The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIE
EDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVKV
Sequence Info Allergen Name Length Opt Bits Score E Value
Q5IRB2 Lat c 1.0101 109 687 104.2 8.5e-25
CAQ72967 Thu a 1.0101 109 614 94.3 8e-22
CAC83658 Cyp c 1.01 109 602 92.7 2.5e-21
QCY53440 Cten i 1.0101 109 599 92.3 3.3e-21
CAC83659 Cyp c 1.02 109 595 91.7 4.7e-21
XP_026772003 Pan h 1.0101 109 565 87.7 7.9e-20
CAA66404 Sal s 1 108 562 87.3 1e-19
CAM56786 Gad m 1.0202 109 562 87.3 1e-19
AAK63087 Gad m 1.0201 109 561 87.1 1.2e-19
Q90YK9 Gad m 1.0201 109 561 87.1 1.2e-19
Q91483 Sal s 1 107 555 86.3 2e-19
Q90YK7 The c 1 109 547 85.2 4.3e-19
CAQ72968 Seb m 1.0101 109 545 85.0 5.2e-19
CAQ72972 Clu h 1.0301 109 544 84.8 5.7e-19
P59747 Sco j 1 109 542 84.5 6.8e-19
A0A1B1V0G7 Ras k 1.0101 109 539 84.1 9.1e-19
CAQ72971 Clu h 1.0201 110 539 84.1 9.1e-19
CAQ72970 Clu h 1.0101 109 535 83.6 1.3e-18
FM177701 Sar sa 1.0101 109 534 83.5 1.4e-18
AAK63086 Gad m 1.0101 109 533 83.3 1.6e-18
FM202668 Xip g 1.0101 109 529 82.8 2.3e-18
CAM56785 Gad m 1.0102 109 527 82.5 2.8e-18
XP_019397705 Cro p 1.0101 109 511 80.4 1.3e-17
CAQ72969 Seb m 1.0201 110 503 79.3 2.7e-17
Q6ITU9 Lat c 1.0201 109 501 79.0 3.2e-17
Q91482 Sal s 1 109 479 76.0 2.5e-16
P86432 Onc m 1.0201 107 469 74.7 6.3e-16
CAC95152 Ran e 2 109 465 74.1 9.3e-16
AM904681 Lep w 1.0101 109 464 74.0 1e-15
P02622 Gad c 1 113 441 70.9 9.1e-15
P86431 Onc m 1.0101 108 422 68.3 5.2e-14
XP_019400389 Cro p 2.0101 110 415 67.4 1e-13
C1L370 Gal d 8.0101 110 387 63.6 1.4e-12
XP_026803769 Pan h 1.0201 109 379 62.5 3e-12
CAC83046 Ran e 1 110 351 58.7 4.1e-11
ABP87672 Cup a 4.0101 177 153 32.2 0.0065
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Lat c 1.0101 Sequence ID: Q5IRB2

 Score = 104.2 bits 687,  Expect = 8e-25
 Identities = 109/109 100%, Positives = 109/109 100%, Gaps = 0/109 0%
Query  1    MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIE 60
            MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIE
Sbjct  1    MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIE 60
Query  61   EDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVKV 109
            EDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVKV
Sbjct  61   EDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVKV 109

Sequence Alignment: 2. Allergen Name: Thu a 1.0101 Sequence ID: CAQ72967

 Score = 94.3 bits 614,  Expect = 8e-22
 Identities = 96/108 88%, Positives = 101/108 93%, Gaps = 0/108 0%
Query  1    MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIE 60
            MAFAGIL EADITAALAACQAADSFK+KDFF KVGLA K+ +D+KKAFAVIDQDKSGFIE
Sbjct  1    MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIE 60
Query  61   EDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVK 108
            EDELKLFLQNFSA ARALTDAETK FL AGDSDGDGKIG+DEFAALVK
Sbjct  61   EDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVK 108

Sequence Alignment: 3. Allergen Name: Cyp c 1.01 Sequence ID: CAC83658

 Score = 92.7 bits 602,  Expect = 2e-21
 Identities = 94/108 87%, Positives = 99/108 91%, Gaps = 0/108 0%
Query  1    MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIE 60
            MAFAGILN+ADITAAL  CQAADSF +K FF KVGL+ K+ DD+KKAFAVIDQDKSGFIE
Sbjct  1    MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIE 60
Query  61   EDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVK 108
            EDELKLFLQNFSA ARALTDAETK FLKAGDSDGDGKIGVDEFAALVK
Sbjct  61   EDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVK 108

