The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Use SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAGASAKVVAMLLSVLATYGFAAGVVYTNDWLPAKATWYGQPNGAGPDDNGGACGFKNTN
QYPFMSMTSCGNEPLFQDGKGCGACYQIRCTNNPSCSGQPRTVIITDMNYYPVARYHFDL
SGTAFGAMARPGLNDQLRHAGIIDIQFRRVPCYHRGLYVNFHVEAGSNPVYLAVLVEFAN
KDGTVVQLDVMESLPSGKPTRVWTPMRRSWGSIWRLDANHRLQGPXSLRMVSESGQTVIA
HQVIPANWRANTNYGSKVQFR
Sequence Info Allergen Name Length Opt Bits Score E Value
AAB61710 Ory s 1 261 1822 422.0 1.1e-119
AAF72987 Ory s 1 275 1295 301.8 1.6e-83
AAF72988 Ory s 1 327 1235 288.1 2.6e-79
AAF72985 Ory s 1 286 1228 286.5 6.8e-79
AAF72984 Ory s 1 268 1208 282.0 1.5e-77
AAD10496 Tri a ps93 271 1193 278.6 1.6e-76
AAF72989 Ory s 1 271 1094 256.0 9.9e-70
ACA23876 Pas n 1.0101 265 1051 246.2 8.6e-67
P58738 Zea m 1 269 1027 240.7 3.9e-65
AAF72990 Ory s 1 269 978 229.6 9e-62
AAF72991 Ory s 1 267 957 224.8 2.5e-60
A0A4D6G2J8 Uro m 1.0201 229 938 220.5 4e-59
AAF72983 Ory s 1 267 922 216.8 6.2e-58
P43213 Phl p 1 263 901 212.0 1.7e-56
CAA10520 Poa p a 263 896 210.9 3.7e-56
CAA10140 Hol l 1 263 894 210.4 5.1e-56
AAL14079 Cyn d 1.0203 262 889 209.3 1.1e-55
A0A4D6FZ45 Uro m 1.0101 262 889 209.3 1.1e-55
P43216 Hol l 1 265 885 208.4 2.1e-55
CAA81613 Phl p 1.0101 263 884 208.1 2.5e-55
CAA93121 Hol l 1.0102 248 882 207.7 3.1e-55
AAL14078 Cyn d 1 262 882 207.7 3.4e-55
CAB63699 Lol p 1.0103 263 879 207.0 5.4e-55
AAL14077 Cyn d 1.0202 262 876 206.3 8.7e-55
O04701 Cyn d 1 246 875 206.1 9.3e-55
QCX36431 Zoy m 1.0101 272 875 206.1 1.1e-54
Q41260 Pha a 1 269 873 205.6 1.4e-54
AAA63278 Lol p 1.0102 252 872 205.4 1.5e-54
AAA63279 Lol p 1.0101 263 872 205.4 1.6e-54
AAF80379 Cyn d 1.0204 244 868 204.5 2.8e-54
AAK96255 Cyn d 1.0201 244 867 204.3 3.3e-54
P14946 Lol p 1 263 866 204.0 4.2e-54
ABC58726 Sor h 1.0101 239 835 197.0 5e-52
Q07154 Zea m 1 191 828 195.5 1.1e-51
AAA50175 Gly m 2 277 766 181.2 3.3e-47
AAF72986 Ory s 1 275 761 180.1 7.2e-47
Q40638 Ory s 1 263 738 174.9 2.6e-45
CAB37496 Ara t expansin 265 425 103.5 7.8e-24
BAA85432 Ory s 1 284 382 93.7 7.6e-21
AAG13596 Ory s 1 275 360 88.7 2.3e-19
CAA10348 Poa p 2 122 174 46.9 4.1e-07
CAA10345 Dac g 2 122 174 46.9 4.1e-07
P43214 Phl p 2 122 174 46.9 4.1e-07
P14947 Lol p 2 97 169 46.1 5.5e-07
CAA10346 Cyn d 2 122 169 45.7 8.9e-07
P93124 Dac g 3 96 158 43.6 3e-06
CAA51775 Lol p 2 88 153 42.7 5.3e-06
AAP80171 Cyn d 15 112 154 42.4 8.1e-06
2JNZ_A Phl p 3.0101 108 145 40.4 3.1e-05
Q7M1X8 Dac g 1.0101 34 117 37.8 6.1e-05
P14948 Lol p 3 97 134 38.1 0.00014
Q7M1X6 Ant o 1.0101 32 99 33.6 0.001
CAA90746 Tri a 3 118 117 33.9 0.0031
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ory s 1 Sequence ID: AAB61710

 Score = 422.0 bits 1822,  Expect = 1e-119
 Identities = 261/261 100%, Positives = 260/261 99%, Gaps = 0/261 0%
Query  1    MAGASAKVVAMLLSVLATYGFAAGVVYTNDWLPAKATWYGQPNGAGPDDNGGACGFKNTN 60
            MAGASAKVVAMLLSVLATYGFAAGVVYTNDWLPAKATWYGQPNGAGPDDNGGACGFKNTN
Sbjct  1    MAGASAKVVAMLLSVLATYGFAAGVVYTNDWLPAKATWYGQPNGAGPDDNGGACGFKNTN 60
Query  61   QYPFMSMTSCGNEPLFQDGKGCGACYQIRCTNNPSCSGQPRTVIITDMNYYPVARYHFDL 120
            QYPFMSMTSCGNEPLFQDGKGCGACYQIRCTNNPSCSGQPRTVIITDMNYYPVARYHFDL
Sbjct  61   QYPFMSMTSCGNEPLFQDGKGCGACYQIRCTNNPSCSGQPRTVIITDMNYYPVARYHFDL 120
Query  121  SGTAFGAMARPGLNDQLRHAGIIDIQFRRVPCYHRGLYVNFHVEAGSNPVYLAVLVEFAN 180
            SGTAFGAMARPGLNDQLRHAGIIDIQFRRVPCYHRGLYVNFHVEAGSNPVYLAVLVEFAN
Sbjct  121  SGTAFGAMARPGLNDQLRHAGIIDIQFRRVPCYHRGLYVNFHVEAGSNPVYLAVLVEFAN 180
Query  181  KDGTVVQLDVMESLPSGKPTRVWTPMRRSWGSIWRLDANHRLQGPXSLRMVSESGQTVIA 240
            KDGTVVQLDVMESLPSGKPTRVWTPMRRSWGSIWRLDANHRLQGPXSLRMVSESGQTVIA
Sbjct  181  KDGTVVQLDVMESLPSGKPTRVWTPMRRSWGSIWRLDANHRLQGPXSLRMVSESGQTVIA 240
Query  241  HQVIPANWRANTNYGSKVQFR 261
            HQVIPANWRANTNYGSKVQFR
Sbjct  241  HQVIPANWRANTNYGSKVQFR 261

Sequence Alignment: 2. Allergen Name: Ory s 1 Sequence ID: AAF72987

 Score = 301.8 bits 1295,  Expect = 2e-83
 Identities = 184/258 71%, Positives = 213/258 82%, Gaps = 11/258 4%
Query  3    GASAKVVAMLLSVLATYGFAAG----------VVYTNDWLPAKATWYGQPNGAGPDDNGG 52
            G+    +  +LSVL  +G   G            Y + WLPA+ATWYG P GAGPDDNGG
Sbjct  6    GSKVAAILAILSVLVVHGSCKGHPVNYNVSDASAYGSGWLPARATWYGAPTGAGPDDNGG 65
Query  53   ACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACYQIRCTNNPSCSGQPRTVIITDMNYYP 112
            ACGFKN NQYPF SMTSCGNEP+F+DGKGCG+CYQIRC  +PSCSG   TVIITDMNYYP
Sbjct  66   ACGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITDMNYYP 125
Query  113  VARYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQFRRVPCYHRGLYVNFHVEAGSNPVYL 172
            VARYHFDLSGTAFGAMA+PGLND+LRH+GIIDIQFRRVPC + GL +NFHVE GSNPVY+
Sbjct  126  VARYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYPGLKINFHVEEGSNPVYF 185
Query  173  AVLVEFANKDGTVVQLDVMESLPS-GKPTRVWTPMRRSWGSIWRLDANHRLQGPXSLRMV 231
            AVLVE+ + DG VVQ+D+MES  + G  T VWTPMR SWGSIWRLD+NHRLQ P SLR+ 
Sbjct  186  AVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPFSLRIR 245
Query  232  SESGQTVIAHQVIPANWRANTNYGSKVQF 260
            S+SG+T++A+ VIPANW  N+NY S VQF
Sbjct  246  SDSGKTLVANNVIPANWSPNSNYRSIVQF 274

Sequence Alignment: 3. Allergen Name: Ory s 1 Sequence ID: AAF72988

 Score = 288.1 bits 1235,  Expect = 3e-79
 Identities = 173/230 75%, Positives = 194/230 84%, Gaps = 5/230 2%
Query  31   WLPAKATWYGQPNGAGPDDNGGACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACYQIRC 90
            WL A+ATWYG PNGAGPDDNGGACGFKN N  PF +MTSCGNEPLF+DGKGCG+CYQIRC
Sbjct  92   WLNARATWYGAPNGAGPDDNGGACGFKNVNLPPFSAMTSCGNEPLFKDGKGCGSCYQIRC 151
Query  91   TNNPSCSGQPRTVIITDMNYYPVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQFRRV 150
              +P+CSG P TVIITDMNYYPV+ YHFDLSGTAFGAMA+   ND+LRHAGIIDIQFRRV
Sbjct  152  VGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMAKDNRNDELRHAGIIDIQFRRV 211
Query  151  PCYHRGLYVNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPS-----GKPTRVWTP 205
            PC + GL V FHVE GSNPVY+A+LVE+ N DG VVQ+D+MES  S     G PT VWTP
Sbjct  212  PCQYPGLTVTFHVEQGSNPVYMAILVEYENGDGDVVQVDLMESRYSTGGVDGTPTGVWTP 271
Query  206  MRRSWGSIWRLDANHRLQGPXSLRMVSESGQTVIAHQVIPANWRANTNYGSKVQF 260
            MR SWGSIWRLD NH LQGP SLR+ +ESG+T+IA QVIPA+W+ NT Y S VQF
Sbjct  272  MRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQVIPADWQPNTVYSSIVQF 326

