The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIE
EDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVKA
Sequence Info Allergen Name Length Opt Bits Score E Value
CAQ72967 Thu a 1.0101 109 683 92.8 2.2e-21
CAC83658 Cyp c 1.01 109 625 85.9 2.6e-19
Q5IRB2 Lat c 1.0101 109 614 84.6 6.5e-19
CAC83659 Cyp c 1.02 109 577 80.2 1.4e-17
QCY53440 Cten i 1.0101 109 576 80.1 1.5e-17
Q90YK9 Gad m 1.0201 109 573 79.8 1.9e-17
AAK63087 Gad m 1.0201 109 573 79.8 1.9e-17
CAM56786 Gad m 1.0202 109 562 78.5 4.6e-17
CAA66404 Sal s 1 108 537 75.5 3.6e-16
XP_026772003 Pan h 1.0101 109 536 75.4 3.9e-16
AAK63086 Gad m 1.0101 109 535 75.3 4.3e-16
CAQ72971 Clu h 1.0201 110 535 75.3 4.3e-16
FM202668 Xip g 1.0101 109 533 75.0 5e-16
CAQ72970 Clu h 1.0101 109 533 75.0 5e-16
Q91483 Sal s 1 107 530 74.7 6.4e-16
CAM56785 Gad m 1.0102 109 529 74.6 7e-16
CAQ72968 Seb m 1.0101 109 525 74.1 9.7e-16
P59747 Sco j 1 109 524 74.0 1.1e-15
A0A1B1V0G7 Ras k 1.0101 109 518 73.3 1.7e-15
Q90YK7 The c 1 109 518 73.3 1.7e-15
CAQ72972 Clu h 1.0301 109 517 73.1 1.9e-15
XP_019397705 Cro p 1.0101 109 510 72.3 3.3e-15
FM177701 Sar sa 1.0101 109 501 71.2 7e-15
Q6ITU9 Lat c 1.0201 109 483 69.1 3.1e-14
Q91482 Sal s 1 109 474 68.0 6.4e-14
CAQ72969 Seb m 1.0201 110 469 67.4 9.7e-14
CAC95152 Ran e 2 109 461 66.5 1.9e-13
AM904681 Lep w 1.0101 109 459 66.3 2.2e-13
P86432 Onc m 1.0201 107 454 65.7 3.3e-13
P02622 Gad c 1 113 434 63.3 1.7e-12
P86431 Onc m 1.0101 108 419 61.5 5.8e-12
C1L370 Gal d 8.0101 110 412 60.7 1e-11
XP_019400389 Cro p 2.0101 110 391 58.2 5.9e-11
XP_026803769 Pan h 1.0201 109 384 57.4 1e-10
CAC83046 Ran e 1 110 352 53.6 1.4e-09
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Thu a 1.0101 Sequence ID: CAQ72967

 Score = 92.8 bits 683,  Expect = 2e-21
 Identities = 109/109 100%, Positives = 109/109 100%, Gaps = 0/109 0%
Query  1    MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIE 60
            MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIE
Sbjct  1    MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVKA 109
            EDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVKA
Sbjct  61   EDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVKA 109

Sequence Alignment: 2. Allergen Name: Cyp c 1.01 Sequence ID: CAC83658

 Score = 85.9 bits 625,  Expect = 3e-19
 Identities = 98/109 89%, Positives = 102/109 93%, Gaps = 0/109 0%
Query  1    MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIE 60
            MAFAGIL +ADITAAL  CQAADSF YK FF KVGL+AKTP+DIKKAFAVIDQDKSGFIE
Sbjct  1    MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVKA 109
            EDELKLFLQNFSAGARALTDAETKAFL AGDSDGDGKIG+DEFAALVKA
Sbjct  61   EDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVKA 109

Sequence Alignment: 3. Allergen Name: Lat c 1.0101 Sequence ID: Q5IRB2

 Score = 84.6 bits 614,  Expect = 6e-19
 Identities = 96/108 88%, Positives = 101/108 93%, Gaps = 0/108 0%
Query  1    MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIE 60
            MAFAGIL EADITAALAACQAADSFK+KDFF KVGLA K+ +D+KKAFAVIDQDKSGFIE
Sbjct  1    MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVK 108
            EDELKLFLQNFSA ARALTDAETK FL AGDSDGDGKIG+DEFAALVK
Sbjct  61   EDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVK 108

