The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAISKIHSRYVYDSRGNPTVEVELTTEKGTFRSIVPSGASTGVHEALELRDGDKSKWLGK
GVLKAVANVNDTIAPALIEANIDVADQAKIDEFLLKLDGTPNKAKLGANAILGVSLAAAK
AGAAQKDVPLYKHIADISKAKEGKFVLPVPFQNVLNGGSHAGGDLAFQEFMIVPSGAPSF
SEGLRIGSEVYHHLKSLTKKKYGQSAGNVGDEGGVAPDIKTAKEALDLIVSAIEAAGYTG
QVDIAMDVASSEFYKDGLYDLDFKNPNSDKSKWITGPQLAELYEQLLNEYPIVSIEDPFA
EDDWEAWSHFFSKVEGKTQIVGDDLTVTNPIRIKKAIETKAADALLLKVNQIGTLTESIQ
AANDSYAAGWGVMVSHRSGETEDTFIADLSVGIRSGQTKTGAPARSERLAKLNQILRIEE
ELGDKAIYAGKDFHKAHSL
Sequence Info Allergen Name Length Opt Bits Score E Value
Q870B9 Rho m 1.0101 439 2818 648.7 1.7e-187
P42040 Cla h 6 440 2174 501.9 2.6e-143
CAA55070 Cla h 6 440 2147 495.7 1.9e-141
AAK49451 Asp f 22.0101 438 2120 489.6 1.3e-139
AAK51201 Pen c 22.0101 438 2118 489.1 1.8e-139
Q9HDT3 Alt a 5 438 2116 488.6 2.5e-139
AAK67491 Cur l 2.0101 440 2016 465.9 1.8e-132
A0A2U9IY94 Cyp c 2.0101 433 1847 427.3 7.1e-121
XP_034156632 Pan h 2.0101 434 1844 426.6 1.1e-120
B5DGQ7 Sal s 2.0101 434 1819 421.0 5.9e-119
P07322 Gal d 9.0101 434 1769 409.6 1.6e-115
A0A1B2H9Q5 Amb a 12.0102 445 1684 390.2 1.1e-109
Q9LEJ0 Hev b 9 445 1673 387.7 6.4e-109
Q9LEI9 Hev b 9 445 1668 386.5 1.4e-108
A0A1B2H9Q1 Amb a 12.0101 431 1599 370.8 7.3e-104
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Rho m 1.0101 Sequence ID: Q870B9

 Score = 648.7 bits 2818,  Expect = 2e-187
 Identities = 439/439 100%, Positives = 439/439 100%, Gaps = 0/439 0%
Query  1    MAISKIHSRYVYDSRGNPTVEVELTTEKGTFRSIVPSGASTGVHEALELRDGDKSKWLGK 60
            MAISKIHSRYVYDSRGNPTVEVELTTEKGTFRSIVPSGASTGVHEALELRDGDKSKWLGK
Sbjct  1    MAISKIHSRYVYDSRGNPTVEVELTTEKGTFRSIVPSGASTGVHEALELRDGDKSKWLGK 60
Query  61   GVLKAVANVNDTIAPALIEANIDVADQAKIDEFLLKLDGTPNKAKLGANAILGVSLAAAK 120
            GVLKAVANVNDTIAPALIEANIDVADQAKIDEFLLKLDGTPNKAKLGANAILGVSLAAAK
Sbjct  61   GVLKAVANVNDTIAPALIEANIDVADQAKIDEFLLKLDGTPNKAKLGANAILGVSLAAAK 120
Query  121  AGAAQKDVPLYKHIADISKAKEGKFVLPVPFQNVLNGGSHAGGDLAFQEFMIVPSGAPSF 180
            AGAAQKDVPLYKHIADISKAKEGKFVLPVPFQNVLNGGSHAGGDLAFQEFMIVPSGAPSF
Sbjct  121  AGAAQKDVPLYKHIADISKAKEGKFVLPVPFQNVLNGGSHAGGDLAFQEFMIVPSGAPSF 180
Query  181  SEGLRIGSEVYHHLKSLTKKKYGQSAGNVGDEGGVAPDIKTAKEALDLIVSAIEAAGYTG 240
            SEGLRIGSEVYHHLKSLTKKKYGQSAGNVGDEGGVAPDIKTAKEALDLIVSAIEAAGYTG
Sbjct  181  SEGLRIGSEVYHHLKSLTKKKYGQSAGNVGDEGGVAPDIKTAKEALDLIVSAIEAAGYTG 240
Query  241  QVDIAMDVASSEFYKDGLYDLDFKNPNSDKSKWITGPQLAELYEQLLNEYPIVSIEDPFA 300
            QVDIAMDVASSEFYKDGLYDLDFKNPNSDKSKWITGPQLAELYEQLLNEYPIVSIEDPFA
Sbjct  241  QVDIAMDVASSEFYKDGLYDLDFKNPNSDKSKWITGPQLAELYEQLLNEYPIVSIEDPFA 300
Query  301  EDDWEAWSHFFSKVEGKTQIVGDDLTVTNPIRIKKAIETKAADALLLKVNQIGTLTESIQ 360
            EDDWEAWSHFFSKVEGKTQIVGDDLTVTNPIRIKKAIETKAADALLLKVNQIGTLTESIQ
Sbjct  301  EDDWEAWSHFFSKVEGKTQIVGDDLTVTNPIRIKKAIETKAADALLLKVNQIGTLTESIQ 360
Query  361  AANDSYAAGWGVMVSHRSGETEDTFIADLSVGIRSGQTKTGAPARSERLAKLNQILRIEE 420
            AANDSYAAGWGVMVSHRSGETEDTFIADLSVGIRSGQTKTGAPARSERLAKLNQILRIEE
Sbjct  361  AANDSYAAGWGVMVSHRSGETEDTFIADLSVGIRSGQTKTGAPARSERLAKLNQILRIEE 420
Query  421  ELGDKAIYAGKDFHKAHSL 439
            ELGDKAIYAGKDFHKAHSL
Sbjct  421  ELGDKAIYAGKDFHKAHSL 439

