The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAFSFTILMETRQLMAFYLGDCLRALNLNPTLAQIEKLGGTKKKNEKKLKVEEFLPIFSQ
VKKEKDHGTLEDFIECMKLYDKSENGTMMLAELNHILLALGEKLEDSQVDSIFKECMDPE
DDEGNIPYTPFLKRLLAGPYPDAQ
Sequence Info Allergen Name Length Opt Bits Score E Value
A7L499 Art fr 5.0101 144 951 224.0 1.2e-60
A0A514C9K9 Scy p 3.0101 153 581 139.7 3.3e-35
J7HCX7 Pro c 5.0101 153 575 138.3 8.4e-35
AIO08852 Der f 26.0101 160 472 114.8 1e-27
QAT18638 Der p 26.0101 121 333 83.3 2.4e-18
P02604 Gal d 7.0101 192 327 81.6 1.2e-17
A0JNJ5 Bos d 13.0101 192 325 81.2 1.6e-17
P85100 Bos d 13.0201 199 325 81.2 1.7e-17
QBF67841 Der f 39.0101 153 140 39.1 5.9e-05
QXY82447 Der p 39.0101 153 140 39.1 5.9e-05
ACL36923 Tyr p 24.0101 153 138 38.7 8.1e-05
D2DGW3 Tyr p 34.0101 153 138 38.7 8.1e-05
P29291 Hom a 6.0101 150 137 38.5 9.3e-05
ABB89298 Bla g 6.0301 154 128 36.4 0.0004
ADV17344 Pen m 6.0101 150 125 35.7 0.00062
ABB89297 Bla g 6.0201 151 124 35.5 0.00073
Q1M0Y3 Per a 6.0101 151 122 35.0 0.001
ABB89296 Bla g 6.0101 151 118 34.1 0.0019
Q2KN25 Amb a 10.0101 160 116 33.6 0.0028
AAF31152 Ole e 8 171 116 33.6 0.0031
Q9M7R0 Ole e 8 171 115 33.4 0.0036
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Art fr 5.0101 Sequence ID: A7L499

 Score = 224.0 bits 951,  Expect = 1e-60
 Identities = 144/144 100%, Positives = 144/144 100%, Gaps = 0/144 0%
Query  1    MAFSFTILMETRQLMAFYLGDCLRALNLNPTLAQIEKLGGTKKKNEKKLKVEEFLPIFSQ 60
            MAFSFTILMETRQLMAFYLGDCLRALNLNPTLAQIEKLGGTKKKNEKKLKVEEFLPIFSQ
Sbjct  1    MAFSFTILMETRQLMAFYLGDCLRALNLNPTLAQIEKLGGTKKKNEKKLKVEEFLPIFSQ 60
Query  61   VKKEKDHGTLEDFIECMKLYDKSENGTMMLAELNHILLALGEKLEDSQVDSIFKECMDPE 120
            VKKEKDHGTLEDFIECMKLYDKSENGTMMLAELNHILLALGEKLEDSQVDSIFKECMDPE
Sbjct  61   VKKEKDHGTLEDFIECMKLYDKSENGTMMLAELNHILLALGEKLEDSQVDSIFKECMDPE 120
Query  121  DDEGNIPYTPFLKRLLAGPYPDAQ 144
            DDEGNIPYTPFLKRLLAGPYPDAQ
Sbjct  121  DDEGNIPYTPFLKRLLAGPYPDAQ 144

Sequence Alignment: 2. Allergen Name: Scy p 3.0101 Sequence ID: A0A514C9K9

 Score = 139.7 bits 581,  Expect = 3e-35
 Identities = 87/133 65%, Positives = 113/133 84%, Gaps = 2/133 1%
Query  3    FSFTIL-METRQLM-AFYLGDCLRALNLNPTLAQIEKLGGTKKKNEKKLKVEEFLPIFSQ 60
            F+F+I   E +  M AFY+GDCLRALNLNPTLA IEK+GG  KK EK LKV++FLPIF+Q
Sbjct  15   FAFSIYDFEGKGTMDAFYVGDCLRALNLNPTLAVIEKVGGKTKKKEKMLKVDDFLPIFAQ 74
Query  61   VKKEKDHGTLEDFIECMKLYDKSENGTMMLAELNHILLALGEKLEDSQVDSIFKECMDPE 120
            VKK+KD G++EDF+E +KLYDK+ENGTM+ AEL HILL+LGE+LE S+++ ++K+C D E
Sbjct  75   VKKDKDAGSFEDFMEVLKLYDKTENGTMLYAELEHILLSLGERLEKSELEPVLKDCCDEE 134
Query  121  DDEGNIPYTPFLKRL 135
            D++G IPY PFLK+L
Sbjct  135  DEDGFIPYEPFLKKL 149