Sequence Alignment: 4. Allergen Name: Cyp c 1.02 Sequence ID: CAC83659

 Score = 80.2 bits 577,  Expect = 1e-17
 Identities = 87/109 79%, Positives = 97/109 88%, Gaps = 0/109 0%
Query  1    MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIE 60
            MAFAG+L +ADITAAL AC+AADSF +K FF KVGL +K+ +D+KKAFA+IDQDKSGFIE
Sbjct  1    MAFAGVLNDADITAALEACKAADSFNHKTFFAKVGLTSKSADDVKKAFAIIDQDKSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVKA 109
            EDELKLFLQNF AGARALTD ETK FL AGDSDGDGKIG+DEF ALVKA
Sbjct  61   EDELKLFLQNFKAGARALTDGETKTFLKAGDSDGDGKIGVDEFTALVKA 109

Sequence Alignment: 5. Allergen Name: Cten i 1.0101 Sequence ID: QCY53440

 Score = 80.1 bits 576,  Expect = 1e-17
 Identities = 89/109 81%, Positives = 98/109 89%, Gaps = 0/109 0%
Query  1    MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIE 60
            MAFAGIL +ADI AAL AC+AADSF +K FF KVGL+AK+ +D+KKAFA+IDQDKSGFIE
Sbjct  1    MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVKA 109
            EDELKLFLQNF A ARALTDAETK FL AGDSDGDGKIG+DEFAALVKA
Sbjct  61   EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVKA 109

Sequence Alignment: 6. Allergen Name: Gad m 1.0201 Sequence ID: Q90YK9

 Score = 79.8 bits 573,  Expect = 2e-17
 Identities = 87/109 79%, Positives = 97/109 88%, Gaps = 0/109 0%
Query  1    MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIE 60
            MAFAGIL +ADITAALAAC+A  SF +K FFTKVGLAAK+P DIKK F +IDQDKS F+E
Sbjct  1    MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSPADIKKVFEIIDQDKSDFVE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVKA 109
            EDELKLFLQNFSAGARAL+DAETK FL AGDSDGDGKIG+DEF A++KA
Sbjct  61   EDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA 109

Sequence Alignment: 7. Allergen Name: Gad m 1.0201 Sequence ID: AAK63087

 Score = 79.8 bits 573,  Expect = 2e-17
 Identities = 87/109 79%, Positives = 97/109 88%, Gaps = 0/109 0%
Query  1    MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIE 60
            MAFAGIL +ADITAALAAC+A  SF +K FFTKVGLAAK+P DIKK F +IDQDKS F+E
Sbjct  1    MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSPADIKKVFEIIDQDKSDFVE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVKA 109
            EDELKLFLQNFSAGARAL+DAETK FL AGDSDGDGKIG+DEF A++KA
Sbjct  61   EDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA 109

Sequence Alignment: 8. Allergen Name: Gad m 1.0202 Sequence ID: CAM56786

 Score = 78.5 bits 562,  Expect = 5e-17
 Identities = 86/109 78%, Positives = 96/109 88%, Gaps = 0/109 0%
Query  1    MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIE 60
            MAFAGIL +ADITAALAAC+A  SF +K FFTKVGLAAK+  DIKK F +IDQDKS F+E
Sbjct  1    MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSSADIKKVFEIIDQDKSDFVE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVKA 109
            EDELKLFLQNFSAGARAL+DAETK FL AGDSDGDGKIG+DEF A++KA
Sbjct  61   EDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA 109