Sequence Alignment: 2. Allergen Name: Cla h 6 Sequence ID: P42040

 Score = 501.9 bits 2174,  Expect = 3e-143
 Identities = 339/438 77%, Positives = 378/438 86%, Gaps = 3/438 0%
Query  1    MAISKIHSRYVYDSRGNPTVEVELTTEKGTFRSIVPSGASTGVHEALELRDGDKSKWLGK 60
            M ISKIHSRYVYDSRGNPTVEV++ TE G  R+IVPSGASTG HEA ELRDGDKSKW GK
Sbjct  1    MPISKIHSRYVYDSRGNPTVEVDIVTETGLHRAIVPSGASTGSHEACELRDGDKSKWAGK 60
Query  61   GVLKAVANVNDTIAPALIEANIDVADQAKIDEFLLKLDGTPNKAKLGANAILGVSLAAAK 120
            GV KAVANVN+ IAPALI+ N+DV DQA +D FL KLDGT NK K+GANAILGVS+A AK
Sbjct  61   GVTKAVANVNEIIAPALIKENLDVKDQAAVDAFLNKLDGTTNKTKIGANAILGVSMAVAK 120
Query  121  AGAAQKDVPLYKHIADISKAKEGKFVLPVPFQNVLNGGSHAGGDLAFQEFMIVPSGAPSF 180
            A AA+K VPLY HI+D+S  K+  FVLPVPF NV+NGGSHAGG LAFQEFMIVPSGAPSF
Sbjct  121  AAAAEKRVPLYAHISDLSGTKK-PFVLPVPFMNVVNGGSHAGGRLAFQEFMIVPSGAPSF 179
Query  181  SEGLRIGSEVYHHLKSLTKKKYGQSAGNVGDEGGVAPDIKTAKEALDLIVSAIEAAGYTG 240
            +E +R G+EVY+ LKSLTKK+YGQSAGNVGDEGGVAPDI+TA+EALDLI  AIE AGYTG
Sbjct  180  TEAMRQGAEVYQKLKSLTKKRYGQSAGNVGDEGGVAPDIQTAEEALDLITDAIEEAGYTG 239
Query  241  QVDIAMDVASSEFYK--DGLYDLDFKNPNSDKSKWITGPQLAELYEQLLNEYPIVSIEDP 298
            Q+ IAMDVASSEFYK  +  YDLDFKNP+SDKSKWIT  QLA+ Y+QL  +YPIVSIEDP
Sbjct  240  QIKIAMDVASSEFYKADEKKYDLDFKNPDSDKSKWITYEQLADQYKQLAAKYPIVSIEDP 299
Query  299  FAEDDWEAWSHFFSKVEGKTQIVGDDLTVTNPIRIKKAIETKAADALLLKVNQIGTLTES 358
            FAEDDWEAWS+F+       QIVGDDLTVTNP  IKKAIETKA +ALLLKVNQIGT+TE+
Sbjct  300  FAEDDWEAWSYFYKTSGSDFQIVGDDLTVTNPEFIKKAIETKACNALLLKVNQIGTITEA 359
Query  359  IQAANDSYAAGWGVMVSHRSGETEDTFIADLSVGIRSGQTKTGAPARSERLAKLNQILRI 418
            I AA DS+AAGWGVMVSHRSGETED  IAD+ VG+R+GQ KTGAPARSERLAKLNQILRI
Sbjct  360  INAAKDSFAAGWGVMVSHRSGETEDVTIADIVVGLRAGQIKTGAPARSERLAKLNQILRI 419
Query  419  EEELGDKAIYAGKDFHKAHSL 439
            EEELGDKA+YAG +F  A +L
Sbjct  420  EEELGDKAVYAGDNFRTAINL 440

Sequence Alignment: 3. Allergen Name: Cla h 6 Sequence ID: CAA55070

 Score = 495.7 bits 2147,  Expect = 2e-141
 Identities = 336/438 76%, Positives = 375/438 85%, Gaps = 3/438 0%
Query  1    MAISKIHSRYVYDSRGNPTVEVELTTEKGTFRSIVPSGASTGVHEALELRDGDKSKWLGK 60
            M ISKIHSRYVYDSRGNPTVEV++ TE G  R+IVPS ASTG HEA ELRDGDKSKW GK
Sbjct  1    MPISKIHSRYVYDSRGNPTVEVDIVTETGLHRAIVPSVASTGSHEACELRDGDKSKWAGK 60
Query  61   GVLKAVANVNDTIAPALIEANIDVADQAKIDEFLLKLDGTPNKAKLGANAILGVSLAAAK 120
            GV KAVANVN+ IAPALI+ N+DV DQA +D FL KLDGT NK K+GANAILGVS+A AK
Sbjct  61   GVTKAVANVNEIIAPALIKENLDVKDQAAVDAFLNKLDGTTNKTKIGANAILGVSMAVAK 120
Query  121  AGAAQKDVPLYKHIADISKAKEGKFVLPVPFQNVLNGGSHAGGDLAFQEFMIVPSGAPSF 180
            A AA+K VPLY HI+D+S  K+  FVLPVPF NV+NGGSHAGG LAFQEFMIVPSGAPSF
Sbjct  121  AAAAEKRVPLYAHISDLSGTKK-PFVLPVPFMNVVNGGSHAGGRLAFQEFMIVPSGAPSF 179
Query  181  SEGLRIGSEVYHHLKSLTKKKYGQSAGNVGDEGGVAPDIKTAKEALDLIVSAIEAAGYTG 240
            +E +R G+EVY+ LKSLTKK+YGQSAGNVGDEGGVAPDI+TA+EALDLI  AIE AGYTG
Sbjct  180  TEAMRQGAEVYQKLKSLTKKRYGQSAGNVGDEGGVAPDIQTAEEALDLITDAIEEAGYTG 239
Query  241  QVDIAMDVASSEFYK--DGLYDLDFKNPNSDKSKWITGPQLAELYEQLLNEYPIVSIEDP 298
            Q+ IAMDVASSEFYK  +  YDLDFKNP+SDKSKWIT  QLA+ Y +L  +YPIVSIEDP
Sbjct  240  QIKIAMDVASSEFYKADEKKYDLDFKNPDSDKSKWITYEQLADQYNELAAKYPIVSIEDP 299
Query  299  FAEDDWEAWSHFFSKVEGKTQIVGDDLTVTNPIRIKKAIETKAADALLLKVNQIGTLTES 358
            FAEDDWEAWS+F+       QIVGDDLTVTNP  IKKAIETKA +ALLLKVNQIGT+TE+
Sbjct  300  FAEDDWEAWSYFYKTSGSDFQIVGDDLTVTNPEFIKKAIETKACNALLLKVNQIGTITEA 359
Query  359  IQAANDSYAAGWGVMVSHRSGETEDTFIADLSVGIRSGQTKTGAPARSERLAKLNQILRI 418
            I AA DS+AAGWGVMVSHRSGETED  IAD+ VG+R+GQ KTGAPARSERLAKLNQILRI
Sbjct  360  INAAKDSFAAGWGVMVSHRSGETEDVTIADIVVGLRAGQIKTGAPARSERLAKLNQILRI 419
Query  419  EEELGDKAIYAGKDFHKAHSL 439
            EEELGDK +YAG +F  A +L
Sbjct  420  EEELGDKRLYAGDNFRTAINL 440