Sequence Alignment: 3. Allergen Name: Pro c 5.0101 Sequence ID: J7HCX7

 Score = 138.3 bits 575,  Expect = 8e-35
 Identities = 86/133 64%, Positives = 112/133 84%, Gaps = 2/133 1%
Query  3    FSFTIL-METRQLM-AFYLGDCLRALNLNPTLAQIEKLGGTKKKNEKKLKVEEFLPIFSQ 60
            F+F+I   E    M AFY+GDCLRALNLNPTLA IEK+GG +K+ EK +K+EEF+PIF+Q
Sbjct  15   FAFSIYDFEGNGTMDAFYIGDCLRALNLNPTLAIIEKVGGKEKRKEKIIKLEEFIPIFAQ 74
Query  61   VKKEKDHGTLEDFIECMKLYDKSENGTMMLAELNHILLALGEKLEDSQVDSIFKECMDPE 120
            VKK+KD G+ EDF+E +KLYDKSENGTMM AEL HILL+LGE+LE S+++ ++KEC + E
Sbjct  75   VKKDKDAGSYEDFMEVLKLYDKSENGTMMYAELEHILLSLGERLEKSELEPVLKECCNEE 134
Query  121  DDEGNIPYTPFLKRL 135
            D++G IPY PFLK++
Sbjct  135  DEDGFIPYEPFLKKM 149

Sequence Alignment: 4. Allergen Name: Der f 26.0101 Sequence ID: AIO08852

 Score = 114.8 bits 472,  Expect = 1e-27
 Identities = 70/125 56%, Positives = 94/125 75%, Gaps = 0/125 0%
Query  18   YLGDCLRALNLNPTLAQIEKLGGTKKKNEKKLKVEEFLPIFSQVKKEKDHGTLEDFIECM 77
            YLGD LR+L+L PT   + K G  KKK +K +  EEFLPI+SQVKK+KD G +ED++E +
Sbjct  31   YLGDLLRSLDLRPTQDSVAKNGWEKKKGQKFMTFEEFLPIYSQVKKDKDCGAFEDLVEGL 90
Query  78   KLYDKSENGTMMLAELNHILLALGEKLEDSQVDSIFKECMDPEDDEGNIPYTPFLKRLLA 137
            K+YDK+ENGTMM AEL H+LL+LGEKL D++V+ I K C    DDEG + Y  F+K ++A
Sbjct  91   KVYDKAENGTMMEAELAHVLLSLGEKLTDAEVEEIIKTCGGGCDDEGFMKYETFIKNVMA 150
Query  138  GPYPD 142
            GP+P+
Sbjct  151  GPFPE 155

Sequence Alignment: 5. Allergen Name: Der p 26.0101 Sequence ID: QAT18638

 Score = 83.3 bits 333,  Expect = 2e-18
 Identities = 51/84 60%, Positives = 65/84 77%, Gaps = 0/84 0%
Query  19   LGDCLRALNLNPTLAQIEKLGGTKKKNEKKLKVEEFLPIFSQVKKEKDHGTLEDFIECMK 78
            LGD LR+L+L PT   + K G  KKK +K +  EEFLPI+SQVKK+KD G  ED++E +K
Sbjct  32   LGDLLRSLDLRPTQEMVAKNGWEKKKGQKYMTFEEFLPIYSQVKKDKDCGAYEDLVEGLK 91
Query  79   LYDKSENGTMMLAELNHILLALGE 102
            +YDK+ENGTMM AEL H+LL+LGE
Sbjct  92   VYDKAENGTMMEAELAHVLLSLGE 115