Sequence Alignment: 9. Allergen Name: Sal s 1 Sequence ID: CAA66404

 Score = 75.5 bits 537,  Expect = 4e-16
 Identities = 83/107 77%, Positives = 94/107 87%, Gaps = 1/107 0%
Query  1    MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIE 60
            M+FAG L +AD+ AALAAC AADSF +K FF KVGLA+K+ +D+KKAF VIDQDKSGFIE
Sbjct  1    MSFAG-LNDADVAAALAACTAADSFNHKAFFAKVGLASKSSDDVKKAFYVIDQDKSGFIE 59
Query  61   EDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVK 108
            EDELKLFLQNFSA ARALTDAETKAFL  GD DGDG IG+DEFAA++K
Sbjct  60   EDELKLFLQNFSASARALTDAETKAFLADGDKDGDGMIGVDEFAAMIK 107

Sequence Alignment: 10. Allergen Name: Pan h 1.0101 Sequence ID: XP_026772003

 Score = 75.4 bits 536,  Expect = 4e-16
 Identities = 81/109 74%, Positives = 94/109 86%, Gaps = 0/109 0%
Query  1    MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIE 60
            MAFAG+L +ADI AAL AC+A  SF +K FFTKVGL  K+ +D+KKAF++IDQDKSGFIE
Sbjct  1    MAFAGVLNDADIAAALDACKADGSFDHKAFFTKVGLTGKSADDVKKAFSIIDQDKSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVKA 109
            EDELKLFLQNF + ARALTD ETK FL AGD+DGDGKIG+DEFA+LVKA
Sbjct  61   EDELKLFLQNFKSDARALTDNETKIFLKAGDTDGDGKIGVDEFASLVKA 109

Sequence Alignment: 11. Allergen Name: Gad m 1.0101 Sequence ID: AAK63086

 Score = 75.3 bits 535,  Expect = 4e-16
 Identities = 84/109 77%, Positives = 93/109 85%, Gaps = 0/109 0%
Query  1    MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIE 60
            MAFAGIL +AD  AA+ AC+AA+SF YK FF K GL+ K+ +DIKKAF VIDQDKSGFIE
Sbjct  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVKA 109
            EDELKLFLQ F AGARALTDAETKAFL AGDSDGDG IG+DE+A LVKA
Sbjct  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVKA 109

Sequence Alignment: 12. Allergen Name: Clu h 1.0201 Sequence ID: CAQ72971

 Score = 75.3 bits 535,  Expect = 4e-16
 Identities = 79/109 72%, Positives = 94/109 86%, Gaps = 0/109 0%
Query  1    MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIE 60
            MAFAG+L++ADI AAL AC AAD+F +K FF KVGL+ K+ +D+KK F +IDQDKSGFIE
Sbjct  1    MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVKA 109
            E+ELKLFLQNF AGARAL+D ETKAFL AGD+DGDG IG+DEFA +VKA
Sbjct  61   EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVKA 109

Sequence Alignment: 13. Allergen Name: Xip g 1.0101 Sequence ID: FM202668

 Score = 75.0 bits 533,  Expect = 5e-16
 Identities = 81/109 74%, Positives = 93/109 85%, Gaps = 0/109 0%
Query  1    MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIE 60
            MAFAG+L++AD+ AAL AC+ A +F YK FF   GLAAK+ +D+KKAFA+IDQDKSGFIE
Sbjct  1    MAFAGVLSDADVAAALEACKDAGTFDYKKFFKSCGLAAKSTDDVKKAFAIIDQDKSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVKA 109
            EDELKLFLQNF A AR LTDAET+AFL AGDSDGDGKIG +EFAALV A
Sbjct  61   EDELKLFLQNFKAAARPLTDAETEAFLKAGDSDGDGKIGAEEFAALVTA 109

Sequence Alignment: 14. Allergen Name: Clu h 1.0101 Sequence ID: CAQ72970

 Score = 75.0 bits 533,  Expect = 5e-16
 Identities = 80/108 74%, Positives = 93/108 86%, Gaps = 0/108 0%
Query  1    MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIE 60
            MA+A +L  ADI AAL AC+A DSFK+KDFF K+GLA K+  D+KKAF +IDQDKSGFIE
Sbjct  1    MALASLLKGADIDAALKACEAKDSFKHKDFFAKIGLATKSAADLKKAFEIIDQDKSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVK 108
            E+ELKLFLQNF AGARALTDAETKAFL AGD+DGDG IG+DEFA ++K
Sbjct  61   EEELKLFLQNFKAGARALTDAETKAFLKAGDADGDGMIGVDEFAVMIK 108