Sequence Alignment: 4. Allergen Name: Asp f 22.0101 Sequence ID: AAK49451

 Score = 489.6 bits 2120,  Expect = 1e-139
 Identities = 333/436 76%, Positives = 373/436 85%, Gaps = 5/436 1%
Query  1    MAISKIHSRYVYDSRGNPTVEVELTTEKGTFRSIVPSGASTGVHEALELRDGDKSKWLGK 60
            M ISKIH+R VYDSRGNPTVEV++ TE G  R+IVPSGASTG HEA ELRDGDK++W GK
Sbjct  1    MPISKIHARSVYDSRGNPTVEVDVATETGLHRAIVPSGASTGQHEAHELRDGDKTQWGGK 60
Query  61   GVLKAVANVNDTIAPALIEANIDVADQAKIDEFLLKLDGTPNKAKLGANAILGVSLAAAK 120
            GVLKAV NVN+TI PALI+ NIDV DQ+K+DEFL KLDGT NK+ LGANAILGVSLA AK
Sbjct  61   GVLKAVKNVNETIGPALIKENIDVKDQSKVDEFLNKLDGTANKSNLGANAILGVSLAVAK 120
Query  121  AGAAQKDVPLYKHIADISKAKEGKFVLPVPFQNVLNGGSHAGGDLAFQEFMIVPSGAPSF 180
            AGAA+K VPLY HI+D++  K+  +VLPVPFQNVLNGGSHAGG LAFQEFMIVP  APSF
Sbjct  121  AGAAEKGVPLYAHISDLAGTKK-PYVLPVPFQNVLNGGSHAGGRLAFQEFMIVPDSAPSF 179
Query  181  SEGLRIGSEVYHHLKSLTKKKYGQSAGNVGDEGGVAPDIKTAKEALDLIVSAIEAAGYTG 240
            SE LR G+EVY+ LK+L KKKYGQSAGNVGDEGGVAPDI+TA+EALDLI  AIE AGYTG
Sbjct  180  SEALRQGAEVYQKLKALAKKKYGQSAGNVGDEGGVAPDIQTAEEALDLITEAIEQAGYTG 239
Query  241  QVDIAMDVASSEFYKDGL--YDLDFKNPNSDKSKWITGPQLAELYEQLLNEYPIVSIEDP 298
            ++ IAMDVASSEFYK  +  YDLDFKNP SD SKW+T  QLA+LY+ L  +YPIVSIEDP
Sbjct  240  KIKIAMDVASSEFYKADVKKYDLDFKNPESDPSKWLTYEQLADLYKSLAAKYPIVSIEDP 299
Query  299  FAEDDWEAWSHFFSKVEGKTQIVGDDLTVTNPIRIKKAIETKAADALLLKVNQIGTLTES 358
            FAEDDWEAWS+F+   +   QIVGDDLTVTNP RIKKAIE K+ +ALLLKVNQIGTLTES
Sbjct  300  FAEDDWEAWSYFYKTSD--FQIVGDDLTVTNPGRIKKAIELKSCNALLLKVNQIGTLTES 357
Query  359  IQAANDSYAAGWGVMVSHRSGETEDTFIADLSVGIRSGQTKTGAPARSERLAKLNQILRI 418
            IQAA DSYA  WGVMVSHRSGETED  IAD++VG+RSGQ KTGAP RSERLAKLNQILRI
Sbjct  358  IQAAKDSYADNWGVMVSHRSGETEDVTIADIAVGLRSGQIKTGAPCRSERLAKLNQILRI 417
Query  419  EEELGDKAIYAGKDFHKAHSL 439
            EEELG+  +YAG  F  A +L
Sbjct  418  EEELGENTVYAGSKFRTAVNL 438

Sequence Alignment: 5. Allergen Name: Pen c 22.0101 Sequence ID: AAK51201

 Score = 489.1 bits 2118,  Expect = 2e-139
 Identities = 333/436 76%, Positives = 376/436 86%, Gaps = 5/436 1%
Query  1    MAISKIHSRYVYDSRGNPTVEVELTTEKGTFRSIVPSGASTGVHEALELRDGDKSKWLGK 60
            M I+K+H+R VY SRGNPTVEV++ TE G  R+IVPSGASTG HEA+ELRDGDK+KW GK
Sbjct  1    MPIAKVHARSVYVSRGNPTVEVDVVTETGLHRAIVPSGASTGQHEAVELRDGDKAKWGGK 60
Query  61   GVLKAVANVNDTIAPALIEANIDVADQAKIDEFLLKLDGTPNKAKLGANAILGVSLAAAK 120
            GVLKAV NVN+TI PALI+ NIDV DQAK+DEFL KLDGT NK  LGANAILGVSLA AK
Sbjct  61   GVLKAVKNVNETIGPALIKENIDVKDQAKVDEFLNKLDGTANKGNLGANAILGVSLAIAK 120
Query  121  AGAAQKDVPLYKHIADISKAKEGKFVLPVPFQNVLNGGSHAGGDLAFQEFMIVPSGAPSF 180
            A AA+K VPLY HI+D++  K+  +VLPVPFQNVLNGGSHAGG LAFQEFMIVP  A SF
Sbjct  121  AAAAEKGVPLYVHISDLAGTKK-PYVLPVPFQNVLNGGSHAGGRLAFQEFMIVPDTAESF 179
Query  181  SEGLRIGSEVYHHLKSLTKKKYGQSAGNVGDEGGVAPDIKTAKEALDLIVSAIEAAGYTG 240
            SEGLR G+EVY+ LK+L KKKYGQSAGNVGDEGGVAPDI+TA+EALDLI  AIE AGYTG
Sbjct  180  SEGLRQGAEVYQKLKALAKKKYGQSAGNVGDEGGVAPDIQTAEEALDLITEAIEQAGYTG 239
Query  241  QVDIAMDVASSEFYKDGL--YDLDFKNPNSDKSKWITGPQLAELYEQLLNEYPIVSIEDP 298
            ++ IAMDVASSEFYK     YDLDFKNP+SD +KW+T  QLA+LY+ L  +YPIVSIEDP
Sbjct  240  KISIAMDVASSEFYKTDAKKYDLDFKNPDSDPTKWLTYEQLADLYKSLAAKYPIVSIEDP 299
Query  299  FAEDDWEAWSHFFSKVEGKTQIVGDDLTVTNPIRIKKAIETKAADALLLKVNQIGTLTES 358
            FAEDDWEAWS+F+   +   QIVGDDLTVTNP+RIKKAIE K+ +ALLLKVNQIGTLTES
Sbjct  300  FAEDDWEAWSYFYKTSD--FQIVGDDLTVTNPLRIKKAIELKSCNALLLKVNQIGTLTES 357
Query  359  IQAANDSYAAGWGVMVSHRSGETEDTFIADLSVGIRSGQTKTGAPARSERLAKLNQILRI 418
            IQAA DSYA  WGVMVSHRSGETED  IAD++VG+RSGQ KTGAPARSERLAKLNQILRI
Sbjct  358  IQAAKDSYADNWGVMVSHRSGETEDVTIADIAVGLRSGQIKTGAPARSERLAKLNQILRI 417
Query  419  EEELGDKAIYAGKDFHKAHSL 439
            EEELG+ AIYAGK+F  + +L
Sbjct  418  EEELGENAIYAGKNFRTSVNL 438