Sequence Alignment: 6. Allergen Name: Gal d 7.0101 Sequence ID: P02604

 Score = 81.6 bits 327,  Expect = 1e-17
 Identities = 53/116 45%, Positives = 78/116 67%, Gaps = 6/116 5%
Query  19   LGDCLRALNLNPTLAQIEKLGGTKKKNE---KKLKVEEFLPIFSQVKKEKDHGTLEDFIE 75
            +GD +RAL  NPT A+I K+ G   K E   KK+  EEFLP++      KD+GT+EDF+E
Sbjct  73   VGDIVRALGQNPTNAEINKILGNPSKEEMNAKKITFEEFLPMLQAAANNKDQGTFEDFVE 132
Query  76   CMKLYDKSENGTMMLAELNHILLALGEKLEDSQVDSIFKECMDPEDDEGNIPYTPFLKRL 135
             ++++DK  NGT+M AEL H+L  LGEK+ + +V+ + K     ED  G I Y  F+K +
Sbjct  133  GLRVFDKEGNGTVMGAELRHVLATLGEKMTEEEVEELMK---GQEDSNGCINYEAFVKHI 189
Query  136  LA 137
            ++
Sbjct  190  MS 191

Sequence Alignment: 7. Allergen Name: Bos d 13.0101 Sequence ID: A0JNJ5

 Score = 81.2 bits 325,  Expect = 2e-17
 Identities = 50/116 43%, Positives = 82/116 70%, Gaps = 6/116 5%
Query  19   LGDCLRALNLNPTLAQIEKLGGT---KKKNEKKLKVEEFLPIFSQVKKEKDHGTLEDFIE 75
            +GD LRAL  NPT A+++K+ G    ++ N KK++ E+FLP++  +   KD+GT EDF+E
Sbjct  73   VGDVLRALGTNPTNAEVKKVLGNPSNEEMNAKKIEFEQFLPMLQAISNNKDQGTYEDFVE 132
Query  76   CMKLYDKSENGTMMLAELNHILLALGEKLEDSQVDSIFKECMDPEDDEGNIPYTPFLKRL 135
             ++++DK  NGT+M AEL H+L  LGEK+++ +V+++       ED  G I Y  F+K +
Sbjct  133  GLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMA---GQEDSNGCINYEAFVKHI 189
Query  136  LA 137
            ++
Sbjct  190  MS 191

Sequence Alignment: 8. Allergen Name: Bos d 13.0201 Sequence ID: P85100

 Score = 81.2 bits 325,  Expect = 2e-17
 Identities = 52/116 44%, Positives = 77/116 66%, Gaps = 6/116 5%
Query  20   GDCLRALNLNPTLAQIEKLGGTKKKNE---KKLKVEEFLPIFSQVKKEKDHGTLEDFIEC 76
            GD LRAL  NPT A++ ++ G  K+ E   K +  + FLP++ ++ K KD GT EDF+E 
Sbjct  81   GDVLRALGQNPTQAEVLRVLGKPKQEELNSKMMDFDTFLPMLQHISKNKDTGTYEDFVEG 140
Query  77   MKLYDKSENGTMMLAELNHILLALGEKLEDSQVDSIFKECMDPEDDEGNIPYTPFLKRLL 136
            ++++DK  NGT+M AEL H+L  LGEKL + +V+ +       ED  G I Y  F+K ++
Sbjct  141  LRVFDKEGNGTVMGAELRHVLATLGEKLTEDEVEKLMA---GQEDSNGCINYEAFVKHIM 197
Query  137  AG 138
            AG
Sbjct  198  AG 199

Sequence Alignment: 9. Allergen Name: Der f 39.0101 Sequence ID: QBF67841

 Score = 39.1 bits 140,  Expect = 6e-05
 Identities = 32/111 28%, Positives = 63/111 56%, Gaps = 10/111 9%
Query  19   LGDCLRALNLNPTLAQIEKLGGTKKKNEKKLKVEEFLPIFSQVKKEKDHGTL-EDFIECM 77
            LG  +   +L   + +I+  G  +      L+ +EFL + ++   E+D   + E++ E  
Sbjct  41   LGQTFEEKDLQQLITEIDADGSGE------LEFDEFLTLTARFLVEEDAEAMQEELREAF 94
Query  78   KLYDKSENGTMMLAELNHILLALGEKLEDSQVDSIFKECMDPEDDEGNIPYTPFLKRLLA 137
            ++YDK  NG +  + L  IL AL +KL + ++D +  E +D  D  G + +  F++ ++ 
Sbjct  95   RMYDKEGNGYIPTSALREILRALDDKLTNDELDEMIAE-IDT-DGSGTVDFDEFME-MMT 151
Query  138  G 138
            G
Sbjct  152  G 152