Sequence Alignment: 4. Allergen Name: Cten i 1.0101 Sequence ID: QCY53440

 Score = 92.3 bits 599,  Expect = 3e-21
 Identities = 94/108 87%, Positives = 98/108 90%, Gaps = 0/108 0%
Query  1    MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIE 60
            MAFAGILN+ADI AAL AC+AADSF HK FF KVGL+ KS DDVKKAFA+IDQDKSGFIE
Sbjct  1    MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE 60
Query  61   EDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVK 108
            EDELKLFLQNF A ARALTDAETK FLKAGDSDGDGKIGVDEFAALVK
Sbjct  61   EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVK 108

Sequence Alignment: 5. Allergen Name: Cyp c 1.02 Sequence ID: CAC83659

 Score = 91.7 bits 595,  Expect = 5e-21
 Identities = 92/108 85%, Positives = 96/108 88%, Gaps = 0/108 0%
Query  1    MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIE 60
            MAFAG+LN+ADITAAL AC+AADSF HK FF KVGL  KS DDVKKAFA+IDQDKSGFIE
Sbjct  1    MAFAGVLNDADITAALEACKAADSFNHKTFFAKVGLTSKSADDVKKAFAIIDQDKSGFIE 60
Query  61   EDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVK 108
            EDELKLFLQNF A ARALTD ETK FLKAGDSDGDGKIGVDEF ALVK
Sbjct  61   EDELKLFLQNFKAGARALTDGETKTFLKAGDSDGDGKIGVDEFTALVK 108

Sequence Alignment: 6. Allergen Name: Pan h 1.0101 Sequence ID: XP_026772003

 Score = 87.7 bits 565,  Expect = 8e-20
 Identities = 87/108 80%, Positives = 95/108 87%, Gaps = 0/108 0%
Query  1    MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIE 60
            MAFAG+LN+ADI AAL AC+A  SF HK FF KVGL GKS DDVKKAF++IDQDKSGFIE
Sbjct  1    MAFAGVLNDADIAAALDACKADGSFDHKAFFTKVGLTGKSADDVKKAFSIIDQDKSGFIE 60
Query  61   EDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVK 108
            EDELKLFLQNF + ARALTD ETK FLKAGD+DGDGKIGVDEFA+LVK
Sbjct  61   EDELKLFLQNFKSDARALTDNETKIFLKAGDTDGDGKIGVDEFASLVK 108

Sequence Alignment: 7. Allergen Name: Sal s 1 Sequence ID: CAA66404

 Score = 87.3 bits 562,  Expect = 1e-19
 Identities = 89/107 83%, Positives = 94/107 87%, Gaps = 1/107 0%
Query  1    MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIE 60
            M+FAG LN+AD+ AALAAC AADSF HK FF KVGLA KS DDVKKAF VIDQDKSGFIE
Sbjct  1    MSFAG-LNDADVAAALAACTAADSFNHKAFFAKVGLASKSSDDVKKAFYVIDQDKSGFIE 59
Query  61   EDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVK 108
            EDELKLFLQNFSASARALTDAETK FL  GD DGDG IGVDEFAA++K
Sbjct  60   EDELKLFLQNFSASARALTDAETKAFLADGDKDGDGMIGVDEFAAMIK 107

Sequence Alignment: 8. Allergen Name: Gad m 1.0202 Sequence ID: CAM56786

 Score = 87.3 bits 562,  Expect = 1e-19
 Identities = 86/108 79%, Positives = 94/108 87%, Gaps = 0/108 0%
Query  1    MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIE 60
            MAFAGILN+ADITAALAAC+A  SF HK FF KVGLA KS  D+KK F +IDQDKS F+E
Sbjct  1    MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSSADIKKVFEIIDQDKSDFVE 60
Query  61   EDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVK 108
            EDELKLFLQNFSA ARAL+DAETK FLKAGDSDGDGKIGVDEF A++K
Sbjct  61   EDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIK 108