Sequence Alignment: 15. Allergen Name: Sal s 1 Sequence ID: Q91483

 Score = 74.7 bits 530,  Expect = 6e-16
 Identities = 82/106 77%, Positives = 93/106 87%, Gaps = 1/106 0%
Query  2    AFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIEE 61
            +FAG L +AD+ AALAAC AADSF +K FF KVGLA+K+ +D+KKAF VIDQDKSGFIEE
Sbjct  1    SFAG-LNDADVAAALAACTAADSFNHKAFFAKVGLASKSSDDVKKAFYVIDQDKSGFIEE 59
Query  62   DELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVK 108
            DELKLFLQNFSA ARALTDAETKAFL  GD DGDG IG+DEFAA++K
Sbjct  60   DELKLFLQNFSASARALTDAETKAFLADGDKDGDGMIGVDEFAAMIK 106

Sequence Alignment: 16. Allergen Name: Gad m 1.0102 Sequence ID: CAM56785

 Score = 74.6 bits 529,  Expect = 7e-16
 Identities = 83/109 76%, Positives = 93/109 85%, Gaps = 0/109 0%
Query  1    MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIE 60
            MAFAGIL +AD  AA+ AC+AA+SF YK FF K GL+ K+ +DIKKAF VIDQDKSGFIE
Sbjct  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVKA 109
            EDELKLFLQ F AGARALTDAETKAFL AGDSDGDG IG++E+A LVKA
Sbjct  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVEEWAVLVKA 109

Sequence Alignment: 17. Allergen Name: Seb m 1.0101 Sequence ID: CAQ72968

 Score = 74.1 bits 525,  Expect = 1e-15
 Identities = 83/108 76%, Positives = 93/108 86%, Gaps = 0/108 0%
Query  1    MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIE 60
            MA+A  L  ADITAALAAC   D+FK+KDFF KVGL+AK+ +DIK AF VIDQDKSGFIE
Sbjct  1    MALAASLNAADITAALAACSGVDTFKHKDFFGKVGLSAKSADDIKNAFKVIDQDKSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVK 108
            E+ELKLFLQNFSA ARALT+AET AFL AGDSDGDG IG+DEFAA+VK
Sbjct  61   EEELKLFLQNFSATARALTEAETTAFLKAGDSDGDGMIGMDEFAAMVK 108

Sequence Alignment: 18. Allergen Name: Sco j 1 Sequence ID: P59747

 Score = 74.0 bits 524,  Expect = 1e-15
 Identities = 78/108 72%, Positives = 94/108 87%, Gaps = 0/108 0%
Query  1    MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIE 60
            MAFA +L +A++TAAL  C+AA SF +K FF   GL+ K+ +++KKAFA+IDQDKSGFIE
Sbjct  1    MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVK 108
            E+ELKLFLQNF AGARAL+DAETKAFL AGDSDGDGKIGIDEFAA++K
Sbjct  61   EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIK 108

Sequence Alignment: 19. Allergen Name: Ras k 1.0101 Sequence ID: A0A1B1V0G7

 Score = 73.3 bits 518,  Expect = 2e-15
 Identities = 77/108 71%, Positives = 92/108 85%, Gaps = 0/108 0%
Query  1    MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIE 60
            MAFA +L +A+ITAAL  C+A  SF +K FF   GLA K+ +D+KKAFA+IDQDKSGFIE
Sbjct  1    MAFASVLKDAEITAALDGCKADGSFDHKKFFKACGLAGKSGDDVKKAFAIIDQDKSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVK 108
            E+ELKLFLQNF AGAR L+DAETKAFL AGD+DGDGKIG+DEFAA++K
Sbjct  61   EEELKLFLQNFKAGARTLSDAETKAFLKAGDTDGDGKIGVDEFAAMIK 108