Sequence Alignment: 10. Allergen Name: Der p 39.0101 Sequence ID: QXY82447

 Score = 39.1 bits 140,  Expect = 6e-05
 Identities = 32/111 28%, Positives = 63/111 56%, Gaps = 10/111 9%
Query  19   LGDCLRALNLNPTLAQIEKLGGTKKKNEKKLKVEEFLPIFSQVKKEKDHGTL-EDFIECM 77
            LG  +   +L   + +I+  G  +      L+ +EFL + ++   E+D   + E++ E  
Sbjct  41   LGQTFEEKDLQTLITEIDADGSGE------LEFDEFLTLTARFLVEEDAEAMQEELREAF 94
Query  78   KLYDKSENGTMMLAELNHILLALGEKLEDSQVDSIFKECMDPEDDEGNIPYTPFLKRLLA 137
            ++YDK  NG +  + L  IL AL +KL + ++D +  E +D  D  G + +  F++ ++ 
Sbjct  95   RMYDKEGNGYIPTSALREILRALDDKLTNDELDEMIAE-IDT-DGSGTVDFDEFME-MMT 151
Query  138  G 138
            G
Sbjct  152  G 152

Sequence Alignment: 11. Allergen Name: Tyr p 24.0101 Sequence ID: ACL36923

 Score = 38.7 bits 138,  Expect = 8e-05
 Identities = 32/111 28%, Positives = 63/111 56%, Gaps = 10/111 9%
Query  19   LGDCLRALNLNPTLAQIEKLGGTKKKNEKKLKVEEFLPIFSQVKKEKDHGTL-EDFIECM 77
            LG  +   +L   + +I+  G  +      L+ +EFL + ++   E+D   + E++ E  
Sbjct  41   LGQTFEENDLQQLIIEIDADGSGE------LEFDEFLTLTARFLVEEDTEAMQEELREAF 94
Query  78   KLYDKSENGTMMLAELNHILLALGEKLEDSQVDSIFKECMDPEDDEGNIPYTPFLKRLLA 137
            ++YDK  NG +  + L  IL AL +KL + ++D +  E +D  D  G + +  F++ ++ 
Sbjct  95   RMYDKEGNGYIPTSALREILRALDDKLTEDELDEMIAE-IDT-DGSGTVDFDEFME-MMT 151
Query  138  G 138
            G
Sbjct  152  G 152

Sequence Alignment: 12. Allergen Name: Tyr p 34.0101 Sequence ID: D2DGW3

 Score = 38.7 bits 138,  Expect = 8e-05
 Identities = 32/111 28%, Positives = 63/111 56%, Gaps = 10/111 9%
Query  19   LGDCLRALNLNPTLAQIEKLGGTKKKNEKKLKVEEFLPIFSQVKKEKDHGTL-EDFIECM 77
            LG  +   +L   + +I+  G  +      L+ +EFL + ++   E+D   + E++ E  
Sbjct  41   LGQTFEENDLQQLIIEIDADGSGE------LEFDEFLTLTARFLVEEDTEAMQEELREAF 94
Query  78   KLYDKSENGTMMLAELNHILLALGEKLEDSQVDSIFKECMDPEDDEGNIPYTPFLKRLLA 137
            ++YDK  NG +  + L  IL AL +KL + ++D +  E +D  D  G + +  F++ ++ 
Sbjct  95   RMYDKEGNGYIPTSALREILRALDDKLTEDELDEMIAE-IDT-DGSGTVDFDEFME-MMT 151
Query  138  G 138
            G
Sbjct  152  G 152

Sequence Alignment: 13. Allergen Name: Hom a 6.0101 Sequence ID: P29291

 Score = 38.5 bits 137,  Expect = 9e-05
 Identities = 30/115 26%, Positives = 63/115 54%, Gaps = 4/115 3%
Query  19   LGDCLRALNLNPTLAQIEK-LGGTKKKNEKKLKVEEFLPIFSQVKKEKDHGTLE-DFIEC 76
            +G  LR + +  +   +++ +  T +    +L+ EEF+ + ++   E+D   L+ ++ E 
Sbjct  32   VGVILRMMGVKISEKNLQEVISETDEDGSGELEFEEFVELAAKFLIEEDEEALKAELREA 91
Query  77   MKLYDKSENGTMMLAELNHILLALGEKLEDSQVDSIFKECMDPEDDEGNIPYTPFLKRL 135
             ++YD+  NG +    L  IL  L  +L +  +DSI +E +D ED  G + +  F++ +
Sbjct  92   FRVYDRGGNGYITTDVLKEILRELDNRLTEEDLDSIIEE-VD-EDGSGTLDFNEFMQMM 148