Sequence Alignment: 9. Allergen Name: Gad m 1.0201 Sequence ID: AAK63087

 Score = 87.1 bits 561,  Expect = 1e-19
 Identities = 86/108 79%, Positives = 94/108 87%, Gaps = 0/108 0%
Query  1    MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIE 60
            MAFAGILN+ADITAALAAC+A  SF HK FF KVGLA KS  D+KK F +IDQDKS F+E
Sbjct  1    MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSPADIKKVFEIIDQDKSDFVE 60
Query  61   EDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVK 108
            EDELKLFLQNFSA ARAL+DAETK FLKAGDSDGDGKIGVDEF A++K
Sbjct  61   EDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIK 108

Sequence Alignment: 10. Allergen Name: Gad m 1.0201 Sequence ID: Q90YK9

 Score = 87.1 bits 561,  Expect = 1e-19
 Identities = 86/108 79%, Positives = 94/108 87%, Gaps = 0/108 0%
Query  1    MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIE 60
            MAFAGILN+ADITAALAAC+A  SF HK FF KVGLA KS  D+KK F +IDQDKS F+E
Sbjct  1    MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSPADIKKVFEIIDQDKSDFVE 60
Query  61   EDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVK 108
            EDELKLFLQNFSA ARAL+DAETK FLKAGDSDGDGKIGVDEF A++K
Sbjct  61   EDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIK 108

Sequence Alignment: 11. Allergen Name: Sal s 1 Sequence ID: Q91483

 Score = 86.3 bits 555,  Expect = 2e-19
 Identities = 88/106 83%, Positives = 93/106 87%, Gaps = 1/106 0%
Query  2    AFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIEE 61
            +FAG LN+AD+ AALAAC AADSF HK FF KVGLA KS DDVKKAF VIDQDKSGFIEE
Sbjct  1    SFAG-LNDADVAAALAACTAADSFNHKAFFAKVGLASKSSDDVKKAFYVIDQDKSGFIEE 59
Query  62   DELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVK 108
            DELKLFLQNFSASARALTDAETK FL  GD DGDG IGVDEFAA++K
Sbjct  60   DELKLFLQNFSASARALTDAETKAFLADGDKDGDGMIGVDEFAAMIK 106

Sequence Alignment: 12. Allergen Name: The c 1 Sequence ID: Q90YK7

 Score = 85.2 bits 547,  Expect = 4e-19
 Identities = 84/108 77%, Positives = 94/108 87%, Gaps = 0/108 0%
Query  1    MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIE 60
            MAFAGIL +A++ AAL AC++A SF H  FF   GLAGKS DDVKKAF +IDQD+S FIE
Sbjct  1    MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE 60
Query  61   EDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVK 108
            E+ELKLFLQNFSASARAL+DAETK FLKAGDSDGDGKIGVDEFAA+VK
Sbjct  61   EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVK 108

Sequence Alignment: 13. Allergen Name: Seb m 1.0101 Sequence ID: CAQ72968

 Score = 85.0 bits 545,  Expect = 5e-19
 Identities = 85/108 78%, Positives = 94/108 87%, Gaps = 0/108 0%
Query  1    MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIE 60
            MA+A  LN ADITAALAAC   D+FKHKDFF KVGL+ KS DD+K AF VIDQDKSGFIE
Sbjct  1    MALAASLNAADITAALAACSGVDTFKHKDFFGKVGLSAKSADDIKNAFKVIDQDKSGFIE 60
Query  61   EDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVK 108
            E+ELKLFLQNFSA+ARALT+AET  FLKAGDSDGDG IG+DEFAA+VK
Sbjct  61   EEELKLFLQNFSATARALTEAETTAFLKAGDSDGDGMIGMDEFAAMVK 108

Sequence Alignment: 14. Allergen Name: Clu h 1.0301 Sequence ID: CAQ72972

 Score = 84.8 bits 544,  Expect = 6e-19
 Identities = 83/107 77%, Positives = 91/107 85%, Gaps = 0/107 0%
Query  1    MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIE 60
            MAFA  L EADITAAL AC+ ADSF HK FF KVGL GKS D++KKAF +IDQDKSGFIE
Sbjct  1    MAFAAFLKEADITAALGACKGADSFDHKAFFAKVGLKGKSGDELKKAFEIIDQDKSGFIE 60
Query  61   EDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALV 107
            E+ELKLFLQNF   ARALTD ETK+FLKAGDSD DGKIG+DEFAAL+
Sbjct  61   EEELKLFLQNFCKGARALTDGETKKFLKAGDSDNDGKIGIDEFAALI 107