Sequence Alignment: 4. Allergen Name: Ory s 1 Sequence ID: AAF72985

 Score = 286.5 bits 1228,  Expect = 7e-79
 Identities = 169/235 71%, Positives = 198/235 84%, Gaps = 1/235 0%
Query  26   VYTNDWLPAKATWYGQPNGAGPDDNGGACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGAC 85
            VY   W  A+ATWYGQPNGAGPDDNGGACGFK+TNQYPFMSMTSCGN+PLF+DGKGCG+C
Sbjct  50   VYWGPWTKARATWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGSC 109
Query  86   YQIRCTNNPSCSGQPRTVIITDMNYYPVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDI 145
            Y+IRCT + SCSG+  TVIITDMNYYPVA +HFDLSGTAFG +A+PGLND+LRH+GIIDI
Sbjct  110  YKIRCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGIIDI 169
Query  146  QFRRVPCYHRGLYVNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPS-GKPTRVWT 204
            +F RVPC   GL + FHVE  SNPVY+AVLVE+ + DG VVQ+D+MES  + G PT  WT
Sbjct  170  EFTRVPCEFPGLKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGKWT 229
Query  205  PMRRSWGSIWRLDANHRLQGPXSLRMVSESGQTVIAHQVIPANWRANTNYGSKVQF 260
            PMR SWGSIWRLD NHRLQ P S+R+ +ESG+T++A+ VIPANWR NT Y S VQ+
Sbjct  230  PMRESWGSIWRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRSFVQY 285

Sequence Alignment: 5. Allergen Name: Ory s 1 Sequence ID: AAF72984

 Score = 282.0 bits 1208,  Expect = 1e-77
 Identities = 165/226 73%, Positives = 192/226 84%, Gaps = 5/226 2%
Query  30   DWLPAKATWYGQPNGAGPDDNGGACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACYQIR 89
            +W  A+ATWYG P GAGPDD+GGACGFKNTNQYPF SMTSCGNEP+F+DGKGCG+CYQIR
Sbjct  41   NWEVARATWYGAPTGAGPDDDGGACGFKNTNQYPFSSMTSCGNEPIFKDGKGCGSCYQIR 100
Query  90   CTNNPSCSGQPRTVIITDMNYYPVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQFRR 149
            C N+P+CSG P TVIITDMNYYPV++YHFDLSGTAFGAMA+PG NDQLRHAGIIDIQF+R
Sbjct  101  CVNHPACSGNPETVIITDMNYYPVSKYHFDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKR 160
Query  150  VPCYHRGLYVNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTPMRRS 209
            VPC   GL V FHVE GSNPVY+AVLVE+ + DG VVQ+D+ME+      ++ WTPMR S
Sbjct  161  VPCNFPGLKVTFHVEEGSNPVYFAVLVEYEDGDGDVVQVDLMEA-----NSQSWTPMRES 215
Query  210  WGSIWRLDANHRLQGPXSLRMVSESGQTVIAHQVIPANWRANTNYGSKVQF 260
            WGSIWRLD+NHRL  P SLR+ +ESG+ ++A QVIPANW     Y S VQ+
Sbjct  216  WGSIWRLDSNHRLTAPFSLRITNESGKQLVASQVIPANWAPMAVYRSFVQY 266

Sequence Alignment: 6. Allergen Name: Tri a ps93 Sequence ID: AAD10496

 Score = 278.6 bits 1193,  Expect = 2e-76
 Identities = 168/259 64%, Positives = 212/259 81%, Gaps = 12/259 4%
Query  1    MAGASAKVVAM--LLSVLAT-------YGFAAGVVYTNDWLPAKATWYGQPNGAGPDDNG 51
            MAG S+  +A+  LLS+L T       Y  A    YT+ WLPAKATWYG PNGAGPDDNG
Sbjct  1    MAGVSSNAIALVALLSMLFTSVRSAVNYDTAVARSYTSGWLPAKATWYGAPNGAGPDDNG 60
Query  52   GACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACYQIRC--TNNPSCSGQPRTVIITDMN 109
            GACGFKN NQYP  SM +CGNEP+F  G+GCG CY+I+C  +NNPSCSGQPR ++ITDMN
Sbjct  61   GACGFKNVNQYPISSMGACGNEPIFAGGEGCGMCYEIKCEYSNNPSCSGQPRRIVITDMN 120
Query  110  YYPVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQFRRVPCYHRGLYVNFHVEAGSNP 169
            YYPVARYH+DLSGTAFG+MA+ GLND+LRHAGIID+QFRRVPC   G+ V FHV+ GSNP
Sbjct  121  YYPVARYHLDLSGTAFGSMAKYGLNDRLRHAGIIDMQFRRVPCNFPGMKVTFHVQRGSNP 180
Query  170  VYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTPMRRSWGSIWRLDANHRLQGPXSLR 229
             YLAVLVE+ N DGTVV++++M+++ +G+PT  W  MRRSWGS+WR+D N  +QGP S+R
Sbjct  181  NYLAVLVEYVNVDGTVVRMELMQTM-NGRPTGYWQDMRRSWGSVWRMDTNRPVQGPFSIR 239
Query  230  MVSESGQTVIAHQVIPANWRANTNYGSKVQF 260
            + S++G+T++A+  IPA W+ +  Y S +QF
Sbjct  240  ITSDTGKTLVANNAIPAYWQQDHAYWSNLQF 270

Sequence Alignment: 7. Allergen Name: Ory s 1 Sequence ID: AAF72989

 Score = 256.0 bits 1094,  Expect = 1e-69
 Identities = 150/227 66%, Positives = 180/227 79%, Gaps = 3/227 1%
Query  31   WLPAKATWYGQPNGAGPDDNGGACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACYQIRC 90
            W  AKATWYGQPNGAG  DNGGACGFK  NQYPFM MTSCGN+PL++ GKGCG+CY++RC
Sbjct  43   WGNAKATWYGQPNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRC 102
Query  91   TNNPSCSGQPRTVIITDMNYYPVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQFRRV 150
              NP+CSG  +TV ITDMNY+P+++YHFDLSG AFG +A+PG  D LR AGIID+QF RV
Sbjct  103  NRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARV 162
Query  151  PCYHRGLYVNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTPMRRSW 210
            PC   GL V FHVE GS+PVYLAVLVE+ N DG V Q+D+ E+   G   R WTPMR SW
Sbjct  163  PCEFPGLKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGG--R-WTPMRESW 219
Query  211  GSIWRLDANHRLQGPXSLRMVSESGQTVIAHQVIPANWRANTNYGSKVQF 260
            GS+WRLD+NHRL+ P S+R+ S+SG+T++A  VIP NW  NT Y S VQ+
Sbjct  220  GSVWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFYRSFVQY 269

Sequence Alignment: 8. Allergen Name: Pas n 1.0101 Sequence ID: ACA23876

 Score = 246.2 bits 1051,  Expect = 9e-67
 Identities = 145/227 63%, Positives = 174/227 76%, Gaps = 8/227 3%
Query  27   YTNDWLPAKATWYGQPNGAGPDDNGGACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACY 86
            Y   WLPAKATWYGQPNGAGPDDNGGACG KN N  P+   T+CGN P+F+DGKGCG+CY
Sbjct  38   YNGKWLPAKATWYGQPNGAGPDDNGGACGIKNVNLPPYNGFTACGNPPIFKDGKGCGSCY 97
Query  87   QIRCTNNPSCSGQPRTVIITDMNYYPVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQ 146
            +IRC N P CSGQP TV ITDMNY P+A YHFDLSG AFGAMA+PGLND+LRH GI D++
Sbjct  98   EIRC-NKPECSGQPVTVFITDMNYEPIAPYHFDLSGKAFGAMAKPGLNDKLRHYGIFDLE 156
Query  147  FRRVPC-YHRGLYVNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTP 205
            FRRV C Y+ G  + FHVE GSNP YLA+LV+F   DG +V +++ E       +  W P
Sbjct  157  FRRVRCKYQGGQKIVFHVEKGSNPNYLAMLVKFVADDGDIVLMELKEK------SSDWKP 210
Query  206  MRRSWGSIWRLDANHRLQGPXSLRMVSESGQTVIAHQVIPANWRANTNYGSKVQF 260
            M+ SWG+IWR+D    L  P S+R+ SESG+ VIA+ VIP NW+ +T Y S VQF
Sbjct  211  MKLSWGAIWRMDTPKALVPPFSIRLTSESGKKVIAQDVIPVNWKPDTVYNSNVQF 265

Sequence Alignment: 9. Allergen Name: Zea m 1 Sequence ID: P58738

 Score = 240.7 bits 1027,  Expect = 4e-65
 Identities = 136/229 59%, Positives = 171/229 74%, Gaps = 6/229 2%
Query  27   YTNDWLPAKATWYGQPNGAGPDDNGGACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACY 86
            Y   WL A+ATWYGQPNGAG  DNGGACG KN N  P+  MT+CGN P+F+DGKGCG+CY
Sbjct  39   YNGKWLTARATWYGQPNGAGAPDNGGACGIKNVNLPPYSGMTACGNVPIFKDGKGCGSCY 98
Query  87   QIRCTNNPSCSGQPRTVIITDMNYYPVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQ 146
            ++RC   P CSG P TV ITDMNY P+A YHFDLSG AFG++A+PGLND++RH GI+D++
Sbjct  99   EVRCKEKPECSGNPVTVYITDMNYEPIAPYHFDLSGKAFGSLAKPGLNDKIRHCGIMDVE 158
Query  147  FRRVPC-YHRGLYVNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTP 205
            FRRV C Y  G  + FH+E G NP YLAVLV++   DG +V +++ + L +      W P
Sbjct  159  FRRVRCKYPAGQKIVFHIEKGCNPNYLAVLVKYVADDGDIVLMEIQDKLSA-----EWKP 213
Query  206  MRRSWGSIWRLDANHRLQGPXSLRMVSESGQTVIAHQVIPANWRANTNYGSKVQF 260
            M+ SWG+IWR+D    L+GP S+R+ SESG+ VIA  VIPANWR +  Y S VQF
Sbjct  214  MKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDVIPANWRPDAVYTSNVQF 268

Sequence Alignment: 10. Allergen Name: Ory s 1 Sequence ID: AAF72990

 Score = 229.6 bits 978,  Expect = 9e-62
 Identities = 135/229 58%, Positives = 167/229 72%, Gaps = 6/229 2%
Query  27   YTNDWLPAKATWYGQPNGAGPDDNGGACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACY 86
            Y   WLPA+ATWYGQP G+G  DNGGACG KN N  P+  M SCGN P+F+DG+GCG+CY
Sbjct  39   YNAPWLPARATWYGQPYGSGSTDNGGACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCY 98
Query  87   QIRCTNNPSCSGQPRTVIITDMNYYPVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQ 146
            +++C    +CS QP TV ITDMNY P++ YHFD+SG AFGAMA PG   +LR AGIID+Q
Sbjct  99   EVKCEQPAACSKQPVTVFITDMNYEPISAYHFDFSGKAFGAMACPGKETELRKAGIIDMQ 158
Query  147  FRRVPC-YHRGLYVNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTP 205
            FRRV C Y  G  V FHVE GSNP YLAVLV+F   DG V+Q+D+ E+   G P   W P
Sbjct  159  FRRVRCKYPGGQKVTFHVEKGSNPNYLAVLVKFVADDGDVIQMDLQEA---GLP--AWRP 213
Query  206  MRRSWGSIWRLDANHRLQGPXSLRMVSESGQTVIAHQVIPANWRANTNYGSKVQF 260
            M+ SWG+IWR+D    L+ P S+R+ +ESG+++IA  VIP NW  +  Y S VQF
Sbjct  214  MKLSWGAIWRMDTATPLKAPFSIRVTTESGKSLIAKDVIPVNWMPDAIYVSNVQF 268

Sequence Alignment: 11. Allergen Name: Ory s 1 Sequence ID: AAF72991

 Score = 224.8 bits 957,  Expect = 2e-60
 Identities = 126/228 55%, Positives = 172/228 75%, Gaps = 6/228 2%
Query  27   YTNDWLPAKATWYGQPNGAGPDDNGGACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACY 86
            Y   WL A+ TWYG+P GAGPDDNGGACG+K+ ++ PF+ M SCGN+P+F+DGKGCG+C+
Sbjct  37   YGKQWLEARGTWYGKPKGAGPDDNGGACGYKDIDKAPFLGMNSCGNDPIFKDGKGCGSCF 96
Query  87   QIRCTNNPSCSGQPRTVIITDMNYYPVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQ 146
            +++C+   +CS +P  + ITDMN  P+A YHFDLSG AFGAMA+ G +++LR AGIID+Q
Sbjct  97   EVKCSKPEACSDKPVIIHITDMNTEPIAAYHFDLSGHAFGAMAKEGKDEELRKAGIIDMQ 156
Query  147  FRRVPCYHRG-LYVNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTP 205
            FRRV C + G   V FHVE GSNP Y+AVLV++   DG VV++++ E     K +  W P
Sbjct  157  FRRVRCKYPGETKVTFHVEKGSNPNYFAVLVKYVGGDGDVVKVELKE-----KGSEEWKP 211
Query  206  MRRSWGSIWRLDANHRLQGPXSLRMVSESGQTVIAHQVIPANWRANTNYGSKVQ 259
            +  SWG+IWR+D    L+GP SLR+ +ES Q ++A+ VIP NW+AN  Y S++Q
Sbjct  212  LNESWGAIWRIDTPKPLKGPFSLRVTTESDQKLVANDVIPDNWKANALYKSEIQ 265

Sequence Alignment: 12. Allergen Name: Uro m 1.0201 Sequence ID: A0A4D6G2J8

 Score = 220.5 bits 938,  Expect = 4e-59
 Identities = 124/225 55%, Positives = 167/225 74%, Gaps = 6/225 2%
Query  31   WLPAKATWYGQPNGAGPDDNGGACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACYQIRC 90
            WL AKATWYG+P GAGPDDNGGACG+K+ N+ PF SM +CGN P+F+DG GCG+CY+I+C
Sbjct  4    WLDAKATWYGKPTGAGPDDNGGACGYKDVNKAPFNSMGACGNPPIFKDGLGCGSCYEIKC 63
Query  91   TNNPSCSGQPRTVIITDMNYYPVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQFRRV 150
                 CSG+P  V ITD NY P+A YHFDL+GTAFGAMA+ G  ++LR AGIID+QFRRV
Sbjct  64   DKPAECSGEPVIVHITDQNYEPIAAYHFDLAGTAFGAMAKKGEEEKLRKAGIIDMQFRRV 123
Query  151  PC-YHRGLYVNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTPMRRS 209
             C Y     + FHVE G NP Y+A+L+++A  DG +V +D+ E     K +  + P++ S
Sbjct  124  KCKYPANTKIAFHVEKGCNPNYFALLIKYAAGDGDIVAVDIKE-----KGSEEFIPLKHS 178
Query  210  WGSIWRLDANHRLQGPXSLRMVSESGQTVIAHQVIPANWRANTNYGSKVQF 260
            WG+IWR+D+   ++GP ++R+ SE G T++    IP  W+A+T Y SK+QF
Sbjct  179  WGAIWRIDSPKPIKGPIAVRLTSEGGTTLVQDDAIPEGWKADTVYTSKLQF 229

Sequence Alignment: 13. Allergen Name: Ory s 1 Sequence ID: AAF72983

 Score = 216.8 bits 922,  Expect = 6e-58
 Identities = 120/228 52%, Positives = 166/228 72%, Gaps = 6/228 2%
Query  27   YTNDWLPAKATWYGQPNGAGPDDNGGACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACY 86
            Y + WL AKATWYG P GAGP DNGGACG+K+ ++ PF+ M SCGN+P+F+DGKGCG+C+
Sbjct  37   YGDKWLEAKATWYGAPKGAGPKDNGGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCF 96
Query  87   QIRCTNNPSCSGQPRTVIITDMNYYPVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQ 146
            +I+C+   +CS +P  + +TDMN  P+A YHFDLSG AFGAMA+ G +++LR AGIID Q
Sbjct  97   EIKCSKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQ 156
Query  147  FRRVPC-YHRGLYVNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTP 205
            FRRV C Y     + FH+E  SNP YLA+LV++   DG VV++++ E     K +  W  
Sbjct  157  FRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKE-----KGSEEWKA 211
Query  206  MRRSWGSIWRLDANHRLQGPXSLRMVSESGQTVIAHQVIPANWRANTNYGSKVQ 259
            ++ SWG+IWR+D    L+GP S+R+ +E G+ +IA   IP  W+A++ Y S VQ
Sbjct  212  LKESWGAIWRIDTPKPLKGPFSVRVTTEGGEKIIAEDAIPDGWKADSVYKSNVQ 265

Sequence Alignment: 14. Allergen Name: Phl p 1 Sequence ID: P43213

 Score = 212.0 bits 901,  Expect = 2e-56
 Identities = 130/249 52%, Positives = 176/249 70%, Gaps = 18/249 7%
Query  4    ASAKVVAMLLSVLATY-GFAAGV-----------VYTNDWLPAKATWYGQPNGAGPDDNG 51
            AS+  V +++ ++A + G A G+            Y + WL AK+TWYG+P GAGP DNG
Sbjct  2    ASSSSVLLVVVLFAVFLGSAYGIPKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDNG 61
Query  52   GACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACYQIRCTNNPSCSGQPRTVIITDMNYY 111
            GACG+K+ ++ PF  MT CGN P+F+ G+GCG+C++I+CT   +CSG+P  V ITD N  
Sbjct  62   GACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEE 121
Query  112  PVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQFRRVPC-YHRGLYVNFHVEAGSNPV 170
            P+A YHFDLSG AFGAMA+ G   +LR AG +++QFRRV C Y  G  V FHVE GSNP 
Sbjct  122  PIAPYHFDLSGHAFGAMAKKGDEQKLRSAGELELQFRRVKCKYPEGTKVTFHVEKGSNPN 181
Query  171  YLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTPMRRSWGSIWRLDANHRLQGPXSLRM 230
            YLA+LV++ N DG VV +D+ E    GK    W  ++ SWG+IWR+D   +L GP ++R 
Sbjct  182  YLALLVKYVNGDGDVVAVDIKEK---GKDK--WIELKESWGAIWRIDTPDKLTGPFTVRY 236
Query  231  VSESGQTVIAHQVIPANWRANTNYGSK 257
             +E G    A  VIP  W+A+T+Y SK
Sbjct  237  TTEGGTKTEAEDVIPEGWKADTSYESK 263

Sequence Alignment: 15. Allergen Name: Poa p a Sequence ID: CAA10520

 Score = 210.9 bits 896,  Expect = 4e-56
 Identities = 130/249 52%, Positives = 175/249 70%, Gaps = 18/249 7%
Query  4    ASAKVVAMLLSVLATY-GFAAGVV-----------YTNDWLPAKATWYGQPNGAGPDDNG 51
            AS+  V ++++++A + G A G+            Y + WL AK+TWYG+P GAGP DNG
Sbjct  2    ASSSSVLLVVALFAVFLGTAHGIAKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDNG 61
Query  52   GACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACYQIRCTNNPSCSGQPRTVIITDMNYY 111
            GACG+K+ ++ PF  MT CGN P+F+ G+GCG+C++I+CT   SCSG+P  V ITD N  
Sbjct  62   GACGYKDVDKAPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPESCSGEPVLVHITDDNEE 121
Query  112  PVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQFRRVPC-YHRGLYVNFHVEAGSNPV 170
            P+A YHFDLSG AFGAMA+ G   +LR AG ++++FRRV C Y  G  V FHVE GSNP 
Sbjct  122  PIAAYHFDLSGKAFGAMAKKGEEQKLRSAGELELKFRRVKCEYPEGTKVTFHVEKGSNPN 181
Query  171  YLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTPMRRSWGSIWRLDANHRLQGPXSLRM 230
            YLA+LV++   DG VV +D+ E    GK    W  ++ SWGSIWR+D   +L GP ++R 
Sbjct  182  YLALLVKYVTGDGDVVAVDIKEK---GKDK--WIELKESWGSIWRVDTPDKLTGPFTVRY 236
Query  231  VSESGQTVIAHQVIPANWRANTNYGSK 257
             +E G    A  VIP  W+A+T Y SK
Sbjct  237  TTEGGTKGEAEDVIPEGWKADTAYASK 263