Sequence Alignment: 6. Allergen Name: Alt a 5 Sequence ID: Q9HDT3

 Score = 488.6 bits 2116,  Expect = 2e-139
 Identities = 329/436 75%, Positives = 373/436 85%, Gaps = 5/436 1%
Query  1    MAISKIHSRYVYDSRGNPTVEVELTTEKGTFRSIVPSGASTGVHEALELRDGDKSKWLGK 60
            M I+KIH+R VYDSRGNPTVEV++ TE G  R+IVPSGASTG HEA ELRDGDKSKW GK
Sbjct  1    MTITKIHARSVYDSRGNPTVEVDIVTETGLHRAIVPSGASTGSHEACELRDGDKSKWGGK 60
Query  61   GVLKAVANVNDTIAPALIEANIDVADQAKIDEFLLKLDGTPNKAKLGANAILGVSLAAAK 120
            GV KAVANVNDTIAPALI+  +DV DQ+ +D FL KLDGT NK  LGANAILGVS+A AK
Sbjct  61   GVTKAVANVNDTIAPALIKEKLDVKDQSAVDAFLNKLDGTTNKTNLGANAILGVSMAIAK 120
Query  121  AGAAQKDVPLYKHIADISKAKEGKFVLPVPFQNVLNGGSHAGGDLAFQEFMIVPSGAPSF 180
            A AA+K VPLY HI+D++  K+  +VLPVPFQNVLNGGSHAGG LAFQEFMIVP  AP+F
Sbjct  121  AAAAEKGVPLYAHISDLAGTKK-PYVLPVPFQNVLNGGSHAGGRLAFQEFMIVPCEAPTF 179
Query  181  SEGLRIGSEVYHHLKSLTKKKYGQSAGNVGDEGGVAPDIKTAKEALDLIVSAIEAAGYTG 240
            SE +R G+EVY+ LK+L KK YGQSAGNVGDEGGVAPDI+TA+EALDLI  AIE AGYTG
Sbjct  180  SEAMRQGAEVYQKLKALAKKTYGQSAGNVGDEGGVAPDIQTAEEALDLITKAIEEAGYTG 239
Query  241  QVDIAMDVASSEFYK--DGLYDLDFKNPNSDKSKWITGPQLAELYEQLLNEYPIVSIEDP 298
            ++ IAMDVASSEFYK  +  YDLDFKNP+SDKSKW+T  QLAE+Y+ L  +YPIVSIEDP
Sbjct  240  KIKIAMDVASSEFYKADEKKYDLDFKNPDSDKSKWLTYEQLAEMYKSLAEKYPIVSIEDP 299
Query  299  FAEDDWEAWSHFFSKVEGKTQIVGDDLTVTNPIRIKKAIETKAADALLLKVNQIGTLTES 358
            FAEDDWEAWS+FF   +G  QIVGDDLTVTNP  IKKAIE K+ +ALLLKVNQIGT+TE+
Sbjct  300  FAEDDWEAWSYFFKTYDG--QIVGDDLTVTNPEFIKKAIELKSCNALLLKVNQIGTITEA 357
Query  359  IQAANDSYAAGWGVMVSHRSGETEDTFIADLSVGIRSGQTKTGAPARSERLAKLNQILRI 418
            IQAA D++ AGWGVMVSHRSGETED  IAD+ VG+RSGQ KTGAPARSERLAKLNQILRI
Sbjct  358  IQAAKDAFGAGWGVMVSHRSGETEDVTIADIVVGLRSGQIKTGAPARSERLAKLNQILRI 417
Query  419  EEELGDKAIYAGKDFHKAHSL 439
            EEELGD A+YAG +F  A +L
Sbjct  418  EEELGDNAVYAGNNFRTAVNL 438

Sequence Alignment: 7. Allergen Name: Cur l 2.0101 Sequence ID: AAK67491

 Score = 465.9 bits 2016,  Expect = 2e-132
 Identities = 319/434 73%, Positives = 367/434 84%, Gaps = 9/434 2%
Query  1    MAISKIHSRYVYDSRGNPTVEVELTTEKGTFRSIVPSGASTGVHEALELRDGDKSKWLGK 60
            MAI+KIH+R VYDSRGNPTVEV++ TE G  R+IVPSGASTG HEA ELRDGDK+KW GK
Sbjct  1    MAITKIHARSVYDSRGNPTVEVDIVTETGLHRAIVPSGASTGSHEACELRDGDKTKWGGK 60
Query  61   GVLKAVANVNDTIAPALIEANIDVADQAKIDEFLLKLDGTPNKAKLGANAILGVSLAAAK 120
            GV KAVANVND IAPALI+  +DV DQ+ +D FL KLDGT NK KLGANAILGVS+A AK
Sbjct  61   GVTKAVANVNDIIAPALIKEKLDVKDQSAVDAFLNKLDGTENKTKLGANAILGVSMAIAK 120
Query  121  AGAAQKDVPLYKHIADISKAKEGKFVLPVPFQNVLNGGSHAGGDLAFQEFMIVPSGAPSF 180
            A AA+K VPLY HI+D++  K+  +V+    +NVLNGGSHAGG L FQEFMI P  A +F
Sbjct  121  AAAAEKGVPLYAHISDLAGTKK-PYVFRFLSKNVLNGGSHAGGFLLFQEFMIAP--AKTF 177
Query  181  SEGLRI--GSEVYHHLKSLTKKKYGQSAGNVGDEGGVAPDIKTAKEALDLIVSAIEAAGY 238
            +E LRI  G+EVY+ LK+LTKK YGQSAGN GDEGGVAPDI+TA+EALDLIV AIEAAG+
Sbjct  178  AEALRIRQGAEVYQKLKALTKKTYGQSAGNYGDEGGVAPDIQTAEEALDLIVDAIEAAGH 237
Query  239  TGQVDIAMDVASSEFYKDGL--YDLDFKNPNSDKSKWITGPQLAELYEQLLNEYPIVSIE 296
            TGQ+ IAMDVASSEF+KD    YDLDFKNP+SDKSKW+T PQLAE+Y+ L  +YPIVSIE
Sbjct  238  TGQIKIAMDVASSEFFKDDEKKYDLDFKNPDSDKSKWLTYPQLAEMYKSLAEKYPIVSIE 297
Query  297  DPFAEDDWEAWSHFFSKVEGKTQIVGDDLTVTNPIRIKKAIETKAADALLLKVNQIGTLT 356
            DPFAEDDWEAWSHF+   +G  QIVGDDLTVTNP  IK AIE K+ +ALLLKVNQIGT++
Sbjct  298  DPFAEDDWEAWSHFYK--DGDFQIVGDDLTVTNPEFIKTAIELKSCNALLLKVNQIGTIS 355
Query  357  ESIQAANDSYAAGWGVMVSHRSGETEDTFIADLSVGIRSGQTKTGAPARSERLAKLNQIL 416
            E+I AA D++ AGWGVMVSHRSGETED  IAD+ VG+RSGQ KT APARSERLAK NQIL
Sbjct  356  EAINAAKDAFGAGWGVMVSHRSGETEDVTIADIVVGLRSGQIKTNAPARSERLAKYNQIL 415
Query  417  RIEEELGDKAIYAGKDFHKAHSL 439
            RIEEELGDK ++AG  FH A +L
Sbjct  416  RIEEELGDKRLFAGNKFHTAINL 438