Sequence Alignment: 15. Allergen Name: Sco j 1 Sequence ID: P59747

 Score = 84.5 bits 542,  Expect = 7e-19
 Identities = 81/108 75%, Positives = 94/108 87%, Gaps = 0/108 0%
Query  1    MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIE 60
            MAFA +L +A++TAAL  C+AA SF HK FF   GL+GKS D+VKKAFA+IDQDKSGFIE
Sbjct  1    MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE 60
Query  61   EDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVK 108
            E+ELKLFLQNF A ARAL+DAETK FLKAGDSDGDGKIG+DEFAA++K
Sbjct  61   EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIK 108

Sequence Alignment: 16. Allergen Name: Ras k 1.0101 Sequence ID: A0A1B1V0G7

 Score = 84.1 bits 539,  Expect = 9e-19
 Identities = 82/108 75%, Positives = 92/108 85%, Gaps = 0/108 0%
Query  1    MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIE 60
            MAFA +L +A+ITAAL  C+A  SF HK FF   GLAGKS DDVKKAFA+IDQDKSGFIE
Sbjct  1    MAFASVLKDAEITAALDGCKADGSFDHKKFFKACGLAGKSGDDVKKAFAIIDQDKSGFIE 60
Query  61   EDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVK 108
            E+ELKLFLQNF A AR L+DAETK FLKAGD+DGDGKIGVDEFAA++K
Sbjct  61   EEELKLFLQNFKAGARTLSDAETKAFLKAGDTDGDGKIGVDEFAAMIK 108

Sequence Alignment: 17. Allergen Name: Clu h 1.0201 Sequence ID: CAQ72971

 Score = 84.1 bits 539,  Expect = 9e-19
 Identities = 82/108 75%, Positives = 92/108 85%, Gaps = 0/108 0%
Query  1    MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIE 60
            MAFAG+L++ADI AAL AC AAD+F HK FF KVGL+GKS DDVKK F +IDQDKSGFIE
Sbjct  1    MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE 60
Query  61   EDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVK 108
            E+ELKLFLQNF A ARAL+D ETK FL AGD+DGDG IGVDEFA +VK
Sbjct  61   EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVK 108

Sequence Alignment: 18. Allergen Name: Clu h 1.0101 Sequence ID: CAQ72970

 Score = 83.6 bits 535,  Expect = 1e-18
 Identities = 82/108 75%, Positives = 92/108 85%, Gaps = 0/108 0%
Query  1    MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIE 60
            MA+A +L  ADI AAL AC+A DSFKHKDFF K+GLA KS  D+KKAF +IDQDKSGFIE
Sbjct  1    MALASLLKGADIDAALKACEAKDSFKHKDFFAKIGLATKSAADLKKAFEIIDQDKSGFIE 60
Query  61   EDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVK 108
            E+ELKLFLQNF A ARALTDAETK FLKAGD+DGDG IGVDEFA ++K
Sbjct  61   EEELKLFLQNFKAGARALTDAETKAFLKAGDADGDGMIGVDEFAVMIK 108

Sequence Alignment: 19. Allergen Name: Sar sa 1.0101 Sequence ID: FM177701

 Score = 83.5 bits 534,  Expect = 1e-18
 Identities = 82/108 75%, Positives = 95/108 87%, Gaps = 0/108 0%
Query  1    MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIE 60
            MA+AG++ EADITAAL AC+AADSF HK FF KVG++GKS D++KKAFA+IDQDKSGFIE
Sbjct  1    MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAIIDQDKSGFIE 60
Query  61   EDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVK 108
            E+ELKLFLQNF   ARALTD ETK+FLKAGD+ GDGKIG+DEF  LVK
Sbjct  61   EEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGIDEFNHLVK 108

Sequence Alignment: 20. Allergen Name: Gad m 1.0101 Sequence ID: AAK63086

 Score = 83.3 bits 533,  Expect = 2e-18
 Identities = 84/108 77%, Positives = 92/108 85%, Gaps = 0/108 0%
Query  1    MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIE 60
            MAFAGIL +AD  AA+ AC+AA+SF +K FF K GL+GKS DD+KKAF VIDQDKSGFIE
Sbjct  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
Query  61   EDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVK 108
            EDELKLFLQ F A ARALTDAETK FLKAGDSDGDG IGVDE+A LVK
Sbjct  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVK 108