Sequence Alignment: 20. Allergen Name: The c 1 Sequence ID: Q90YK7

 Score = 73.3 bits 518,  Expect = 2e-15
 Identities = 78/109 71%, Positives = 93/109 85%, Gaps = 0/109 0%
Query  1    MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIE 60
            MAFAGIL +A++ AAL AC++A SF +  FF   GLA K+ +D+KKAF +IDQD+S FIE
Sbjct  1    MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVKA 109
            E+ELKLFLQNFSA ARAL+DAETKAFL AGDSDGDGKIG+DEFAA+VKA
Sbjct  61   EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVKA 109

Sequence Alignment: 21. Allergen Name: Clu h 1.0301 Sequence ID: CAQ72972

 Score = 73.1 bits 517,  Expect = 2e-15
 Identities = 80/107 74%, Positives = 89/107 83%, Gaps = 0/107 0%
Query  1    MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIE 60
            MAFA  L EADITAAL AC+ ADSF +K FF KVGL  K+ +++KKAF +IDQDKSGFIE
Sbjct  1    MAFAAFLKEADITAALGACKGADSFDHKAFFAKVGLKGKSGDELKKAFEIIDQDKSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALV 107
            E+ELKLFLQNF  GARALTD ETK FL AGDSD DGKIGIDEFAAL+
Sbjct  61   EEELKLFLQNFCKGARALTDGETKKFLKAGDSDNDGKIGIDEFAALI 107

Sequence Alignment: 22. Allergen Name: Cro p 1.0101 Sequence ID: XP_019397705

 Score = 72.3 bits 510,  Expect = 3e-15
 Identities = 76/109 69%, Positives = 91/109 83%, Gaps = 0/109 0%
Query  1    MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIE 60
            MA   IL+  DI AAL++CQAA+SF YK FF+ VGL  K+ + +KK F ++DQDKSGFIE
Sbjct  1    MAITDILSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVKA 109
            EDEL+LFL+NFS+ ARALTDAETKAFL AGD+DGDGKIG+DEF ALVKA
Sbjct  61   EDELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVKA 109

Sequence Alignment: 23. Allergen Name: Sar sa 1.0101 Sequence ID: FM177701

 Score = 71.2 bits 501,  Expect = 7e-15
 Identities = 78/108 72%, Positives = 92/108 85%, Gaps = 0/108 0%
Query  1    MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIE 60
            MA+AG++ EADITAAL AC+AADSF +K FF KVG++ K+ +++KKAFA+IDQDKSGFIE
Sbjct  1    MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAIIDQDKSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVK 108
            E+ELKLFLQNF   ARALTD ETK FL AGD+ GDGKIGIDEF  LVK
Sbjct  61   EEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGIDEFNHLVK 108

Sequence Alignment: 24. Allergen Name: Lat c 1.0201 Sequence ID: Q6ITU9

 Score = 69.1 bits 483,  Expect = 3e-14
 Identities = 71/108 65%, Positives = 87/108 80%, Gaps = 0/108 0%
Query  1    MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIE 60
            MAF+ +L+++D+ AAL  C+ A +F +K FF+  GL+ KT +D+KKAFA+IDQDKSGFIE
Sbjct  1    MAFSNVLSDSDVAAALDGCKDAGTFDHKKFFSACGLSNKTSDDVKKAFAIIDQDKSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVK 108
            E+ELKLFLQNF A AR LTD ET  FL AGD+DGDGKIG DEF ALVK
Sbjct  61   EEELKLFLQNFKADARVLTDVETSTFLKAGDTDGDGKIGADEFTALVK 108

Sequence Alignment: 25. Allergen Name: Sal s 1 Sequence ID: Q91482

 Score = 68.0 bits 474,  Expect = 6e-14
 Identities = 74/108 68%, Positives = 86/108 79%, Gaps = 0/108 0%
Query  1    MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIE 60
            MA A +  EADI  AL AC+AAD+F +K FF  +G+A+K+ +D+KKAF VIDQD SGFIE
Sbjct  1    MACAHLCKEADIKTALEACKAADTFSFKTFFHTIGFASKSADDVKKAFKVIDQDASGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVK 108
             +ELKLFLQNF   AR LTDAETKAFL AGD+DGDG IGIDEFA LVK
Sbjct  61   VEELKLFLQNFCPKARELTDAETKAFLKAGDADGDGMIGIDEFAVLVK 108