Sequence Alignment: 8. Allergen Name: Cyp c 2.0101 Sequence ID: A0A2U9IY94

 Score = 427.3 bits 1847,  Expect = 7e-121
 Identities = 285/428 66%, Positives = 346/428 80%, Gaps = 5/428 1%
Query  1    MAISKIHSRYVYDSRGNPTVEVELTTEKGTFRSIVPSGASTGVHEALELRDGDKSKWLGK 60
            M+ISKIH+R + DSRGNPTVEV+L T KG FR+ VPSGASTGVHEALELRDGDK+++LGK
Sbjct  1    MSISKIHAREILDSRGNPTVEVDLYTAKGRFRAAVPSGASTGVHEALELRDGDKTRYLGK 60
Query  61   GVLKAVANVNDTIAPALIEANIDVADQAKIDEFLLKLDGTPNKAKLGANAILGVSLAAAK 120
            G  KAV +VN  IAP LIE    V +Q KID+F+L+LDGT NK+K+GANAILGVSLA  K
Sbjct  61   GTQKAVDHVNKEIAPKLIEKKFSVVEQEKIDKFMLELDGTENKSKFGANAILGVSLAVCK 120
Query  121  AGAAQKDVPLYKHIADISKAKEGKFVLPVPFQNVLNGGSHAGGDLAFQEFMIVPSGAPSF 180
            AGAA+K VPLY+HIAD++  K+   +LPVP  NV+NGGSHAG  LA QEFMI+P GA +F
Sbjct  121  AGAAEKGVPLYRHIADLAGNKD--VILPVPAFNVINGGSHAGNKLAMQEFMILPVGAKNF 178
Query  181  SEGLRIGSEVYHHLKSLTKKKYGQSAGNVGDEGGVAPDIKTAKEALDLIVSAIEAAGYTG 240
             E +RIG+EVYH+LK++ K KYG+ A NVGDEGG AP+I    EAL+L+ SAIE AGY  
Sbjct  179  HEAMRIGAEVYHNLKNVIKAKYGKDATNVGDEGGFAPNILENNEALELLKSAIEKAGYPD 238
Query  241  QVDIAMDVASSEFYKDGLYDLDFKNPNSDKSKWITGPQLAELYEQLLNEYPIVSIEDPFA 300
            ++ I MDVA+SEF+K+G YDLDFK+P+ D  + ITG QL +LY+ ++  YP+ SIEDPF 
Sbjct  239  KIIIGMDVAASEFFKNGKYDLDFKSPD-DPKRHITGDQLGDLYKSFIKNYPVQSIEDPFD 297
Query  301  EDDWEAWSHFFSKVEGKTQIVGDDLTVTNPIRIKKAIETKAADALLLKVNQIGTLTESIQ 360
            +DDWE WS F   V+   Q+VGDDLTVTNP RI++A E KA + LLLKVNQIG++TESIQ
Sbjct  298  QDDWENWSKFTGSVD--IQVVGDDLTVTNPKRIQQACEKKACNCLLLKVNQIGSVTESIQ 355
Query  361  AANDSYAAGWGVMVSHRSGETEDTFIADLSVGIRSGQTKTGAPARSERLAKLNQILRIEE 420
            A   + + GWGVMVSHRSGETEDTFIADL VG+ +GQ KTGAP RSERLAK NQ++RIEE
Sbjct  356  ACKLAQSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEE 415
Query  421  ELGDKAIYAGKDF 433
            ELGDKA +AGKDF
Sbjct  416  ELGDKAKFAGKDF 428

Sequence Alignment: 9. Allergen Name: Pan h 2.0101 Sequence ID: XP_034156632

 Score = 426.6 bits 1844,  Expect = 1e-120
 Identities = 284/428 66%, Positives = 346/428 80%, Gaps = 5/428 1%
Query  1    MAISKIHSRYVYDSRGNPTVEVELTTEKGTFRSIVPSGASTGVHEALELRDGDKSKWLGK 60
            M+I KIH+R + DSRGNPTVEV+L TEKG FR+ VPSGASTGVHEALELRDGDK+++LGK
Sbjct  1    MSIVKIHAREILDSRGNPTVEVDLYTEKGRFRAAVPSGASTGVHEALELRDGDKTRFLGK 60
Query  61   GVLKAVANVNDTIAPALIEANIDVADQAKIDEFLLKLDGTPNKAKLGANAILGVSLAAAK 120
            GV KAV +VN  IAP L+E  + V DQ KID+++L+LD T NK+K+GANAILGVSLA  K
Sbjct  61   GVTKAVDHVNKDIAPKLLEKKLSVVDQEKIDKLMLELDATENKSKFGANAILGVSLAVCK 120
Query  121  AGAAQKDVPLYKHIADISKAKEGKFVLPVPFQNVLNGGSHAGGDLAFQEFMIVPSGAPSF 180
            AGAA+K VPL++HIAD+  A     +LPVP  NV+NGGSHAG  LA QEFMI+P GA +F
Sbjct  121  AGAAEKGVPLFRHIADL--AGHADVILPVPAFNVINGGSHAGNKLAMQEFMILPVGAANF 178
Query  181  SEGLRIGSEVYHHLKSLTKKKYGQSAGNVGDEGGVAPDIKTAKEALDLIVSAIEAAGYTG 240
             E +RIG+EVYH+LK + K KYG+ A NVGDEGG AP+I    EAL+L+ SAIE AGY  
Sbjct  179  REAMRIGAEVYHNLKGVIKGKYGKDATNVGDEGGFAPNILENNEALELLKSAIEKAGYAD 238
Query  241  QVDIAMDVASSEFYKDGLYDLDFKNPNSDKSKWITGPQLAELYEQLLNEYPIVSIEDPFA 300
            ++ I MDVA+SEFY+ G YDLDFK+P+ D  + ITG QLA+LY+ ++  YP++SIEDPF 
Sbjct  239  KIVIGMDVAASEFYRSGKYDLDFKSPD-DPKRHITGDQLADLYKSFIKNYPVLSIEDPFD 297
Query  301  EDDWEAWSHFFSKVEGKTQIVGDDLTVTNPIRIKKAIETKAADALLLKVNQIGTLTESIQ 360
            +DDWE W+ F S V+   QIVGDDLTVTNP RI++A+E KA + LLLKVNQIG++TESIQ
Sbjct  298  QDDWENWTKFTSSVD--IQIVGDDLTVTNPKRIQQAVEKKACNCLLLKVNQIGSVTESIQ 355
Query  361  AANDSYAAGWGVMVSHRSGETEDTFIADLSVGIRSGQTKTGAPARSERLAKLNQILRIEE 420
            A   +   GWGVMVSHRSGETEDTFIADL VG+ +GQ KTGAP RSERLAK NQ++RIEE
Sbjct  356  ACKLAQKNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEE 415
Query  421  ELGDKAIYAGKDF 433
            +LGDKA +AGKDF
Sbjct  416  QLGDKAKFAGKDF 428