Sequence Alignment: 16. Allergen Name: Hol l 1 Sequence ID: CAA10140

 Score = 210.4 bits 894,  Expect = 5e-56
 Identities = 128/249 51%, Positives = 179/249 71%, Gaps = 18/249 7%
Query  4    ASAKVVAMLLSVLATY-GFAAGVV-----------YTNDWLPAKATWYGQPNGAGPDDNG 51
            AS+ +V ++++++A + G A G+            Y + WL AK+TWYG+P GAGP DNG
Sbjct  2    ASSSLVLLVVALFAVFLGTAHGIAKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDNG 61
Query  52   GACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACYQIRCTNNPSCSGQPRTVIITDMNYY 111
            GACG+K+ ++ PF  MT CGN P+F+ G+GCG+C++I+CT   SCSG+P  V ITD N  
Sbjct  62   GACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPESCSGEPIVVHITDDNEE 121
Query  112  PVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQFRRVPC-YHRGLYVNFHVEAGSNPV 170
            P+A YH+DLSG AFGAMA+ G   +LR AG ++++FRRV C Y +G  V FHVE GSNP 
Sbjct  122  PIAAYHLDLSGKAFGAMAKKGEEQKLRSAGELELKFRRVKCEYPKGTKVTFHVEKGSNPN 181
Query  171  YLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTPMRRSWGSIWRLDANHRLQGPXSLRM 230
            YLA+LV++ + DG VV +D+ E    GK    W  ++ SWG++WR+D   +L GP ++R 
Sbjct  182  YLALLVKYVDGDGDVVAVDIKEK---GKDK--WIELKESWGAVWRVDTPDKLTGPFTVRY 236
Query  231  VSESGQTVIAHQVIPANWRANTNYGSK 257
             +E G  V A  VIP  W+A+T Y SK
Sbjct  237  TTEGGTKVEAEDVIPEGWKADTAYESK 263

Sequence Alignment: 17. Allergen Name: Cyn d 1.0203 Sequence ID: AAL14079

 Score = 209.3 bits 889,  Expect = 1e-55
 Identities = 129/255 50%, Positives = 174/255 68%, Gaps = 11/255 4%
Query  1    MAGASAKVVAMLLSVLATYGFAAG----VVYTNDWLPAKATWYGQ-PNGAGPDDNGGACG 55
            +A  +  + +M+   L   G   G      Y + WL AKAT+YG  P GA PDD+GGACG
Sbjct  2    LAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACG 61
Query  56   FKNTNQYPFMSMTSCGNEPLFQDGKGCGACYQIRCTNNPSCSGQPRTVIITDMNYYPVAR 115
            +K+ ++ PF SMT CGNEP+F+DG GCG+CY+I+C     CSG+P  + ITD NY  +A 
Sbjct  62   YKDVDKAPFDSMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAA 121
Query  116  YHFDLSGTAFGAMARPGLNDQLRHAGIIDIQFRRVPC-YHRGLYVNFHVEAGSNPVYLAV 174
            YHFDLSG AFGAMA+ G  D+LR AG + +QFRRV C Y     + FHVE GSNP YLA+
Sbjct  122  YHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLAL 181
Query  175  LVEFANKDGTVVQLDVMESLPSGKPTRVWTPMRRSWGSIWRLDANHRLQGPXSLRMVSES 234
            LV++A  DG +V +D+       K +  + PM++SWG+IWR+D    L+GP ++R+ SES
Sbjct  182  LVKYAAGDGNIVSVDI-----KSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSES 236
Query  235  GQTVIAHQVIPANWRANTNYGSKVQF 260
            G  V    VIP +W+ +T Y SK+QF
Sbjct  237  GGHVEQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 18. Allergen Name: Uro m 1.0101 Sequence ID: A0A4D6FZ45

 Score = 209.3 bits 889,  Expect = 1e-55
 Identities = 129/255 50%, Positives = 174/255 68%, Gaps = 11/255 4%
Query  1    MAGASAKVVAMLLSVLATYGFAAG----VVYTNDWLPAKATWYGQ-PNGAGPDDNGGACG 55
            +A  +  + +M+   L   G   G      Y + WL AKAT+YG  P GA PDD+GGACG
Sbjct  2    LAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACG 61
Query  56   FKNTNQYPFMSMTSCGNEPLFQDGKGCGACYQIRCTNNPSCSGQPRTVIITDMNYYPVAR 115
            +K+ ++ PF SMT CGNEP+F+DG GCG+CY+I+C     CSG+P  + ITD NY  +A 
Sbjct  62   YKDVDKAPFDSMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAA 121
Query  116  YHFDLSGTAFGAMARPGLNDQLRHAGIIDIQFRRVPC-YHRGLYVNFHVEAGSNPVYLAV 174
            YHFDLSG AFGAMA+ G  D+LR AG + +QFRRV C Y     + FHVE GSNP YLA+
Sbjct  122  YHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLAL 181
Query  175  LVEFANKDGTVVQLDVMESLPSGKPTRVWTPMRRSWGSIWRLDANHRLQGPXSLRMVSES 234
            LV++A  DG +V +D+       K +  + PM++SWG+IWR+D    L+GP ++R+ SES
Sbjct  182  LVKYAAGDGNIVSVDI-----KSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSES 236
Query  235  GQTVIAHQVIPANWRANTNYGSKVQF 260
            G  V    VIP +W+ +T Y SK+QF
Sbjct  237  GGHVEQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 19. Allergen Name: Hol l 1 Sequence ID: P43216

 Score = 208.4 bits 885,  Expect = 2e-55
 Identities = 128/252 50%, Positives = 179/252 71%, Gaps = 18/252 7%
Query  1    MAGASAKVVAMLLSVLATY-GFAAGVV-----------YTNDWLPAKATWYGQPNGAGPD 48
            MA +S  V+ ++ +++A + G A G+            Y ++WL AK+TWYG+P GAGP 
Sbjct  1    MASSSRSVLLLVAALFAVFLGSAHGIAKVPPGPNITATYGDEWLDAKSTWYGKPTGAGPK 60
Query  49   DNGGACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACYQIRCTNNPSCSGQPRTVIITDM 108
            DNGGACG+K+ ++ PF  MT CGN P+F+DG+GCG+C++I+CT   SCSG+P TV ITD 
Sbjct  61   DNGGACGYKDVDKPPFSGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEPVTVHITDD 120
Query  109  NYYPVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQFRRVPC-YHRGLYVNFHVEAGS 167
            N  P+A YHFDLSG AFG+MA+ G   +LR AG ++++FRRV C Y  G    FHVE GS
Sbjct  121  NEEPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELKFRRVKCKYPDGTKPTFHVEKGS 180
Query  168  NPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTPMRRSWGSIWRLDANHRLQGPXS 227
            NP YLA+LV++ + DG VV +D+ E    GK    W  ++ SWG++WR+D   +L GP +
Sbjct  181  NPNYLALLVKYIDGDGDVVAVDIKEK---GKDK--WIELKESWGAVWRVDTPDKLTGPFT 235
Query  228  LRMVSESGQTVIAHQVIPANWRANTNYGSK 257
            +R  +E G    A  VIP  W+A+T Y +K
Sbjct  236  VRYTTEGGTKGEAEDVIPEGWKADTAYEAK 265

Sequence Alignment: 20. Allergen Name: Phl p 1.0101 Sequence ID: CAA81613

 Score = 208.1 bits 884,  Expect = 2e-55
 Identities = 129/249 51%, Positives = 174/249 69%, Gaps = 18/249 7%
Query  4    ASAKVVAMLLSVLATY-GFAAGV-----------VYTNDWLPAKATWYGQPNGAGPDDNG 51
            AS+  V ++++++A + G A G+            Y + WL AK+TWYG+P  AGP DNG
Sbjct  2    ASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYGKPTAAGPKDNG 61
Query  52   GACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACYQIRCTNNPSCSGQPRTVIITDMNYY 111
            GACG+K+ ++ PF  MT CGN P+F+ G+GCG+C++I+CT   +CSG+P  V ITD N  
Sbjct  62   GACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEE 121
Query  112  PVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQFRRVPC-YHRGLYVNFHVEAGSNPV 170
            P+A YHFDLSG AFG+MA+ G   +LR AG ++IQFRRV C Y  G  V FHVE GSNP 
Sbjct  122  PIAAYHFDLSGIAFGSMAKKGDEQKLRSAGEVEIQFRRVKCKYPEGTKVTFHVEKGSNPN 181
Query  171  YLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTPMRRSWGSIWRLDANHRLQGPXSLRM 230
            YLA+LV+F   DG VV +D+ E    GK    W  ++ SWG+IWR+D    L+GP ++R 
Sbjct  182  YLALLVKFVAGDGDVVAVDIKEK---GKDK--WIALKESWGAIWRIDTPEVLKGPFTVRY 236
Query  231  VSESGQTVIAHQVIPANWRANTNYGSK 257
             +E G    A  VIP  W+A+T Y SK
Sbjct  237  TTEGGTKGEAKDVIPEGWKADTAYESK 263

Sequence Alignment: 21. Allergen Name: Hol l 1.0102 Sequence ID: CAA93121

 Score = 207.7 bits 882,  Expect = 3e-55
 Identities = 119/226 52%, Positives = 162/226 71%, Gaps = 6/226 2%
Query  27   YTNDWLPAKATWYGQPNGAGPDDNGGACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACY 86
            Y ++WL AK+TWYG+P GAGP DNGGACG+K+ ++ PF  MT CGN P+F+DG+GCG+C+
Sbjct  22   YGDEWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKDGRGCGSCF 81
Query  87   QIRCTNNPSCSGQPRTVIITDMNYYPVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQ 146
            +I+C+   SCSG+P TV ITD N  P+A YHFDLSG AFG+MA+ G   +LR AG ++++
Sbjct  82   EIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELK 141
Query  147  FRRVPC-YHRGLYVNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTP 205
            FRRV C Y  G    FHVE GSNP YLA+LV++ + DG VV +D+ E    GK    W  
Sbjct  142  FRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDIKE---KGKDK--WIE 196
Query  206  MRRSWGSIWRLDANHRLQGPXSLRMVSESGQTVIAHQVIPANWRANTNYGSK 257
            ++ SWG++WR+D   +L GP ++R  +E G    A  VIP  W+A+T Y +K
Sbjct  197  LKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYEAK 248