Sequence Alignment: 21. Allergen Name: Xip g 1.0101 Sequence ID: FM202668

 Score = 82.8 bits 529,  Expect = 2e-18
 Identities = 81/107 75%, Positives = 92/107 85%, Gaps = 0/107 0%
Query  1    MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIE 60
            MAFAG+L++AD+ AAL AC+ A +F +K FF   GLA KS DDVKKAFA+IDQDKSGFIE
Sbjct  1    MAFAGVLSDADVAAALEACKDAGTFDYKKFFKSCGLAAKSTDDVKKAFAIIDQDKSGFIE 60
Query  61   EDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALV 107
            EDELKLFLQNF A+AR LTDAET+ FLKAGDSDGDGKIG +EFAALV
Sbjct  61   EDELKLFLQNFKAAARPLTDAETEAFLKAGDSDGDGKIGAEEFAALV 107

Sequence Alignment: 22. Allergen Name: Gad m 1.0102 Sequence ID: CAM56785

 Score = 82.5 bits 527,  Expect = 3e-18
 Identities = 83/108 76%, Positives = 92/108 85%, Gaps = 0/108 0%
Query  1    MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIE 60
            MAFAGIL +AD  AA+ AC+AA+SF +K FF K GL+GKS DD+KKAF VIDQDKSGFIE
Sbjct  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
Query  61   EDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVK 108
            EDELKLFLQ F A ARALTDAETK FLKAGDSDGDG IGV+E+A LVK
Sbjct  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVEEWAVLVK 108

Sequence Alignment: 23. Allergen Name: Cro p 1.0101 Sequence ID: XP_019397705

 Score = 80.4 bits 511,  Expect = 1e-17
 Identities = 79/108 73%, Positives = 90/108 83%, Gaps = 0/108 0%
Query  1    MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIE 60
            MA   IL+  DI AAL++CQAA+SF +K FF  VGL GKS D VKK F ++DQDKSGFIE
Sbjct  1    MAITDILSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIE 60
Query  61   EDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVK 108
            EDEL+LFL+NFS+SARALTDAETK FL AGD+DGDGKIGVDEF ALVK
Sbjct  61   EDELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVK 108

Sequence Alignment: 24. Allergen Name: Seb m 1.0201 Sequence ID: CAQ72969

 Score = 79.3 bits 503,  Expect = 3e-17
 Identities = 79/108 73%, Positives = 89/108 82%, Gaps = 1/108 0%
Query  1    MAFAGI-LNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFI 59
            MAFA + L +ADI AAL  C+ A  F HK FF   GL+GKS D+VKKAFA+IDQD SGFI
Sbjct  1    MAFASVGLKDADIAAALDGCKDAGKFNHKTFFKTCGLSGKSSDEVKKAFAIIDQDISGFI 60
Query  60   EEDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVK 108
            EE+ELKLFLQ F A ARAL+DAETKEFLKAGDSDGDGKIG DE+AA+VK
Sbjct  61   EEEELKLFLQTFKAGARALSDAETKEFLKAGDSDGDGKIGADEWAAMVK 109

Sequence Alignment: 25. Allergen Name: Lat c 1.0201 Sequence ID: Q6ITU9

 Score = 79.0 bits 501,  Expect = 3e-17
 Identities = 74/108 68%, Positives = 87/108 80%, Gaps = 0/108 0%
Query  1    MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIE 60
            MAF+ +L+++D+ AAL  C+ A +F HK FF   GL+ K+ DDVKKAFA+IDQDKSGFIE
Sbjct  1    MAFSNVLSDSDVAAALDGCKDAGTFDHKKFFSACGLSNKTSDDVKKAFAIIDQDKSGFIE 60
Query  61   EDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVK 108
            E+ELKLFLQNF A AR LTD ET  FLKAGD+DGDGKIG DEF ALVK
Sbjct  61   EEELKLFLQNFKADARVLTDVETSTFLKAGDTDGDGKIGADEFTALVK 108