Sequence Alignment: 10. Allergen Name: Sal s 2.0101 Sequence ID: B5DGQ7

 Score = 421.0 bits 1819,  Expect = 6e-119
 Identities = 280/428 65%, Positives = 346/428 80%, Gaps = 5/428 1%
Query  1    MAISKIHSRYVYDSRGNPTVEVELTTEKGTFRSIVPSGASTGVHEALELRDGDKSKWLGK 60
            M+I+KIH+R + DSRGNPTVEV+L T KG FR+ VPSGASTGVHEALELRDGDKS++LGK
Sbjct  1    MSITKIHAREILDSRGNPTVEVDLYTAKGRFRAAVPSGASTGVHEALELRDGDKSRYLGK 60
Query  61   GVLKAVANVNDTIAPALIEANIDVADQAKIDEFLLKLDGTPNKAKLGANAILGVSLAAAK 120
            G +KAV +VN  IA  LIE    V DQ KID F+L+LDGT NK+K+GANAILGVSLA  K
Sbjct  61   GTVKAVDHVNKDIAAKLIEKKFSVVDQEKIDHFMLELDGTENKSKFGANAILGVSLAVCK 120
Query  121  AGAAQKDVPLYKHIADISKAKEGKFVLPVPFQNVLNGGSHAGGDLAFQEFMIVPSGAPSF 180
            AGAA+K VPLY+HIAD++  K+   +LP P  NV+NGGSHAG  LA QEFMI+P GA +F
Sbjct  121  AGAAEKGVPLYRHIADLAGHKD--VILPCPAFNVINGGSHAGNKLAMQEFMILPIGASNF 178
Query  181  SEGLRIGSEVYHHLKSLTKKKYGQSAGNVGDEGGVAPDIKTAKEALDLIVSAIEAAGYTG 240
             E +RIG+EVYH+LK++ K KYG+ A NVGDEGG AP+I    EAL+L+ +AIE AGY  
Sbjct  179  HEAMRIGAEVYHNLKNVIKAKYGKDATNVGDEGGFAPNILENNEALELLKTAIEKAGYPD 238
Query  241  QVDIAMDVASSEFYKDGLYDLDFKNPNSDKSKWITGPQLAELYEQLLNEYPIVSIEDPFA 300
            ++ I MDVA+SEFYK G YDLDFK+P+ D +++ITG QL +LY+ ++  YP+ SIEDPF 
Sbjct  239  KIIIGMDVAASEFYKAGKYDLDFKSPD-DPARYITGDQLGDLYKSFIKGYPVQSIEDPFD 297
Query  301  EDDWEAWSHFFSKVEGKTQIVGDDLTVTNPIRIKKAIETKAADALLLKVNQIGTLTESIQ 360
            +DDW AW+ F + V+   Q+VGDDLTVTNP RI++A+E KA + LLLKVNQIG++TESI+
Sbjct  298  QDDWAAWTKFTAAVD--IQVVGDDLTVTNPKRIQQAVEKKACNCLLLKVNQIGSVTESIK 355
Query  361  AANDSYAAGWGVMVSHRSGETEDTFIADLSVGIRSGQTKTGAPARSERLAKLNQILRIEE 420
            A   + + GWGVMVSHRSGETEDTFIADL VG+ +GQ KTGAP RSERLAK NQ++RIEE
Sbjct  356  ACKLAQSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEE 415
Query  421  ELGDKAIYAGKDF 433
            ELG KA +AGKD+
Sbjct  416  ELGAKAKFAGKDY 428

Sequence Alignment: 11. Allergen Name: Gal d 9.0101 Sequence ID: P07322

 Score = 409.6 bits 1769,  Expect = 2e-115
 Identities = 273/428 63%, Positives = 335/428 78%, Gaps = 5/428 1%
Query  1    MAISKIHSRYVYDSRGNPTVEVELTTEKGTFRSIVPSGASTGVHEALELRDGDKSKWLGK 60
            M+I KIH+R + DSRG PTVEV+L T KG FR+ VPSGASTG+HEALE RDGDK ++LGK
Sbjct  1    MSIQKIHAREILDSRGEPTVEVDLHTAKGHFRAAVPSGASTGIHEALEPRDGDKKRFLGK 60
Query  61   GVLKAVANVNDTIAPALIEANIDVADQAKIDEFLLKLDGTPNKAKLGANAILGVSLAAAK 120
            GVLKAV ++N TI PALIE  I V +Q KID+ ++++DGT NK+K+GANAILGVSLA  K
Sbjct  61   GVLKAVEHINKTIGPALIEKKISVVEQEKIDKVMIEMDGTENKSKFGANAILGVSLAVCK 120
Query  121  AGAAQKDVPLYKHIADISKAKEGKFVLPVPFQNVLNGGSHAGGDLAFQEFMIVPSGAPSF 180
            AGAA+K VPLY+HIAD++   E  ++LPVP  NV+NGGSHAG  LA QEFM++P GA SF
Sbjct  121  AGAAEKGVPLYRHIADLAGNTE--LILPVPAFNVINGGSHAGNKLAMQEFMVLPVGAASF 178
Query  181  SEGLRIGSEVYHHLKSLTKKKYGQSAGNVGDEGGVAPDIKTAKEALDLIVSAIEAAGYTG 240
             + +R+G+EVYH LK + K KYG+ A NVG EGG AP+I    EAL+L+ +AI  AGYT 
Sbjct  179  HDAMRVGAEVYHSLKGVIKAKYGKDATNVGGEGGFAPNILDNHEALELLKAAIAQAGYTD 238
Query  241  QVDIAMDVASSEFYKDGLYDLDFKNPNSDKSKWITGPQLAELYEQLLNEYPIVSIEDPFA 300
            +V I MDVA+SEF +DG Y LDFK+P   K ++ITG QL E+Y  ++ +YP+VSIEDPF 
Sbjct  239  KVVIGMDVAASEFCRDGRYHLDFKSPPHTK-RYITGEQLGEIYRGFIKDYPVVSIEDPFD 297
Query  301  EDDWEAWSHFFSKVEGKTQIVGDDLTVTNPIRIKKAIETKAADALLLKVNQIGTLTESIQ 360
            +DDWEAW  F   V+   Q+VGDDLTVTNP RI    E  A + LLLKVNQIG++TESIQ
Sbjct  298  QDDWEAWKRFVFHVD--IQVVGDDLTVTNPKRIAHGAEQHACNCLLLKVNQIGSVTESIQ 355
Query  361  AANDSYAAGWGVMVSHRSGETEDTFIADLSVGIRSGQTKTGAPARSERLAKLNQILRIEE 420
            A   + + GWGVMVSHRSGETEDTFIADL VG+ +GQ KTGAP RSERLAK NQ++RIEE
Sbjct  356  ACKLAQSHGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEE 415
Query  421  ELGDKAIYAGKDF 433
             LGDKA +AG+ F
Sbjct  416  ALGDKAKFAGRKF 428