Sequence Alignment: 22. Allergen Name: Cyn d 1 Sequence ID: AAL14078

 Score = 207.7 bits 882,  Expect = 3e-55
 Identities = 132/255 51%, Positives = 174/255 68%, Gaps = 12/255 4%
Query  1    MAGASAKVVA-MLLSVLATYGFAAG----VVYTNDWLPAKATWYGQ-PNGAGPDDNGGAC 54
            M  A A V+A M+       G   G      Y + WL AKAT+YG  P GA PDD+GGAC
Sbjct  1    MLAAVAVVLASMVGGAWCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGAC 60
Query  55   GFKNTNQYPFMSMTSCGNEPLFQDGKGCGACYQIRCTNNPSCSGQPRTVIITDMNYYPVA 114
            G+K+ ++ PF  MT CGNEP+F+DG GCG+CY+I+C     CSG+P  + ITD NY  +A
Sbjct  61   GYKDVDKAPFDGMTGCGNEPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIA 120
Query  115  RYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQFRRVPC-YHRGLYVNFHVEAGSNPVYLA 173
             YHFDLSG AFGAMA+ G  D+LR AG + +QFRRV C Y     + FHVE GS+P YLA
Sbjct  121  AYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLA 180
Query  174  VLVEFANKDGTVVQLDVMESLPSGKPTRVWTPMRRSWGSIWRLDANHRLQGPXSLRMVSE 233
            +LV++A  DG +V +D+    P G  + V+ PM+ SWG+IWR+D    L+GP ++R+ SE
Sbjct  181  LLVKYAAGDGNIVGVDIK---PKG--SDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSE 235
Query  234  SGQTVIAHQVIPANWRANTNYGSKVQF 260
            SG  V    VIP +W+ +T Y SK+QF
Sbjct  236  SGGHVEQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 23. Allergen Name: Lol p 1.0103 Sequence ID: CAB63699

 Score = 207.0 bits 879,  Expect = 5e-55
 Identities = 125/249 50%, Positives = 175/249 70%, Gaps = 18/249 7%
Query  4    ASAKVVAMLLSVLATY-GFAAGVV-----------YTNDWLPAKATWYGQPNGAGPDDNG 51
            AS+  V ++++++A + G A G+            Y + WL AK+TWYG+P GAGP DNG
Sbjct  2    ASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNG 61
Query  52   GACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACYQIRCTNNPSCSGQPRTVIITDMNYY 111
            GACG+K+ ++ PF  MT CGN P+F+DG+GCG+C++I+CT   SCSG+  TV ITD N  
Sbjct  62   GACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEE 121
Query  112  PVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQFRRVPC-YHRGLYVNFHVEAGSNPV 170
            P+A YHFDLSG AFG+MA+ G   +LR AG +++QFRRV C Y  G    FHVE  SNP 
Sbjct  122  PIAPYHFDLSGHAFGSMAKKGEEQKLRSAGELELQFRRVKCKYPDGTKPTFHVEKASNPN 181
Query  171  YLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTPMRRSWGSIWRLDANHRLQGPXSLRM 230
            YLA+LV++ + DG VV +D+ E    GK    W  ++ SWG++WR+D   +L GP ++R 
Sbjct  182  YLAILVKYVDGDGDVVAVDIKEK---GKDK--WIELKESWGAVWRIDTPDKLTGPFTVRY 236
Query  231  VSESGQTVIAHQVIPANWRANTNYGSK 257
             +E G       VIP  W+A+T+Y +K
Sbjct  237  TTEGGTKSEVEDVIPEGWKADTSYSAK 263

Sequence Alignment: 24. Allergen Name: Cyn d 1.0202 Sequence ID: AAL14077

 Score = 206.3 bits 876,  Expect = 9e-55
 Identities = 127/255 49%, Positives = 172/255 67%, Gaps = 11/255 4%
Query  1    MAGASAKVVAMLLSVLATYGFAAG----VVYTNDWLPAKATWYGQ-PNGAGPDDNGGACG 55
            +A  +  + +M+   L   G   G      Y + WL AKAT+YG  P GA PDD+GGACG
Sbjct  2    LAVVAVVLASMVGGALCAMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACG 61
Query  56   FKNTNQYPFMSMTSCGNEPLFQDGKGCGACYQIRCTNNPSCSGQPRTVIITDMNYYPVAR 115
            +K+ ++ PF  MT CGNEP+F+DG  CG+CY+I+C     CSG+P  + ITD NY  +A 
Sbjct  62   YKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAA 121
Query  116  YHFDLSGTAFGAMARPGLNDQLRHAGIIDIQFRRVPC-YHRGLYVNFHVEAGSNPVYLAV 174
            YHFDLSG AFGAMA+ G  D+LR AG + +QFRRV C Y     + FHVE GSNP YLA+
Sbjct  122  YHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLAL 181
Query  175  LVEFANKDGTVVQLDVMESLPSGKPTRVWTPMRRSWGSIWRLDANHRLQGPXSLRMVSES 234
            LV++A  DG +V +D+       K +  + PM++SWG+IWR+D    L+GP ++R+ SES
Sbjct  182  LVKYAAGDGNIVSVDI-----KSKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSES 236
Query  235  GQTVIAHQVIPANWRANTNYGSKVQF 260
            G  V    VIP +W+ +T Y SK+QF
Sbjct  237  GGHVEQEDVIPEDWKPDTVYKSKIQF 262

Sequence Alignment: 25. Allergen Name: Cyn d 1 Sequence ID: O04701

 Score = 206.1 bits 875,  Expect = 9e-55
 Identities = 123/229 53%, Positives = 164/229 71%, Gaps = 7/229 3%
Query  27   YTNDWLPAKATWYGQ-PNGAGPDDNGGACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGAC 85
            Y + WL A+AT+YG  P GA PDD+GGACG+K+ ++ PF  MT+CGNEP+F+DG GC AC
Sbjct  14   YGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGNEPIFKDGLGCRAC 73
Query  86   YQIRCTNNPSCSGQPRTVIITDMNYYPVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDI 145
            Y+I+C     CSG+P  V ITD NY  +A YHFDLSG AFGAMA+ G  D+LR AG + +
Sbjct  74   YEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKGQEDKLRKAGELTL 133
Query  146  QFRRVPC-YHRGLYVNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWT 204
            QFRRV C Y  G  + FH+E GSN  YLA+LV++A  DG +V +D+    P  + +  + 
Sbjct  134  QFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIK---P--RDSDEFI 188
Query  205  PMRRSWGSIWRLDANHRLQGPXSLRMVSESGQTVIAHQVIPANWRANTNYGSKVQF 260
            PM+ SWG+IWR+D    L+GP S+R+ SE G  ++   VIPANW+ +T Y SK+QF
Sbjct  189  PMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSKLQF 244

Sequence Alignment: 26. Allergen Name: Zoy m 1.0101 Sequence ID: QCX36431

 Score = 206.1 bits 875,  Expect = 1e-54
 Identities = 126/255 49%, Positives = 169/255 66%, Gaps = 11/255 4%
Query  1    MAGASAKVVAMLLSVLATYGFAAG----VVYTNDWLPAKATWYGQ-PNGAGPDDNGGACG 55
            +A  +  + AM+ S L   G   G      Y  +W  AKAT+YG  P GA PDD+GGACG
Sbjct  12   LAAVAVLLSAMVGSALCEIGDKPGPNITATYNEEWQDAKATFYGSNPRGAAPDDDGGACG 71
Query  56   FKNTNQYPFMSMTSCGNEPLFQDGKGCGACYQIRCTNNPSCSGQPRTVIITDMNYYPVAR 115
            +KN ++ PF  MT CGNEP+F+DG GCG+C++I+C     CS +P  + ITD NY  +A 
Sbjct  72   YKNVDKAPFFGMTGCGNEPIFKDGLGCGSCFEIKCKEPAECSDKPVLIRITDKNYEHIAA 131
Query  116  YHFDLSGTAFGAMARPGLNDQLRHAGIIDIQFRRVPC-YHRGLYVNFHVEAGSNPVYLAV 174
            YHFDLSG AFG+MA+ G  D LR AG + +QFRRV C Y     + FHVE G N  YLA+
Sbjct  132  YHFDLSGKAFGSMAKQGQEDNLRKAGELTLQFRRVKCEYPSKTKITFHVEKGCNDNYLAL 191
Query  175  LVEFANKDGTVVQLDVMESLPSGKPTRVWTPMRRSWGSIWRLDANHRLQGPXSLRMVSES 234
            LVE+A  DG +V +D+    P G     + PM+ SWG+IWR+D    L+GP ++R+ SES
Sbjct  192  LVEYAAGDGDIVAVDIK---PKGSDE--FLPMKPSWGAIWRIDPKKPLKGPFTVRLTSES 246
Query  235  GQTVIAHQVIPANWRANTNYGSKVQF 260
            G  ++   VIPA+W+ NT Y S +Q+
Sbjct  247  GAKLVQEDVIPADWKPNTAYTSNLQY 272

Sequence Alignment: 27. Allergen Name: Pha a 1 Sequence ID: Q41260

 Score = 205.6 bits 873,  Expect = 1e-54
 Identities = 128/249 51%, Positives = 175/249 70%, Gaps = 19/249 7%
Query  2    AGASAKVVAMLLSVLATYGFAAGVV-----------YTNDWLPAKATWYGQPNGAGPDDN 50
            + +S  VVA LL+V+   G A G+            Y + WL AK+TWYG+P GAGP DN
Sbjct  9    SSSSLLVVAALLAVFV--GSAQGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDN 66
Query  51   GGACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACYQIRCTNNPSCSGQPRTVIITDMNY 110
            GGACG+K+ ++ PF  MT CGN P+F+DG+GCG+C++++C+   SCSG+P TV ITD N 
Sbjct  67   GGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCFELKCSKPESCSGEPITVHITDDNE 126
Query  111  YPVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQFRRVPC-YHRGLYVNFHVEAGSNP 169
             P+A YHFDLSG AFG+MA+ G  + +R AG +++QFRRV C Y  G    FHVE GSNP
Sbjct  127  EPIAPYHFDLSGHAFGSMAKKGEEENVRGAGELELQFRRVKCKYPDGTKPTFHVEKGSNP 186
Query  170  VYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTPMRRSWGSIWRLDANHRLQGPXSLR 229
             YLA+LV++ + DG VV +D+ E    GK    W  ++ SWG+IWR+D   +L GP ++R
Sbjct  187  NYLALLVKYVDGDGDVVAVDIKEK---GKDK--WIELKESWGAIWRIDTPDKLTGPFTVR 241
Query  230  MVSESGQTVIAHQVIPANWRANTNYGSK 257
              +E G       VIP  W+A+T+  SK
Sbjct  242  YTTEGGTKAEFEDVIPEGWKADTHDASK 269