Sequence Alignment: 14. Allergen Name: Bla g 6.0301 Sequence ID: ABB89298

 Score = 36.4 bits 128,  Expect = 0.0004
 Identities = 26/88 29%, Positives = 52/88 59%, Gaps = 4/88 4%
Query  48   KLKVEEFLPIFSQVKKEKDHGTLE-DFIECMKLYDKSENGTMMLAELNHILLALGEKLED 106
            +L+ +EF+ + ++   E+D   +E ++ E  +LYDK  NG +  + L  IL  L E+L  
Sbjct  66   RLEFDEFVTLAAKFIIEEDSEAMEKELREAFRLYDKEGNGYIPTSCLREILRELDEQLTS 125
Query  107  SQVDSIFKECMDPEDDEGNIPYTPFLKRLLAG 138
             ++D + +E +D  D  G + +  F++ ++ G
Sbjct  126  DELDMMIEE-IDA-DGSGTVDFDEFME-MMTG 154

Sequence Alignment: 15. Allergen Name: Pen m 6.0101 Sequence ID: ADV17344

 Score = 35.7 bits 125,  Expect = 0.0006
 Identities = 34/124 27%, Positives = 67/124 54%, Gaps = 10/124 8%
Query  6    TILMETRQLMAFYLGDCLRALNLNPTLAQIEKLGGTKKKNEKKLKVEEFLPIFSQVKKEK 65
            +I  ET  ++   +G  +   NL   +A+ ++ G         L+ EEF  + ++   E+
Sbjct  26   SINAETVGVILRMMGVKISEKNLQEVIAETDEDGS------GMLEFEEFAELAAKFLIEE 79
Query  66   DHGTLE-DFIECMKLYDKSENGTMMLAELNHILLALGEKLEDSQVDSIFKECMDPEDDEG 124
            D   L+ ++ E  ++YDK   G +    L  IL+ L  KL  + ++ I +E +D ED  G
Sbjct  80   DEEALKAELREAFRIYDKDCQGYITTDILKEILVELDPKLTPTDLEGIIEE-VD-EDGSG 137
Query  125  NIPYTPFLKRLLAG 138
             + +  F++ +++G
Sbjct  138  TLDFDEFME-MMSG 150

Sequence Alignment: 16. Allergen Name: Bla g 6.0201 Sequence ID: ABB89297

 Score = 35.5 bits 124,  Expect = 0.0007
 Identities = 32/107 29%, Positives = 58/107 54%, Gaps = 9/107 8%
Query  19   LGDCLRALNLNPTLAQIEKLGGTKKKNEKKLKVEEFLPIFSQVKKEKDHGTLE-DFIECM 77
            LG  L    L+  +A+++  G        +L+ EEF  + S+   E+D   ++ ++ E  
Sbjct  39   LGTRLDQDMLDEIIAEVDADGS------GELEFEEFCTLASRFLVEEDAEAMQHELREAF 92
Query  78   KLYDKSENGTMMLAELNHILLALGEKLEDSQVDSIFKECMDPEDDEGNIPYTPFLK 133
            +LYDK  NG +  A L  IL  L +K+    +D + +E +D  D  G + +  F++
Sbjct  93   RLYDKEGNGYITTAVLREILKELDDKITAEDLDMMIEE-IDS-DGSGTVDFDEFME 146

Sequence Alignment: 17. Allergen Name: Per a 6.0101 Sequence ID: Q1M0Y3

 Score = 35.0 bits 122,  Expect = 0.001
 Identities = 24/84 28%, Positives = 49/84 58%, Gaps = 3/84 3%
Query  48   KLKVEEFLPIFSQVKKEKDHGTLE-DFIECMKLYDKSENGTMMLAELNHILLALGEKLED 106
            +L+ +EF+ + ++   E+D   ++ ++ E  +LYDK  NG +    L  IL  L +KL +
Sbjct  62   ELEFQEFVTLAARFLVEEDAEAMQQELKEAFRLYDKEGNGYITTTVLREILKELDDKLTN 121
Query  107  SQVDSIFKECMDPEDDEGNIPYTPFLK 133
              +D++ +E +D  D  G + +  F++
Sbjct  122  EDLDAMIEE-IDS-DGSGTVDFDEFME 146