Sequence Alignment: 12. Allergen Name: Amb a 12.0102 Sequence ID: A0A1B2H9Q5

 Score = 390.2 bits 1684,  Expect = 1e-109
 Identities = 274/428 64%, Positives = 335/428 78%, Gaps = 14/428 3%
Query  3    ISKIHSRYVYDSRGNPTVEVELTTEKGTF-RSIVPSGASTGVHEALELRDGDKSKWLGKG 61
            I  + +R ++DSRGNPTVEV++T   GT+ R+ VPSGASTG++EALELRDG  S +LGKG
Sbjct  4    IKAVKARQIFDSRGNPTVEVDITLSDGTLARAAVPSGASTGIYEALELRDGG-SDYLGKG 62
Query  62   VLKAVANVNDTIAPALIEANIDVADQAKIDEFLLK-LDGTPN-----KAKLGANAILGVS 115
            V KAVANVN  I PAL+    D  DQ  ID F+++ LDGT N     K KLGANAIL VS
Sbjct  63   VSKAVANVNTIIGPALV--GKDPTDQTGIDNFMVQQLDGTQNEWGWCKQKLGANAILAVS 120
Query  116  LAAAKAGAAQKDVPLYKHIADISKAKEGKFVLPVPFQNVLNGGSHAGGDLAFQEFMIVPS 175
            LA  KAGA+    PLYKHIA+++  K   +VLPVP  NV+NGGSHAG  LA QEFMI+P 
Sbjct  121  LAVCKAGASVLKTPLYKHIANLAGNK--NLVLPVPAFNVINGGSHAGNKLAMQEFMILPI 178
Query  176  GAPSFSEGLRIGSEVYHHLKSLTKKKYGQSAGNVGDEGGVAPDIKTAKEALDLIVSAIEA 235
            GA SF E +++G EVYH+LKS+ KKKYGQ A NVGDEGG AP+I+  KE L+L+ +AI  
Sbjct  179  GASSFKEAMKMGVEVYHNLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAK 238
Query  236  AGYTGQVDIAMDVASSEFY--KDGLYDLDFKNPNSDKSKWITGPQLAELYEQLLNEYPIV 293
            AGYT +V I MDVA+SEFY  KD  YDL+FK  N+D  + I+G QL +LY+ +++EYPIV
Sbjct  239  AGYTDKVVIGMDVAASEFYGEKDKTYDLNFKEENNDGKEKISGEQLKDLYKSFVSEYPIV 298
Query  294  SIEDPFAEDDWEAWSHFFSKVEGKTQIVGDDLTVTNPIRIKKAIETKAADALLLKVNQIG 353
            SIEDPF +DDWE ++   ++   + QIVGDDL VTNP R+KKAI+ K  +ALLLKVNQIG
Sbjct  299  SIEDPFDQDDWEHYAKMTAECGEQVQIVGDDLLVTNPTRVKKAIDEKTCNALLLKVNQIG 358
Query  354  TLTESIQAANDSYAAGWGVMVSHRSGETEDTFIADLSVGIRSGQTKTGAPARSERLAKLN 413
            ++TESI+A   S  AGWGVM SHRSGETEDTFIADLSVG+ +GQ KTGAP RSERLAK N
Sbjct  359  SVTESIEAVRMSKHAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYN 418
Query  414  QILRIEEELGDKAIYAGKDFHK 435
            Q+LRIEEELG +A+YAG +F K
Sbjct  419  QLLRIEEELGSEAVYAGANFRK 440

Sequence Alignment: 13. Allergen Name: Hev b 9 Sequence ID: Q9LEJ0

 Score = 387.7 bits 1673,  Expect = 6e-109
 Identities = 271/430 63%, Positives = 335/430 77%, Gaps = 13/430 3%
Query  1    MAISKIHSRYVYDSRGNPTVEVELTTEKGTF-RSIVPSGASTGVHEALELRDGDKSKWLG 59
            + I  + +R ++DSRGNPTVE ++    G + R+ VPSGASTG++EALELRDG  S +LG
Sbjct  3    ITIVSVRARQIFDSRGNPTVEADVKLSDGYLARAAVPSGASTGIYEALELRDGG-SDYLG 61
Query  60   KGVLKAVANVNDTIAPALIEANIDVADQAKIDEFLLK-LDGTPN-----KAKLGANAILG 113
            KGV KAV NVN  I PAL+    D  DQ  ID F+++ LDGT N     K KLGANAIL 
Sbjct  62   KGVSKAVENVNIIIGPALV--GKDPTDQVGIDNFMVQQLDGTVNEWGWCKQKLGANAILA 119
Query  114  VSLAAAKAGAAQKDVPLYKHIADISKAKEGKFVLPVPFQNVLNGGSHAGGDLAFQEFMIV 173
            VSLA  KAGA  K +PLY+HIA+++  K   +VLPVP  NV+NGGSHAG  LA QEFMI+
Sbjct  120  VSLAVCKAGAHVKGIPLYEHIANLAGNKN--LVLPVPAFNVINGGSHAGNKLAMQEFMIL 177
Query  174  PSGAPSFSEGLRIGSEVYHHLKSLTKKKYGQSAGNVGDEGGVAPDIKTAKEALDLIVSAI 233
            P GA SF E +++G+EVYHHLKS+ KKKYGQ A NVGDEGG AP+I+  KE L+L+ +AI
Sbjct  178  PVGASSFKEAMKMGAEVYHHLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAI 237
Query  234  EAAGYTGQVDIAMDVASSEFY-KDGLYDLDFKNPNSDKSKWITGPQLAELYEQLLNEYPI 292
              AGYTG+V I MDVA+SEFY  D  YDL+FK  N++ S+ I+G  L +LY+ ++ EYPI
Sbjct  238  AKAGYTGKVVIGMDVAASEFYGSDQTYDLNFKEENNNGSQKISGEALKDLYKSFVAEYPI 297
Query  293  VSIEDPFAEDDWEAWSHFFSKVEGKTQIVGDDLTVTNPIRIKKAIETKAADALLLKVNQI 352
            VSIEDPF +DDW  ++ + S++  K QIVGDDL VTNP R++KAI+ KA +ALLLKVNQI
Sbjct  298  VSIEDPFDQDDWAHYAKLTSEIGEKVQIVGDDLLVTNPKRVEKAIKEKACNALLLKVNQI 357
Query  353  GTLTESIQAANDSYAAGWGVMVSHRSGETEDTFIADLSVGIRSGQTKTGAPARSERLAKL 412
            G++TESI+A   S  AGWGVM SHRSGETEDTFIADLSVG+ +GQ KTGAP RSERLAK 
Sbjct  358  GSVTESIEAVKMSKRAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKY 417
Query  413  NQILRIEEELGDKAIYAGKDFHK 435
            NQ+LRIEEELG +A+YAG +F K
Sbjct  418  NQLLRIEEELGSEAVYAGANFRK 440

