVGLKDADIAAALDGCKDAGKFNHKTFFKTCGLSGKSSDEVKKAFAIIDQDISGFI 60
Query  60   EEDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVK 108
            EE+ELKLFLQ FKA ARAL+DAETK FLKAGDSDGDGKIG DE+AA+VK
Sbjct  61   EEEELKLFLQTFKAGARALSDAETKEFLKAGDSDGDGKIGADEWAAMVK 109

Sequence Alignment: 24. Allergen Name: Seb m 1.0101 Sequence ID: CAQ72968

 Score = 76.6 bits 523,  Expect = 2e-16
 Identities = 81/108 75%, Positives = 89/108 82%, Gaps = 0/108 0%
Query  1    MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE 60
            MA+A  LN ADI AAL AC   D+F HK FF KVGLSAKS DD+K AF +IDQDKSGFIE
Sbjct  1    MALAASLNAADITAALAACSGVDTFKHKDFFGKVGLSAKSADDIKNAFKVIDQDKSGFIE 60
Query  61   EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVK 108
            E+ELKLFLQNF A ARALT+AET  FLKAGDSDGDG IG+DEFAA+VK
Sbjct  61   EEELKLFLQNFSATARALTEAETTAFLKAGDSDGDGMIGMDEFAAMVK 108

Sequence Alignment: 25. Allergen Name: Cro p 1.0101 Sequence ID: XP_019397705

 Score = 74.4 bits 505,  Expect = 8e-16
 Identities = 78/109 71%, Positives = 90/109 82%, Gaps = 0/109 0%
Query  1    MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE 60
            MA   IL+  DI AAL +C+AA+SFN+K+FF+ VGL  KS D VKK F I+DQDKSGFIE
Sbjct  1    MAITDILSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIE 60
Query  61   EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVKA 109
            EDEL+LFL+NF + ARALTDAETK FL AGD+DGDGKIGVDEF ALVKA
Sbjct  61   EDELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVKA 109

Sequence Alignment: 26. Allergen Name: Sal s 1 Sequence ID: Q91482

 Score = 71.9 bits 485,  Expect = 4e-15
 Identities = 75/108 69%, Positives = 87/108 80%, Gaps = 0/108 0%
Query  1    MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE 60
            MA A +  +ADI  ALEACKAAD+F+ K FF  +G+++KS DDVKKAF +IDQD SGFIE
Sbjct  1    MACAHLCKEADIKTALEACKAADTFSFKTFFHTIGFASKSADDVKKAFKVIDQDASGFIE 60
Query  61   EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVK 108
             +ELKLFLQNF   AR LTDAETK FLKAGD+DGDG IG+DEFA LVK
Sbjct  61   VEELKLFLQNFCPKARELTDAETKAFLKAGDADGDGMIGIDEFAVLVK 108

Sequence Alignment: 27. Allergen Name: Onc m 1.0201 Sequence ID: P86432

 Score = 71.7 bits 483,  Expect = 5e-15
 Identities = 77/106 72%, Positives = 85/106 80%, Gaps = 1/106 0%
Query  2    AFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIEE 61
            +FAG LNDAD+AAAL AC AADSFNHKAFFAK      S DD+KK    +DQDKSGF+EE
Sbjct  1    SFAG-LNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEE 59
Query  62   DELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVK 108
            DELKLFLQNF A ARALTDAETK    AGD+DGDG +G+DEFA LVK
Sbjct  60   DELKLFLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVK 106

Sequence Alignment: 28. Allergen Name: Ran e 2 Sequence ID: CAC95152

 Score = 71.1 bits 478,  Expect = 8e-15
 Identities = 75/109 68%, Positives = 88/109 80%, Gaps = 0/109 0%
Query  1    MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE 60
            M+   I+++ DI AALE+ KAA SFN+K FF KVGL+ KS  D KK F I+D+DKSGFIE
Sbjct  1    MSITDIVSEKDIDAALESVKAAGSFNYKIFFQKVGLAGKSAADAKKVFEILDRDKSGFIE 60
Query  61   EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVKA 109
            +DEL LFLQNF+A AR L+DAET  FLKAGDSDGDGKIGV+EF ALVKA
Sbjct  61   QDELGLFLQNFRASARVLSDAETSAFLKAGDSDGDGKIGVEEFQALVKA 109

Sequence Alignment: 29. Allergen Name: Gad c 1 Sequence ID: P02622

 Score = 69.1 bits 462,  Expect = 3e-14
 Identities = 75/106 70%, Positives = 82/106 77%, Gaps = 0/106 0%
Query  2    AFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIEE 61
            AF GIL++ADI AA  AC    SF+   F+AKVGL A S D++KK F I D+DK GFIEE
Sbjct  1    AFKGILSNADIKAAEAACFKEGSFDEDGFYAKVGLDAFSADELKKLFKIADEDKEGFIEE 60
Query  62   DELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALV 107
            DELKLFL  F AD RALTDAETK FLKAGDSDGDGKIGVDEF ALV
Sbjct  61   DELKLFLIAFAADLRALTDAETKAFLKAGDSDGDGKIGVDEFGALV 106