Sequence Alignment: 26. Allergen Name: Seb m 1.0201 Sequence ID: CAQ72969

 Score = 67.4 bits 469,  Expect = 1e-13
 Identities = 73/108 67%, Positives = 87/108 80%, Gaps = 1/108 0%
Query  1    MAFAGI-LTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFI 59
            MAFA + L +ADI AAL  C+ A  F +K FF   GL+ K+ +++KKAFA+IDQD SGFI
Sbjct  1    MAFASVGLKDADIAAALDGCKDAGKFNHKTFFKTCGLSGKSSDEVKKAFAIIDQDISGFI 60
Query  60   EEDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVK 108
            EE+ELKLFLQ F AGARAL+DAETK FL AGDSDGDGKIG DE+AA+VK
Sbjct  61   EEEELKLFLQTFKAGARALSDAETKEFLKAGDSDGDGKIGADEWAAMVK 109

Sequence Alignment: 27. Allergen Name: Ran e 2 Sequence ID: CAC95152

 Score = 66.5 bits 461,  Expect = 2e-13
 Identities = 72/109 66%, Positives = 85/109 77%, Gaps = 0/109 0%
Query  1    MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIE 60
            M+   I++E DI AAL + +AA SF YK FF KVGLA K+  D KK F ++D+DKSGFIE
Sbjct  1    MSITDIVSEKDIDAALESVKAAGSFNYKIFFQKVGLAGKSAADAKKVFEILDRDKSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVKA 109
            +DEL LFLQNF A AR L+DAET AFL AGDSDGDGKIG++EF ALVKA
Sbjct  61   QDELGLFLQNFRASARVLSDAETSAFLKAGDSDGDGKIGVEEFQALVKA 109

Sequence Alignment: 28. Allergen Name: Lep w 1.0101 Sequence ID: AM904681

 Score = 66.3 bits 459,  Expect = 2e-13
 Identities = 75/108 69%, Positives = 83/108 76%, Gaps = 1/108 0%
Query  1    MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIE 60
            M FAG L  A+I AAL  C AADSF YK FF   GLA K+ E++K AF  IDQD+SGFIE
Sbjct  1    MTFAG-LDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIE 59
Query  61   EDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVKA 109
            EDELKLFLQNFSA ARALTD ET  FL AGD DGDGKIGI+EF  LV++
Sbjct  60   EDELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVRS 108

Sequence Alignment: 29. Allergen Name: Onc m 1.0201 Sequence ID: P86432

 Score = 65.7 bits 454,  Expect = 3e-13
 Identities = 71/106 66%, Positives = 83/106 78%, Gaps = 1/106 0%
Query  2    AFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIEE 61
            +FAG L +AD+ AALAAC AADSF +K FF K      +P+D+KK    +DQDKSGF+EE
Sbjct  1    SFAG-LNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEE 59
Query  62   DELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVK 108
            DELKLFLQNFSA ARALTDAETK    AGD+DGDG +G+DEFA LVK
Sbjct  60   DELKLFLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVK 106

Sequence Alignment: 30. Allergen Name: Gad c 1 Sequence ID: P02622

 Score = 63.3 bits 434,  Expect = 2e-12
 Identities = 70/106 66%, Positives = 80/106 75%, Gaps = 0/106 0%
Query  2    AFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIEE 61
            AF GIL+ ADI AA AAC    SF    F+ KVGL A + +++KK F + D+DK GFIEE
Sbjct  1    AFKGILSNADIKAAEAACFKEGSFDEDGFYAKVGLDAFSADELKKLFKIADEDKEGFIEE 60
Query  62   DELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALV 107
            DELKLFL  F+A  RALTDAETKAFL AGDSDGDGKIG+DEF ALV
Sbjct  61   DELKLFLIAFAADLRALTDAETKAFLKAGDSDGDGKIGVDEFGALV 106