Sequence Alignment: 14. Allergen Name: Hev b 9 Sequence ID: Q9LEI9

 Score = 386.5 bits 1668,  Expect = 1e-108
 Identities = 270/428 63%, Positives = 334/428 78%, Gaps = 13/428 3%
Query  1    MAISKIHSRYVYDSRGNPTVEVELTTEKGTF-RSIVPSGASTGVHEALELRDGDKSKWLG 59
            + I  + +R ++DSRGNPTVE ++    G + R+ VP GASTG++EALELRDG  S +LG
Sbjct  3    ITIVSVRARQIFDSRGNPTVEADVKLSDGYLARAAVPRGASTGIYEALELRDGG-SDYLG 61
Query  60   KGVLKAVANVNDTIAPALIEANIDVADQAKIDEFLLK-LDGTPN-----KAKLGANAILG 113
            KGV KAV NVN  I PAL+    D  DQ  ID F+++ LDGT N     K KLGANAIL 
Sbjct  62   KGVSKAVENVNIIIGPALV--GKDPTDQVGIDNFMVQQLDGTVNEWGWCKQKLGANAILA 119
Query  114  VSLAAAKAGAAQKDVPLYKHIADISKAKEGKFVLPVPFQNVLNGGSHAGGDLAFQEFMIV 173
            VSLA  KAGA  K +PLYKH+A+++  K   +VLPVP  NV+NGGSHAG  LA QEFMI+
Sbjct  120  VSLAVCKAGAHVKGIPLYKHVANLAGNKN--LVLPVPAFNVINGGSHAGNKLAMQEFMIL 177
Query  174  PSGAPSFSEGLRIGSEVYHHLKSLTKKKYGQSAGNVGDEGGVAPDIKTAKEALDLIVSAI 233
            P GA SF E +++G+EVYHHLKS+ KKKYGQ A NVGDEGG AP+I+  KE L+L+ +AI
Sbjct  178  PVGASSFKEAMKMGAEVYHHLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAI 237
Query  234  EAAGYTGQVDIAMDVASSEFY-KDGLYDLDFKNPNSDKSKWITGPQLAELYEQLLNEYPI 292
              AGYTG+V I MDVA+SEFY  D  YDL+FK  N++ S+ I+G  L +LY+ ++ EYPI
Sbjct  238  AKAGYTGKVVIGMDVAASEFYGSDKTYDLNFKEENNNGSQKISGDVLKDLYKSFVTEYPI 297
Query  293  VSIEDPFAEDDWEAWSHFFSKVEGKTQIVGDDLTVTNPIRIKKAIETKAADALLLKVNQI 352
            VSIEDPF +DDWE ++ + S++  K QIVGDDL VTNP R++KAI+ KA +ALLLKVNQI
Sbjct  298  VSIEDPFDQDDWEHYAKLTSEIGVKVQIVGDDLLVTNPKRVEKAIKEKACNALLLKVNQI 357
Query  353  GTLTESIQAANDSYAAGWGVMVSHRSGETEDTFIADLSVGIRSGQTKTGAPARSERLAKL 412
            G++TESI+A   S  AGWGVM SHRSGETEDTFIADLSVG+ +GQ KTGAP RSERLAK 
Sbjct  358  GSVTESIEAVKMSKRAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKY 417
Query  413  NQILRIEEELGDKAIYAGKDF 433
            NQ+LRIEEELG +A+YAG +F
Sbjct  418  NQLLRIEEELGAEAVYAGANF 438

Sequence Alignment: 15. Allergen Name: Amb a 12.0101 Sequence ID: A0A1B2H9Q1

 Score = 370.8 bits 1599,  Expect = 7e-104
 Identities = 262/411 63%, Positives = 321/411 78%, Gaps = 14/411 3%
Query  20   VEVELTTEKGTF-RSIVPSGASTGVHEALELRDGDKSKWLGKGVLKAVANVNDTIAPALI 78
            ++V++T   GT+ R+ VPSGASTG++EALELRDG  S +LGKGV KAVANVN  I PAL+
Sbjct  7    IKVDITLSDGTLARAAVPSGASTGIYEALELRDGG-SDYLGKGVSKAVANVNTIIGPALV 65
Query  79   EANIDVADQAKIDEFLLK-LDGTPN-----KAKLGANAILGVSLAAAKAGAAQKDVPLYK 132
                D  DQ  ID F+++ LDGT N     K KLGANAIL V LA  KAGA+    PLYK
Sbjct  66   --GKDPTDQTGIDNFMVQQLDGTQNEWGWCKQKLGANAILAVPLAVCKAGASVLKTPLYK 123
Query  133  HIADISKAKEGKFVLPVPFQNVLNGGSHAGGDLAFQEFMIVPSGAPSFSEGLRIGSEVYH 192
            HIA+++  K   +VLPVP  NV+NGGSHAG  LA QEFMI+P GA SF E +++G EVYH
Sbjct  124  HIANLAGNKN--LVLPVPAFNVINGGSHAGNKLAMQEFMILPIGASSFKEAMKMGVEVYH 181
Query  193  HLKSLTKKKYGQSAGNVGDEGGVAPDIKTAKEALDLIVSAIEAAGYTGQVDIAMDVASSE 252
            +LKS+ KKKYGQ A NVGDEGG AP+I+  KE L+L+ +AI  AGYT +V I MDVA+SE
Sbjct  182  NLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKAGYTDKVVIGMDVAASE 241
Query  253  FY--KDGLYDLDFKNPNSDKSKWITGPQLAELYEQLLNEYPIVSIEDPFAEDDWEAWSHF 310
            FY  KD  YDL+FK  N+D  + I+G QL +LY+ +++EYPIVSIEDPF +DDWE ++  
Sbjct  242  FYGEKDKTYDLNFKEENNDGKEKISGEQLKDLYKSFVSEYPIVSIEDPFDQDDWEHYAKM 301
Query  311  FSKVEGKTQIVGDDLTVTNPIRIKKAIETKAADALLLKVNQIGTLTESIQAANDSYAAGW 370
             ++   + QIVGDDL VTNP R+KKAI+ K  +ALLLKVNQIG++TESI+A   S  AGW
Sbjct  302  TAECGEQVQIVGDDLLVTNPTRVKKAIDEKTCNALLLKVNQIGSVTESIEAVRMSKHAGW 361
Query  371  GVMVSHRSGETEDTFIADLSVGIRSGQTKTGAPARSERLAKLNQILRIEEELGDKAIYAG 430
            GVM SHRSGETEDTFIADLSVG+ +GQ KTGAP RSERLAK NQ+LRIEEELG +A+YAG
Sbjct  362  GVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAG 421
Query  431  KDFHK 435
             +F K
Sbjct  422  ANFRK 426

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.