Sequence Alignment: 28. Allergen Name: Lol p 1.0102 Sequence ID: AAA63278

 Score = 205.4 bits 872,  Expect = 2e-54
 Identities = 117/226 51%, Positives = 158/226 69%, Gaps = 6/226 2%
Query  27   YTNDWLPAKATWYGQPNGAGPDDNGGACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACY 86
            Y + WL AK+TWYG+P GAGP DNGGACG+K+ ++ PF  MT CGN P+F+DG+GCG+C+
Sbjct  26   YGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKAPFNGMTGCGNTPIFKDGRGCGSCF 85
Query  87   QIRCTNNPSCSGQPRTVIITDMNYYPVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQ 146
            +I+CT   SCSG+  TV ITD N  P+A YHFDLSG AFG+MA+ G    +R AG +++Q
Sbjct  86   EIKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQ 145
Query  147  FRRVPC-YHRGLYVNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTP 205
            FRRV C Y       FHVE GSNP YLA+LV++ + DG VV +D+ E    GK    W  
Sbjct  146  FRRVKCKYPDDTKPTFHVEKGSNPNYLAILVKYVDGDGDVVAVDIKE---KGKDK--WIE 200
Query  206  MRRSWGSIWRLDANHRLQGPXSLRMVSESGQTVIAHQVIPANWRANTNYGSK 257
            ++ SWG++WR+D   +L GP ++R  +E G       VIP  W+A+T+Y +K
Sbjct  201  LKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVEDVIPEGWKADTSYSAK 252

Sequence Alignment: 29. Allergen Name: Lol p 1.0101 Sequence ID: AAA63279

 Score = 205.4 bits 872,  Expect = 2e-54
 Identities = 125/249 50%, Positives = 174/249 69%, Gaps = 18/249 7%
Query  4    ASAKVVAMLLSVLATY-GFAAGVV-----------YTNDWLPAKATWYGQPNGAGPDDNG 51
            AS+  V ++++++A + G A G+            Y + WL AK+TWYG+P GAGP DNG
Sbjct  2    ASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNG 61
Query  52   GACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACYQIRCTNNPSCSGQPRTVIITDMNYY 111
            GACG+KN ++ PF  MT CGN P+F+DG+GCG+C++I+CT   SCSG+  TV ITD N  
Sbjct  62   GACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEE 121
Query  112  PVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQFRRVPC-YHRGLYVNFHVEAGSNPV 170
            P+A YHFDLSG AFG+MA+ G    +R AG +++QFRRV C Y       FHVE  SNP 
Sbjct  122  PIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNPN 181
Query  171  YLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTPMRRSWGSIWRLDANHRLQGPXSLRM 230
            YLA+LV++ + DG VV +D+ E    GK    WT ++ SWG++WR+D   +L GP ++R 
Sbjct  182  YLAILVKYVDGDGDVVAVDIKEK---GKDK--WTELKESWGAVWRIDTPDKLTGPFTVRY 236
Query  231  VSESGQTVIAHQVIPANWRANTNYGSK 257
             +E G       VIP  W+A+T+Y +K
Sbjct  237  TTEGGTKSEFEDVIPEGWKADTSYSAK 263

Sequence Alignment: 30. Allergen Name: Cyn d 1.0204 Sequence ID: AAF80379

 Score = 204.5 bits 868,  Expect = 3e-54
 Identities = 122/229 53%, Positives = 162/229 70%, Gaps = 7/229 3%
Query  27   YTNDWLPAKATWYGQ-PNGAGPDDNGGACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGAC 85
            Y + WL AKAT+YG  P GA PDD+GGACG+K+ ++ PF  MT CGNEP+F+DG  CG+C
Sbjct  14   YGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSC 73
Query  86   YQIRCTNNPSCSGQPRTVIITDMNYYPVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDI 145
            Y+I+C     CSG+P  + ITD NY  +A YHFDLSG AFGAMA+ G  D+LR AG + +
Sbjct  74   YEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELML 133
Query  146  QFRRVPC-YHRGLYVNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWT 204
            QFRRV C Y     + FHVE GS+P YLA+LV++A  DG +V +D+    P G     + 
Sbjct  134  QFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIK---PKGSDE--FL 188
Query  205  PMRRSWGSIWRLDANHRLQGPXSLRMVSESGQTVIAHQVIPANWRANTNYGSKVQF 260
            PM++SWG+IWR+D    L+GP ++R+ SESG  V    VIP +W+ +T Y SK+QF
Sbjct  189  PMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF 244

Sequence Alignment: 31. Allergen Name: Cyn d 1.0201 Sequence ID: AAK96255

 Score = 204.3 bits 867,  Expect = 3e-54
 Identities = 122/229 53%, Positives = 162/229 70%, Gaps = 7/229 3%
Query  27   YTNDWLPAKATWYGQ-PNGAGPDDNGGACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGAC 85
            Y + WL AKAT+YG  P GA PDD+GGACG+K+ ++ PF  MT CGNEP+F+DG  CG+C
Sbjct  14   YGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSC 73
Query  86   YQIRCTNNPSCSGQPRTVIITDMNYYPVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDI 145
            Y+I+C     CSG+P  + ITD NY  +A YHFDLSG AFGAMA+ G  D+LR AG + +
Sbjct  74   YEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELML 133
Query  146  QFRRVPC-YHRGLYVNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWT 204
            QFRRV C Y     + FHVE GS+P YLA+LV++A  DG +V +D+    P G     + 
Sbjct  134  QFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIK---PKGSDE--FL 188
Query  205  PMRRSWGSIWRLDANHRLQGPXSLRMVSESGQTVIAHQVIPANWRANTNYGSKVQF 260
            PM++SWG+IWR+D    L+GP ++R+ SESG  V    VIP +W+ +T Y SK+QF
Sbjct  189  PMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF 244

Sequence Alignment: 32. Allergen Name: Lol p 1 Sequence ID: P14946

 Score = 204.0 bits 866,  Expect = 4e-54
 Identities = 124/249 49%, Positives = 173/249 69%, Gaps = 18/249 7%
Query  4    ASAKVVAMLLSVLATY-GFAAGVV-----------YTNDWLPAKATWYGQPNGAGPDDNG 51
            AS+  V ++++++A + G A G+            Y + WL AK+TWYG+P GAGP DNG
Sbjct  2    ASSSSVLLVVALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNG 61
Query  52   GACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACYQIRCTNNPSCSGQPRTVIITDMNYY 111
            GACG+KN ++ PF  MT CGN P+F+DG+GCG+C++I+CT   SCSG+  TV ITD N  
Sbjct  62   GACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEE 121
Query  112  PVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQFRRVPC-YHRGLYVNFHVEAGSNPV 170
            P+A YHFDLSG AFG+MA+ G    +R AG +++QFRRV C Y       FHVE  SNP 
Sbjct  122  PIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNPN 181
Query  171  YLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTPMRRSWGSIWRLDANHRLQGPXSLRM 230
            YLA+LV++ + DG VV +D+ E    GK    W  ++ SWG++WR+D   +L GP ++R 
Sbjct  182  YLAILVKYVDGDGDVVAVDIKEK---GKDK--WIELKESWGAVWRIDTPDKLTGPFTVRY 236
Query  231  VSESGQTVIAHQVIPANWRANTNYGSK 257
             +E G       VIP  W+A+T+Y +K
Sbjct  237  TTEGGTKSEFEDVIPEGWKADTSYSAK 263

Sequence Alignment: 33. Allergen Name: Sor h 1.0101 Sequence ID: ABC58726

 Score = 197.0 bits 835,  Expect = 5e-52
 Identities = 117/224 52%, Positives = 161/224 71%, Gaps = 9/224 4%
Query  27   YTNDWLPAKATWYGQPNGAGPDDNGGACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACY 86
            Y +DWL  KATWYG+P GAGPDDNGGACG+K+ N+ PF SM +CGN P+F+DG  CG+C+
Sbjct  14   YGSDWLERKATWYGKPTGAGPDDNGGACGYKDVNKAPFNSMGACGNLPIFKDGL-CGSCF 72
Query  87   QIRCTN-NPS-CSGQPRTVIITDMNYYPVARYHFDLSGTAFGAMARPGLNDQLRHAGIID 144
            +I+C    P+ CSG+   V ITDMNY  +A YHFDL+G AFGAMA+ G  ++L  AGIID
Sbjct  73   EIKCDKPKPAECSGEAVVVHITDMNYEQIAAYHFDLAGHAFGAMAKKGQEEKLAKAGIID 132
Query  145  IQFRRVPCYHRGLYVNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWT 204
            ++FRRV C + G  V FHVE GSNP YLA+LV++ + DG +V +D+ E     K    + 
Sbjct  133  MKFRRVKCKY-GEKVTFHVEKGSNPNYLALLVKYVDGDGDIVGVDIKE-----KGGDAYQ 186
Query  205  PMRRSWGSIWRLDANHRLQGPXSLRMVSESGQTVIAHQVIPANWRANTNYGSK 257
            P++ SWG+IWR D+   ++ P ++++ +E G       VIP  W+A+T Y +K
Sbjct  187  PLKHSWGAIWRKDSPDPIKFPVTVQITTEGGTKTAYDDVIPEGWKADTTYTAK 239