Sequence Alignment: 30. Allergen Name: Lep w 1.0101 Sequence ID: AM904681

 Score = 69.0 bits 461,  Expect = 3e-14
 Identities = 73/108 67%, Positives = 86/108 79%, Gaps = 1/108 0%
Query  1    MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE 60
            M FAG L+ A+I AAL+ C AADSF++K FF   GL+ KS ++VK AF  IDQD+SGFIE
Sbjct  1    MTFAG-LDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIE 59
Query  61   EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVKA 109
            EDELKLFLQNF A ARALTD ET  FLKAGD DGDGKIG++EF  LV++
Sbjct  60   EDELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVRS 108

Sequence Alignment: 31. Allergen Name: Onc m 1.0101 Sequence ID: P86431

 Score = 65.2 bits 431,  Expect = 4e-13
 Identities = 67/107 62%, Positives = 81/107 75%, Gaps = 0/107 0%
Query  2    AFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIEE 61
            A A +  +AD+  ALEACKAADSFN K FF  +G+++K  DDVKK   ++DQD SGF+E 
Sbjct  1    ACAHLCKEADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEV 60
Query  62   DELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVK 108
            +ELKLFLQNF      LTDAETK FLKAGD+DGDG +G+DEFA LVK
Sbjct  61   EELKLFLQNFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVK 107

Sequence Alignment: 32. Allergen Name: Cro p 2.0101 Sequence ID: XP_019400389

 Score = 63.4 bits 416,  Expect = 2e-12
 Identities = 67/107 62%, Positives = 78/107 72%, Gaps = 0/107 0%
Query  1    MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE 60
            MA   +L+  DI  A+ A  AA+SFNHK FF  VGL  KS DDVKK F I+D+D+SGFIE
Sbjct  1    MAMTDLLSADDIKKAVGAFAAAESFNHKKFFEMVGLKKKSQDDVKKVFHILDKDRSGFIE 60
Query  61   EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALV 107
            EDELK  L+ F  DAR L+D ETK +L AGD DGDGKIGVDEF +LV
Sbjct  61   EDELKSVLKGFTPDARDLSDKETKELLAAGDKDGDGKIGVDEFTSLV 107

Sequence Alignment: 33. Allergen Name: Pan h 1.0201 Sequence ID: XP_026803769

 Score = 61.5 bits 401,  Expect = 6e-12
 Identities = 62/107 57%, Positives = 75/107 70%, Gaps = 0/107 0%
Query  1    MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE 60
            MA   +L   DI  AL+  K AD+F+HK FF  VGL A S ++VKK F+++D D SGFIE
Sbjct  1    MAMQDLLKADDIKKALDTFKVADTFDHKKFFELVGLKAMSAENVKKVFSVLDVDASGFIE 60
Query  61   EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALV 107
            EDELK+ L+ F  D R LTD ETK FL A D DGDGKIG+DEF A+V
Sbjct  61   EDELKFVLKGFSKDGRDLTDKETKAFLTAADRDGDGKIGIDEFEAIV 107

Sequence Alignment: 34. Allergen Name: Gal d 8.0101 Sequence ID: C1L370

 Score = 61.3 bits 399,  Expect = 7e-12
 Identities = 62/107 57%, Positives = 77/107 71%, Gaps = 0/107 0%
Query  1    MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE 60
            MA   +L+  DI  A+ A  AA+SFN+K FF  VGL  KS +DVKK F I+D+D+SGFIE
Sbjct  1    MAMTDVLSAEDIKKAVGAFSAAESFNYKKFFEMVGLKKKSPEDVKKVFHILDKDRSGFIE 60
Query  61   EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALV 107
            E+ELK+ L+ F  D R L+D ETK +L AGD DGDGKIG DEFA +V
Sbjct  61   EEELKFVLKGFTPDGRDLSDKETKALLAAGDKDGDGKIGADEFATMV 107

Sequence Alignment: 35. Allergen Name: Ran e 1 Sequence ID: CAC83046

 Score = 56.0 bits 356,  Expect = 3e-10
 Identities = 55/107 51%, Positives = 73/107 68%, Gaps = 0/107 0%
Query  1    MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE 60
            M    +L   DI+ A+ A  A +SFNHK FF   GL +KS + ++K F ++DQD+SGFIE
Sbjct  1    MPMTDLLAAGDISKAVSAFAAPESFNHKKFFELCGLKSKSKEIMQKVFHVLDQDQSGFIE 60
Query  61   EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALV 107
            ++EL L L+ F  + R+L+D ET  +L AGD DGDGKIGVDEF  LV
Sbjct  61   KEELCLILKGFTPEGRSLSDKETTALLAAGDKDGDGKIGVDEFVTLV 107

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.