Sequence Alignment: 18. Allergen Name: Bla g 6.0101 Sequence ID: ABB89296

 Score = 34.1 bits 118,  Expect = 0.002
 Identities = 25/84 29%, Positives = 46/84 54%, Gaps = 3/84 3%
Query  48   KLKVEEFLPIFSQVKKEKDHGTLEDFI-ECMKLYDKSENGTMMLAELNHILLALGEKLED 106
            +L+ EEF+ + S+   E+D   ++  + E  +LYDK  NG +    L  IL  L +K+  
Sbjct  62   ELEFEEFVSLASRFLVEEDAEAMQQELREAFRLYDKEGNGYITTNVLREILKELDDKITA 121
Query  107  SQVDSIFKECMDPEDDEGNIPYTPFLK 133
              +D + +E +D  D  G + +  F++
Sbjct  122  EDLDMMIEE-IDS-DGSGTVDFDEFME 146

Sequence Alignment: 19. Allergen Name: Amb a 10.0101 Sequence ID: Q2KN25

 Score = 33.6 bits 116,  Expect = 0.003
 Identities = 26/82 31%, Positives = 47/82 57%, Gaps = 6/82 7%
Query  49   LKVEEFLPIFSQVKKEKDHGTLEDFIECMKLYDKSENGTMMLAELNHILLALGEKLE-DS 107
            + ++EF+     ++ E D   + D+ E  K+YD++ NG +   EL++IL  LGE    +S
Sbjct  69   ISLDEFILFCKGIESEGDE--INDLKEAFKFYDQNNNGVISANELHQILGRLGENYSVES 126
Query  108  QVDSIFKECMDPEDDEGNIPYTPFLKRL 135
              D I  + +D  D +G + +  F K +
Sbjct  127  CADMI--KSVDS-DGDGFVDFEEFRKMM 151

Sequence Alignment: 20. Allergen Name: Ole e 8 Sequence ID: AAF31152

 Score = 33.6 bits 116,  Expect = 0.003
 Identities = 33/109 30%, Positives = 56/109 51%, Gaps = 11/109 10%
Query  22   C-LRALNLNPTLAQIEKLGGTKKKNEKK-LKVEEFLPIFSQVKKEKD----HGTLEDFIE 75
            C L+AL  N +  +I ++      ++   + V+EF      VK E D     G   ++ E
Sbjct  43   CALKALGSNTSKEEIARMMEEIDTDKDGFINVQEFAAF---VKAETDPYPSSGGENELKE 99
Query  76   CMKLYDKSENGTMMLAELNHILLALGEKLEDSQVDSIFKECMDPEDDEGNIPYTPFLKRL 135
              +LYD+  NG +   EL+ IL  LGE+  +     + K  +D  D +G + +  F K +
Sbjct  100  AFELYDQDHNGLISSVELHKILTRLGERYAEHDCVEMIKS-VDS-DGDGYVSFEEFKKMM 157

Sequence Alignment: 21. Allergen Name: Ole e 8 Sequence ID: Q9M7R0

 Score = 33.4 bits 115,  Expect = 0.004
 Identities = 33/112 29%, Positives = 56/112 50%, Gaps = 10/112 8%
Query  19   LGDCLRALNLNPTLAQIEKLGGTKKKNEKK-LKVEEFLPIFSQVKKEKD----HGTLEDF 73
            L   L+AL  N +  +I ++      ++   + V+EF      VK E D     G   ++
Sbjct  41   LAGVLKALGSNTSKEEIGRIMEEIDTDKDGFINVQEFAAF---VKAETDPYPSSGGENEL 97
Query  74   IECMKLYDKSENGTMMLAELNHILLALGEKLEDSQVDSIFKECMDPEDDEGNIPYTPFLK 133
             E  +LYD+  NG +   EL+ IL  LGE+  +     + K  +D  D +G + +  F K
Sbjct  98   KEAFELYDQDHNGLISSVELHKILTRLGERYAEHDCVEMIKS-VDS-DGDGYVSFEEFKK 155
Query  134  RL 135
             +
Sbjct  156  MM 157

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.