Sequence Alignment: 34. Allergen Name: Zea m 1 Sequence ID: Q07154

 Score = 195.5 bits 828,  Expect = 1e-51
 Identities = 110/189 58%, Positives = 143/189 75%, Gaps = 6/189 3%
Query  67   MTSCGNEPLFQDGKGCGACYQIRCTNNPSCSGQPRTVIITDMNYYPVARYHFDLSGTAFG 126
            MT+CGN P+F+DGKGCG+CY++RC   P CSG P TV ITDMNY P+A YHFDLSG AFG
Sbjct  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEPIAPYHFDLSGKAFG 60
Query  127  AMARPGLNDQLRHAGIIDIQFRRVPC-YHRGLYVNFHVEAGSNPVYLAVLVEFANKDGTV 185
            ++A+PGLND+LRH GI+D++FRRV C Y  G  + FH+E G NP Y+AVLV+F   DG +
Sbjct  61   SLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGDI 120
Query  186  VQLDVMESLPSGKPTRVWTPMRRSWGSIWRLDANHRLQGPXSLRMVSESGQTVIAHQVIP 245
            V +++ + L     +  W PM+ SWG+IWR+D    L+GP S+R+ SESG+ VIA  +IP
Sbjct  121  VLMEIQDKL-----SAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIP 175
Query  246  ANWRANTNYGSKVQF 260
            ANWR +  Y S VQF
Sbjct  176  ANWRPDAVYTSNVQF 190

Sequence Alignment: 35. Allergen Name: Gly m 2 Sequence ID: AAA50175

 Score = 181.2 bits 766,  Expect = 3e-47
 Identities = 110/227 48%, Positives = 157/227 69%, Gaps = 10/227 4%
Query  28   TNDWLPAKATWYGQPNGAGPDDNGGACGFKNT-NQYPFMSMTSCGNEPLFQDGKGCGACY 86
            ++DW PA ATWYG  NG G +  GGACG+ N   Q PF S+ S G+  ++  GKGCG+CY
Sbjct  45   SSDWSPAVATWYGPANGDGSE--GGACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCY 102
Query  87   QIRCTNNPSCSGQPRTVIITD--MNYYPVARYHFDLSGTAFGAMARPGLNDQLRHAGIID 144
            +++CT N +CSG P  V+ITD        A+YHFDLSG AFGAMA  G ++ LR+AG I+
Sbjct  103  EVKCTGNSACSGNPVKVVITDECAGCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKIN 162
Query  145  IQFRRVPCYHRGLYVNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWT 204
            IQ RR+ C + G  + FHV++GSN  Y+A LVE+ + DG + ++++ E+L SG     W 
Sbjct  163  IQHRRIECNYPGRSIAFHVDSGSNQEYFATLVEYEDGDGDLAKVELKEALDSGS----WD 218
Query  205  PMRRSWGSIWRLDANHRLQGPXSLRMVS-ESGQTVIAHQVIPANWRANTNYGSKVQF 260
             M++SWG++W++D    L+ P S+++ + ESGQT++A+ VIPA W     Y S V F
Sbjct  219  SMQQSWGAVWKFDKGSPLRAPFSIKLTTLESGQTIVANNVIPAGWTPGQTYRSIVNF 275

Sequence Alignment: 36. Allergen Name: Ory s 1 Sequence ID: AAF72986

 Score = 180.1 bits 761,  Expect = 7e-47
 Identities = 112/223 50%, Positives = 155/223 69%, Gaps = 13/223 5%
Query  31   WLPAKATWYGQPNGAGPDDNGGACGFKNT-NQYPFMSMTSCGNEPLFQDGKGCGACYQIR 89
            W    ATWYG P G G +  GGACG+++   Q PF SM + G   LF++GKGCG+CYQI+
Sbjct  45   WSSGGATWYGGPQGDGSE--GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCYQIK 102
Query  90   CTNNPSCSGQPRTVIITDMNYYPVA---RYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQ 146
            CT N +CSG+P TV+ITD     V      HFD+SGTAFGAMA  G+ D+LR AG++ IQ
Sbjct  103  CTGNRACSGRPVTVVITDSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVLKIQ 162
Query  147  FRRVPCYHRGLYVNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTPM 206
            ++RVPC    + V F V+AGSNP YLA+LV++AN DG +  + +M++   G     W  M
Sbjct  163  YKRVPCRF-AMNVAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGG----WKAM 217
Query  207  RRSWGSIWRLDAN--HRLQGPXSLRMVSESGQTVIAHQVIPANWRANTNYGSKVQF 260
            ++SWG+ WRL++N    L  P S+R+ S SG+ ++A+ VIP+ W+A   Y S V +
Sbjct  218  QQSWGATWRLNSNTGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTYRSTVNY 273

Sequence Alignment: 37. Allergen Name: Ory s 1 Sequence ID: Q40638

 Score = 174.9 bits 738,  Expect = 3e-45
 Identities = 100/211 47%, Positives = 144/211 68%, Gaps = 9/211 4%
Query  27   YTNDWLPAKATWYGQPNGAGPDDNGGACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACY 86
            Y + WL A+     +P    P DNGGACG+K+ ++ PF+ M SCGN+P+F+DGKGCG+C+
Sbjct  37   YGDKWLEARPPGMVRPRVLAPKDNGGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCF 96
Query  87   QIRCTNNPSCSGQPRTVIITDMNYYPVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQ 146
            +I+C+   +CS +P  + +TDMN  P+A YHFDLSG A   MA+ G +++LR AGIID Q
Sbjct  97   EIKCSKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLA---MAKDGKDEELRKAGIIDTQ 153
Query  147  FRRVPC-YHRGLYVNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTP 205
            FRRV C Y     + FH+E  SNP YLA+LV++   DG VV++++ E     K +  W  
Sbjct  154  FRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKE-----KGSEEWKA 208
Query  206  MRRSWGSIWRLDANHRLQGPXSLRMVSESGQTVIAHQVIP 245
            ++ SWG+IWR+D    L+GP S+R+ +E  +   A   IP
Sbjct  209  LKESWGAIWRIDTPKPLKGPFSVRVTTEGARRSSAEDAIP 248

Sequence Alignment: 38. Allergen Name: Ara t expansin Sequence ID: CAB37496

 Score = 103.5 bits 425,  Expect = 8e-24
 Identities = 75/201 37%, Positives = 114/201 56%, Gaps = 15/201 7%
Query  50   NGGACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACYQIRCTNNPSCSGQPRTVIITDMN 109
            + GAC + +     F    +     +++DG GCGAC+Q+RC N   CS +  TVI+TD+N
Sbjct  41   SSGACAYGSMATGFFAGHIAAALPSIYKDGSGCGACFQVRCKNPTLCSSKGTTVIVTDLN 100
Query  110  YYPVARYHFDLSGTAFGAMARP--GLNDQLRHAGIIDIQFRRVPCYHRGLYVNFHVEAGS 167
                 +  + LS  AF AMA+P  G +  L   GI+DI++RRVPC +    +N  VE  S
Sbjct  101  --KTNQTDLVLSSRAFRAMAKPVVGADRDLLKQGIVDIEYRRVPCDYGNKKMNVRVEESS 158
Query  168  -NPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTPMRRSWGSIWRLDANHRLQGPX 226
             NP YLA+ + +      VV + + +   S      W+ M RS G++W  D      G  
Sbjct  159  KNPNYLAIKLLYQGGQTEVVAIYIAQVGSSH-----WSYMTRSHGAVWVTDKVP--NGAL 211
Query  227  SLRMVSESG---QTVIAHQVIPANWRANTNYGSKVQ 259
             +R V  +G   + V +++V+PANW A  +Y + VQ
Sbjct  212  QFRFVVTAGYDGKMVWSQRVLPANWEAGKSYDAGVQ 247

Sequence Alignment: 39. Allergen Name: Ory s 1 Sequence ID: BAA85432

 Score = 93.7 bits 382,  Expect = 8e-21
 Identities = 81/217 37%, Positives = 119/217 54%, Gaps = 34/217 15%
Query  28   TNDWLPAKATWYGQPNGAGPDDNGGACGFKNTNQYPFMSM-TSCGNEPLFQDGKGCGACY 86
            T+DW    AT+YG P+G G DD GGACG+ + +   + S  T+  + PLF DG GCG CY
Sbjct  49   TSDWHDGSATFYGDPSGMG-DDFGGACGYVSNDIVSLYSTKTAALSTPLFADGNGCGQCY 107
Query  87   QIRCTNNPSCS-GQPRTVIITDMN------YYPV--------ARYHFDLSGTAFGAMARP 131
            ++RC  +P C+ G P +V+IT  N      Y P          R+HFD++  +F  +A+ 
Sbjct  108  ELRCVKSPWCNPGSP-SVVITGTNLCPPNWYLPNDDGGWCNPPRHHFDMAPPSFLKLAQ- 165
Query  132  GLNDQLRHAGIIDIQFRRVPCYHRGLYVNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVM 191
                  R AGI+ +Q+RRVPC   G  V F ++   N  +L + V      G V  L V 
Sbjct  166  ------RVAGIVPVQYRRVPCQRTG-GVRFCLQ--GNHYWLLLYVMNVGGAGDVSSLSVK 216
Query  192  ESLPSGKPTRVWTPMRRSWGSIWRLDANHRLQGPXSLRMVSESG--QTVIAHQVIPANWR 249
             S   G     W     +WG  +++ A        ++++ + S   QT+I    I   W 
Sbjct  217  TSGGGG----AWIQAAHNWGITYQVFAALDNSDGLTVKLTTYSTPQQTIIVSDAISPWWI 272
Query  250  ANTNYGSKVQF 260
                Y     F
Sbjct  273  TGLCYQGSNNF 283

Sequence Alignment: 40. Allergen Name: Ory s 1 Sequence ID: AAG13596

 Score = 88.7 bits 360,  Expect = 2e-19
 Identities = 67/203 33%, Positives = 103/203 50%, Gaps = 12/203 5%
Query  50   NGGACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGACYQIRCTNNPSCSGQPRTVIITDMN 109
            N G+CG+ +          +  +  LF+ G GCGAC+Q+RC +   CS     V++TD  
Sbjct  50   NAGSCGYGSLAASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTD-E 108
Query  110  YYPVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDIQFRRVPC-YHRGLYVNFHVEAGSN 168
                 R  + LS  A+ AMARPG+  QLR    +D++++RVPC Y  G  ++  VE  S 
Sbjct  109  ARSTNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKSR 168
Query  169  PVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTPMRRSWGSIWRLDANHRLQGPXSL 228
            P    + + F  + G   Q D++    +   +  W  M R +G  W     +   GP  +
Sbjct  169  PPR-ELSIRFLYQGG---QTDIVAVDVATVGSSNWKFMTRDYGPAW--STAQAPAGPLQF 222
Query  229  RMV---SESGQTVIAH-QVIPANWRANTNYGSKVQ 259
            R+V      G+ V A  +V+P  W A   Y + VQ
Sbjct  223  RVVVTGGYDGKWVWADGEVLPRRWTAGRVYDAGVQ 257