Sequence Alignment: 26. Allergen Name: Sal s 1 Sequence ID: Q91482

 Score = 76.0 bits 479,  Expect = 3e-16
 Identities = 76/108 70%, Positives = 84/108 77%, Gaps = 0/108 0%
Query  1    MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIE 60
            MA A +  EADI  AL AC+AAD+F  K FF  +G+A KS DDVKKAF VIDQD SGFIE
Sbjct  1    MACAHLCKEADIKTALEACKAADTFSFKTFFHTIGFASKSADDVKKAFKVIDQDASGFIE 60
Query  61   EDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVK 108
             +ELKLFLQNF   AR LTDAETK FLKAGD+DGDG IG+DEFA LVK
Sbjct  61   VEELKLFLQNFCPKARELTDAETKAFLKAGDADGDGMIGIDEFAVLVK 108

Sequence Alignment: 27. Allergen Name: Onc m 1.0201 Sequence ID: P86432

 Score = 74.7 bits 469,  Expect = 6e-16
 Identities = 75/106 70%, Positives = 84/106 79%, Gaps = 1/106 0%
Query  2    AFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIEE 61
            +FAG LN+AD+ AALAAC AADSF HK FF K      S DD+KK    +DQDKSGF+EE
Sbjct  1    SFAG-LNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEE 59
Query  62   DELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVK 108
            DELKLFLQNFSASARALTDAETK    AGD+DGDG +G+DEFA LVK
Sbjct  60   DELKLFLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVK 106

Sequence Alignment: 28. Allergen Name: Ran e 2 Sequence ID: CAC95152

 Score = 74.1 bits 465,  Expect = 9e-16
 Identities = 74/108 68%, Positives = 86/108 79%, Gaps = 0/108 0%
Query  1    MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIE 60
            M+   I++E DI AAL + +AA SF +K FF KVGLAGKS  D KK F ++D+DKSGFIE
Sbjct  1    MSITDIVSEKDIDAALESVKAAGSFNYKIFFQKVGLAGKSAADAKKVFEILDRDKSGFIE 60
Query  61   EDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVK 108
            +DEL LFLQNF ASAR L+DAET  FLKAGDSDGDGKIGV+EF ALVK
Sbjct  61   QDELGLFLQNFRASARVLSDAETSAFLKAGDSDGDGKIGVEEFQALVK 108

Sequence Alignment: 29. Allergen Name: Lep w 1.0101 Sequence ID: AM904681

 Score = 74.0 bits 464,  Expect = 1e-15
 Identities = 76/107 71%, Positives = 85/107 79%, Gaps = 1/107 0%
Query  1    MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIE 60
            M FAG L+ A+I AAL  C AADSF +K FF   GLA KS ++VK AF  IDQD+SGFIE
Sbjct  1    MTFAG-LDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIE 59
Query  61   EDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVK 108
            EDELKLFLQNFSASARALTD ET  FLKAGD DGDGKIG++EF  LV+
Sbjct  60   EDELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVR 107

Sequence Alignment: 30. Allergen Name: Gad c 1 Sequence ID: P02622

 Score = 70.9 bits 441,  Expect = 9e-15
 Identities = 72/106 67%, Positives = 79/106 74%, Gaps = 0/106 0%
Query  2    AFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIEE 61
            AF GIL+ ADI AA AAC    SF    F+ KVGL   S D++KK F + D+DK GFIEE
Sbjct  1    AFKGILSNADIKAAEAACFKEGSFDEDGFYAKVGLDAFSADELKKLFKIADEDKEGFIEE 60
Query  62   DELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALV 107
            DELKLFL  F+A  RALTDAETK FLKAGDSDGDGKIGVDEF ALV
Sbjct  61   DELKLFLIAFAADLRALTDAETKAFLKAGDSDGDGKIGVDEFGALV 106

Sequence Alignment: 31. Allergen Name: Onc m 1.0101 Sequence ID: P86431

 Score = 68.3 bits 422,  Expect = 5e-14
 Identities = 67/107 62%, Positives = 78/107 72%, Gaps = 0/107 0%
Query  2    AFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIEE 61
            A A +  EAD+  AL AC+AADSF  K FF  +G+A K  DDVKK   V+DQD SGF+E 
Sbjct  1    ACAHLCKEADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEV 60
Query  62   DELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVK 108
            +ELKLFLQNF      LTDAETK FLKAGD+DGDG +G+DEFA LVK
Sbjct  61   EELKLFLQNFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVK 107