Sequence Alignment: 31. Allergen Name: Onc m 1.0101 Sequence ID: P86431

 Score = 61.5 bits 419,  Expect = 6e-12
 Identities = 65/107 60%, Positives = 80/107 74%, Gaps = 0/107 0%
Query  2    AFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIEE 61
            A A +  EAD+  AL AC+AADSF +K FF  +G+A+K  +D+KK   V+DQD SGF+E 
Sbjct  1    ACAHLCKEADLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEV 60
Query  62   DELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVK 108
            +ELKLFLQNF      LTDAETKAFL AGD+DGDG +G+DEFA LVK
Sbjct  61   EELKLFLQNFCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVK 107

Sequence Alignment: 32. Allergen Name: Gal d 8.0101 Sequence ID: C1L370

 Score = 60.7 bits 412,  Expect = 1e-11
 Identities = 61/107 57%, Positives = 78/107 72%, Gaps = 0/107 0%
Query  1    MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIE 60
            MA   +L+  DI  A+ A  AA+SF YK FF  VGL  K+PED+KK F ++D+D+SGFIE
Sbjct  1    MAMTDVLSAEDIKKAVGAFSAAESFNYKKFFEMVGLKKKSPEDVKKVFHILDKDRSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALV 107
            E+ELK+ L+ F+   R L+D ETKA+L AGD DGDGKIG DEFA +V
Sbjct  61   EEELKFVLKGFTPDGRDLSDKETKALLAAGDKDGDGKIGADEFATMV 107

Sequence Alignment: 33. Allergen Name: Cro p 2.0101 Sequence ID: XP_019400389

 Score = 58.2 bits 391,  Expect = 6e-11
 Identities = 59/107 55%, Positives = 77/107 71%, Gaps = 0/107 0%
Query  1    MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIE 60
            MA   +L+  DI  A+ A  AA+SF +K FF  VGL  K+ +D+KK F ++D+D+SGFIE
Sbjct  1    MAMTDLLSADDIKKAVGAFAAAESFNHKKFFEMVGLKKKSQDDVKKVFHILDKDRSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALV 107
            EDELK  L+ F+  AR L+D ETK +L AGD DGDGKIG+DEF +LV
Sbjct  61   EDELKSVLKGFTPDARDLSDKETKELLAAGDKDGDGKIGVDEFTSLV 107

Sequence Alignment: 34. Allergen Name: Pan h 1.0201 Sequence ID: XP_026803769

 Score = 57.4 bits 384,  Expect = 1e-10
 Identities = 62/107 57%, Positives = 74/107 69%, Gaps = 0/107 0%
Query  1    MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIE 60
            MA   +L   DI  AL   + AD+F +K FF  VGL A + E++KK F+V+D D SGFIE
Sbjct  1    MAMQDLLKADDIKKALDTFKVADTFDHKKFFELVGLKAMSAENVKKVFSVLDVDASGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALV 107
            EDELK+ L+ FS   R LTD ETKAFL A D DGDGKIGIDEF A+V
Sbjct  61   EDELKFVLKGFSKDGRDLTDKETKAFLTAADRDGDGKIGIDEFEAIV 107

Sequence Alignment: 35. Allergen Name: Ran e 1 Sequence ID: CAC83046

 Score = 53.6 bits 352,  Expect = 1e-09
 Identities = 54/107 50%, Positives = 74/107 69%, Gaps = 0/107 0%
Query  1    MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIE 60
            M    +L   DI+ A++A  A +SF +K FF   GL +K+ E ++K F V+DQD+SGFIE
Sbjct  1    MPMTDLLAAGDISKAVSAFAAPESFNHKKFFELCGLKSKSKEIMQKVFHVLDQDQSGFIE 60
Query  61   EDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALV 107
            ++EL L L+ F+   R+L+D ET A+L AGD DGDGKIG+DEF  LV
Sbjct  61   KEELCLILKGFTPEGRSLSDKETTALLAAGDKDGDGKIGVDEFVTLV 107

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.