Sequence Alignment: 41. Allergen Name: Poa p 2 Sequence ID: CAA10348

 Score = 46.9 bits 174,  Expect = 4e-07
 Identities = 30/89 33%, Positives = 50/89 56%, Gaps = 7/89 7%
Query  159  VNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTPMRRSWGSIWRLDA 218
            V F VE GSN  +LAVLV++  +  T+ ++++ E    G     W  M +  G +W +D+
Sbjct  30   VTFTVEKGSNEKHLAVLVKY--EGDTMAEVELREH---GSDE--WVAMTKGEGGVWTFDS 82
Query  219  NHRLQGPXSLRMVSESGQTVIAHQVIPANWRANTNY 254
               LQGP ++R ++E G   +   V+P  +     Y
Sbjct  83   EEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 42. Allergen Name: Dac g 2 Sequence ID: CAA10345

 Score = 46.9 bits 174,  Expect = 4e-07
 Identities = 30/89 33%, Positives = 50/89 56%, Gaps = 7/89 7%
Query  159  VNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTPMRRSWGSIWRLDA 218
            V F VE GSN  +LAVLV++  +  T+ ++++ E    G     W  M +  G +W +D+
Sbjct  30   VTFTVEKGSNEKHLAVLVKY--EGDTMAEVELREH---GSDE--WVAMTKGEGGVWTFDS 82
Query  219  NHRLQGPXSLRMVSESGQTVIAHQVIPANWRANTNY 254
               LQGP ++R ++E G   +   V+P  +     Y
Sbjct  83   EEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 43. Allergen Name: Phl p 2 Sequence ID: P43214

 Score = 46.9 bits 174,  Expect = 4e-07
 Identities = 30/89 33%, Positives = 50/89 56%, Gaps = 7/89 7%
Query  159  VNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTPMRRSWGSIWRLDA 218
            V F VE GSN  +LAVLV++  +  T+ ++++ E    G     W  M +  G +W +D+
Sbjct  30   VTFTVEKGSNEKHLAVLVKY--EGDTMAEVELREH---GSDE--WVAMTKGEGGVWTFDS 82
Query  219  NHRLQGPXSLRMVSESGQTVIAHQVIPANWRANTNY 254
               LQGP ++R ++E G   +   V+P  +     Y
Sbjct  83   EEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 44. Allergen Name: Lol p 2 Sequence ID: P14947

 Score = 46.1 bits 169,  Expect = 5e-07
 Identities = 27/90 30%, Positives = 56/90 62%, Gaps = 7/90 7%
Query  159  VNFHVEAGSNPVYLAVLVEFANKDG-TVVQLDVMESLPSGKPTRVWTPMRRSWGSIWRLD 217
            V F VE GS+   LA+ +++ NK+G ++ ++++ E       +  W  ++++   +W + 
Sbjct  4    VEFTVEKGSDEKNLALSIKY-NKEGDSMAEVELKE-----HGSNEWLALKKNGDGVWEIK 57
Query  218  ANHRLQGPXSLRMVSESGQTVIAHQVIPANWRANTNY 254
            ++  L+GP ++R VSE G   +   V+PA+++  T Y
Sbjct  58   SDKPLKGPFNFRFVSEKGMRNVFDDVVPADFKVGTTY 94

Sequence Alignment: 45. Allergen Name: Cyn d 2 Sequence ID: CAA10346

 Score = 45.7 bits 169,  Expect = 9e-07
 Identities = 29/89 32%, Positives = 50/89 56%, Gaps = 7/89 7%
Query  159  VNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTPMRRSWGSIWRLDA 218
            V F VE GSN  +LAVLV++  +  T+ ++++ E    G     W  M +  G +W +D+
Sbjct  30   VTFTVEKGSNEKHLAVLVKY--EGDTMAEVELREH---GSDE--WVAMTKGEGGVWTFDS 82
Query  219  NHRLQGPXSLRMVSESGQTVIAHQVIPANWRANTNY 254
               L+GP ++R ++E G   +   V+P  +     Y
Sbjct  83   EEPLKGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 46. Allergen Name: Dac g 3 Sequence ID: P93124

 Score = 43.6 bits 158,  Expect = 3e-06
 Identities = 24/90 26%, Positives = 51/90 56%, Gaps = 6/90 6%
Query  159  VNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTPMRRSWGSIWRLDA 218
            V F VE GS+P  L + +++     T+ ++++ +       +  W P+ +  G++W + +
Sbjct  3    VTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQ-----HGSEEWEPLTKK-GNLWEVKS 56
Query  219  NHRLQGPXSLRMVSESGQTVIAHQVIPANWRANTNY 254
            +  L GP ++R +S+ G   +  +VIP  ++  T Y
Sbjct  57   SKPLTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTY 92

Sequence Alignment: 47. Allergen Name: Lol p 2 Sequence ID: CAA51775

 Score = 42.7 bits 153,  Expect = 5e-06
 Identities = 22/87 25%, Positives = 51/87 58%, Gaps = 5/87 5%
Query  161  FHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTPMRRSWGSIWRLDANH 220
            F VE GS+   LA+ ++++ +   + ++++ E       +  W  ++++   +W + ++ 
Sbjct  2    FTVEKGSDEKNLALSIKYSKEGDAMAEVELKE-----HGSNEWLALKKNGDGVWEIKSDK 56
Query  221  RLQGPXSLRMVSESGQTVIAHQVIPANWRANT 252
             L+GP ++R VSE G   +   V+PA+++  T
Sbjct  57   PLKGPFNFRFVSEKGMWNVFDDVVPADFKVGT 88

Sequence Alignment: 48. Allergen Name: Cyn d 15 Sequence ID: AAP80171

 Score = 42.4 bits 154,  Expect = 8e-06
 Identities = 35/90 38%, Positives = 59/90 65%, Gaps = 12/90 13%
Query  159  VNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTPMRRSWGSIWRLDA 218
            + FHVE  S+P + A+ ++ + K+  + Q+DV E    G       PM +S G  W +D 
Sbjct  22   IIFHVEE-SSPKF-ALSIKDSAKE--ITQVDVREH---GADN--MDPMTKS-GDSWTIDK 71
Query  219  NHRLQGPXSLRMVSESGQTVIAHQVIPANWRANTNYGSKVQF 260
               L+GP ++R+ +E G + +   VIP NW+A T+Y +K++F
Sbjct  72   P--LKGPLNIRLRAEGGGSRVQDDVIPENWKAGTDYPTKLHF 111

Sequence Alignment: 49. Allergen Name: Phl p 3.0101 Sequence ID: 2JNZ_A

 Score = 40.4 bits 145,  Expect = 3e-05
 Identities = 23/96 23%, Positives = 53/96 55%, Gaps = 8/96 8%
Query  153  YHRG--LYVNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTPMRRSW 210
            +H G  + V F V+ GS+P  L + +++     ++ ++++ +       +  W P+ +  
Sbjct  7    HHHGSAVQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQ-----HGSEEWEPLTKK- 60
Query  211  GSIWRLDANHRLQGPXSLRMVSESGQTVIAHQVIPANWRANTNY 254
            G++W + ++  L GP ++R +S+ G   +  +VIP  +     Y
Sbjct  61   GNVWEVKSSKPLVGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTY 104

Sequence Alignment: 50. Allergen Name: Dac g 1.0101 Sequence ID: Q7M1X8

 Score = 37.8 bits 117,  Expect = 6e-05
 Identities = 14/21 66%, Positives = 17/21 80%, Gaps = 0/21 0%
Query  27   YTNDWLPAKATWYGQPNGAGP 47
            Y + WL AK+TWYG+P GAGP
Sbjct  14   YGDKWLDAKSTWYGKPTGAGP 34

Sequence Alignment: 51. Allergen Name: Lol p 3 Sequence ID: P14948

 Score = 38.1 bits 134,  Expect = 0.0001
 Identities = 22/90 24%, Positives = 48/90 53%, Gaps = 6/90 6%
Query  159  VNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTPMRRSWGSIWRLDA 218
            V++ VE GS+   L + +++     T+ ++++ +       +  W PM +  G++W + +
Sbjct  3    VDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQ-----HGSEEWEPMTKK-GNLWEVKS 56
Query  219  NHRLQGPXSLRMVSESGQTVIAHQVIPANWRANTNY 254
               L GP ++R +S+ G   +  +VIP  +     Y
Sbjct  57   AKPLTGPMNFRFLSKGGMKNVFDEVIPTAFTVGKTY 92

Sequence Alignment: 52. Allergen Name: Ant o 1.0101 Sequence ID: Q7M1X6

 Score = 33.6 bits 99,  Expect = 0.001
 Identities = 12/19 63%, Positives = 15/19 78%, Gaps = 0/19 0%
Query  27   YTNDWLPAKATWYGQPNGA 45
            Y + WL AK+TWYG+P GA
Sbjct  14   YGDKWLDAKSTWYGKPTGA 32

Sequence Alignment: 53. Allergen Name: Tri a 3 Sequence ID: CAA90746

 Score = 33.9 bits 117,  Expect = 0.003
 Identities = 19/90 21%, Positives = 50/90 55%, Gaps = 6/90 6%
Query  159  VNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWTPMRRSWGSIWRLDA 218
            V + V+ GS+   LA+ +++   + ++ ++++ +    G  +  W P+ +  G +W +  
Sbjct  25   VKLTVQKGSDKKKLALKIDYTRPNDSLSEVELRQY---G--SEEWQPLTKK-GDVWEVSC 78
Query  219  NHRLQGPXSLRMVSESGQTVIAHQVIPANWRANTNY 254
            +  L GP ++R +S++G   +  +V   +++    Y
Sbjct  79   SKPLVGPFNFRFLSKNGMKKVFDEVFSTDFKIGKTY 114

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.