Sequence Alignment: 32. Allergen Name: Cro p 2.0101 Sequence ID: XP_019400389

 Score = 67.4 bits 415,  Expect = 1e-13
 Identities = 65/107 60%, Positives = 78/107 72%, Gaps = 0/107 0%
Query  1    MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIE 60
            MA   +L+  DI  A+ A  AA+SF HK FF  VGL  KS DDVKK F ++D+D+SGFIE
Sbjct  1    MAMTDLLSADDIKKAVGAFAAAESFNHKKFFEMVGLKKKSQDDVKKVFHILDKDRSGFIE 60
Query  61   EDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALV 107
            EDELK  L+ F+  AR L+D ETKE+L AGD DGDGKIGVDEF +LV
Sbjct  61   EDELKSVLKGFTPDARDLSDKETKELLAAGDKDGDGKIGVDEFTSLV 107

Sequence Alignment: 33. Allergen Name: Gal d 8.0101 Sequence ID: C1L370

 Score = 63.6 bits 387,  Expect = 1e-12
 Identities = 59/107 55%, Positives = 76/107 71%, Gaps = 0/107 0%
Query  1    MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIE 60
            MA   +L+  DI  A+ A  AA+SF +K FF  VGL  KS +DVKK F ++D+D+SGFIE
Sbjct  1    MAMTDVLSAEDIKKAVGAFSAAESFNYKKFFEMVGLKKKSPEDVKKVFHILDKDRSGFIE 60
Query  61   EDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALV 107
            E+ELK+ L+ F+   R L+D ETK +L AGD DGDGKIG DEFA +V
Sbjct  61   EEELKFVLKGFTPDGRDLSDKETKALLAAGDKDGDGKIGADEFATMV 107

Sequence Alignment: 34. Allergen Name: Pan h 1.0201 Sequence ID: XP_026803769

 Score = 62.5 bits 379,  Expect = 3e-12
 Identities = 61/107 57%, Positives = 72/107 67%, Gaps = 0/107 0%
Query  1    MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIE 60
            MA   +L   DI  AL   + AD+F HK FF  VGL   S ++VKK F+V+D D SGFIE
Sbjct  1    MAMQDLLKADDIKKALDTFKVADTFDHKKFFELVGLKAMSAENVKKVFSVLDVDASGFIE 60
Query  61   EDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALV 107
            EDELK+ L+ FS   R LTD ETK FL A D DGDGKIG+DEF A+V
Sbjct  61   EDELKFVLKGFSKDGRDLTDKETKAFLTAADRDGDGKIGIDEFEAIV 107

Sequence Alignment: 35. Allergen Name: Ran e 1 Sequence ID: CAC83046

 Score = 58.7 bits 351,  Expect = 4e-11
 Identities = 55/107 51%, Positives = 72/107 67%, Gaps = 0/107 0%
Query  1    MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIE 60
            M    +L   DI+ A++A  A +SF HK FF   GL  KS + ++K F V+DQD+SGFIE
Sbjct  1    MPMTDLLAAGDISKAVSAFAAPESFNHKKFFELCGLKSKSKEIMQKVFHVLDQDQSGFIE 60
Query  61   EDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALV 107
            ++EL L L+ F+   R+L+D ET  +L AGD DGDGKIGVDEF  LV
Sbjct  61   KEELCLILKGFTPEGRSLSDKETTALLAAGDKDGDGKIGVDEFVTLV 107

Sequence Alignment: 36. Allergen Name: Cup a 4.0101 Sequence ID: ABP87672

 Score = 32.2 bits 153,  Expect = 0.007
 Identities = 30/98 30%, Positives = 50/98 51%, Gaps = 4/98 4%
Query  7    LNEADITAALAACQA-ADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIEEDELK 65
            ++EA++ A +       D +     FV + + G +  D+K AF V D+D +G I   EL 
Sbjct  70   VDEAEVKAMMEEADTDGDGYVSLQEFVDLNIKGATVKDLKNAFKVFDRDCNGTISPAEL- 128
Query  66   LFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALV 107
               Q + +     T  E+K  +   D +GDG I V+EF  ++
Sbjct  129  --CQTLKSMGEPCTIEESKNIIHNVDKNGDGLISVEEFQTMM 168

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.