The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAITDILSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIE
EDELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVKA
Sequence Info Allergen Name Length Opt Bits Score E Value
XP_019397705 Cro p 1.0101 109 676 108.7 3.8e-26
CAC83658 Cyp c 1.01 109 520 86.2 2.2e-19
Q5IRB2 Lat c 1.0101 109 511 84.9 5.4e-19
CAQ72967 Thu a 1.0101 109 510 84.8 5.9e-19
QCY53440 Cten i 1.0101 109 505 84.0 9.8e-19
CAC83659 Cyp c 1.02 109 505 84.0 9.8e-19
CAC95152 Ran e 2 109 503 83.7 1.2e-18
XP_026772003 Pan h 1.0101 109 498 83.0 2e-18
CAQ72971 Clu h 1.0201 110 486 81.3 6.6e-18
Q91483 Sal s 1 107 479 80.3 1.3e-17
CAA66404 Sal s 1 108 479 80.3 1.3e-17
Q90YK7 The c 1 109 479 80.3 1.3e-17
P59747 Sco j 1 109 478 80.1 1.5e-17
AAK63086 Gad m 1.0101 109 477 80.0 1.6e-17
CAM56786 Gad m 1.0202 109 472 79.3 2.6e-17
CAM56785 Gad m 1.0102 109 471 79.1 2.9e-17
Q90YK9 Gad m 1.0201 109 470 79.0 3.2e-17
AAK63087 Gad m 1.0201 109 470 79.0 3.2e-17
A0A1B1V0G7 Ras k 1.0101 109 468 78.7 3.9e-17
FM202668 Xip g 1.0101 109 465 78.3 5.3e-17
CAQ72972 Clu h 1.0301 109 465 78.3 5.3e-17
FM177701 Sar sa 1.0101 109 463 78.0 6.5e-17
Q6ITU9 Lat c 1.0201 109 461 77.7 7.9e-17
CAQ72970 Clu h 1.0101 109 457 77.1 1.2e-16
CAQ72968 Seb m 1.0101 109 453 76.5 1.8e-16
XP_019400389 Cro p 2.0101 110 451 76.3 2.2e-16
C1L370 Gal d 8.0101 110 447 75.7 3.2e-16
CAQ72969 Seb m 1.0201 110 442 75.0 5.3e-16
Q91482 Sal s 1 109 438 74.4 7.9e-16
AM904681 Lep w 1.0101 109 434 73.8 1.2e-15
XP_026803769 Pan h 1.0201 109 426 72.7 2.6e-15
CAC83046 Ran e 1 110 405 69.6 2.1e-14
P02622 Gad c 1 113 405 69.7 2.2e-14
P86432 Onc m 1.0201 107 398 68.6 4.2e-14
P86431 Onc m 1.0101 108 391 67.6 8.5e-14
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Cro p 1.0101 Sequence ID: XP_019397705

 Score = 108.7 bits 676,  Expect = 4e-26
 Identities = 109/109 100%, Positives = 109/109 100%, Gaps = 0/109 0%
Query  1    MAITDILSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIE 60
            MAITDILSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIE
Sbjct  1    MAITDILSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIE 60
Query  61   EDELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVKA 109
            EDELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVKA
Sbjct  61   EDELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVKA 109

Sequence Alignment: 2. Allergen Name: Cyp c 1.01 Sequence ID: CAC83658

 Score = 86.2 bits 520,  Expect = 2e-19
 Identities = 79/109 72%, Positives = 91/109 83%, Gaps = 0/109 0%
Query  1    MAITDILSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIE 60
            MA   IL+  DI AAL  CQAA+SF+YKSFF+ VGL  K+ D +KK F ++DQDKSGFIE
Sbjct  1    MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIE 60
Query  61   EDELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVKA 109
            EDEL+LFL+NFS+ ARALTDAETKAFL AGD+DGDGKIGVDEF ALVKA
Sbjct  61   EDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVKA 109

Sequence Alignment: 3. Allergen Name: Lat c 1.0101 Sequence ID: Q5IRB2

 Score = 84.9 bits 511,  Expect = 5e-19
 Identities = 79/108 73%, Positives = 90/108 83%, Gaps = 0/108 0%
Query  1    MAITDILSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIE 60
            MA   IL+  DI AAL++CQAA+SF +K FF  VGL GKS D VKK F ++DQDKSGFIE
Sbjct  1    MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIE 60
Query  61   EDELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVK 108
            EDEL+LFL+NFS+SARALTDAETK FL AGD+DGDGKIGVDEF ALVK
Sbjct  61   EDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVK 108

Sequence Alignment: 4. Allergen Name: Thu a 1.0101 Sequence ID: CAQ72967

 Score = 84.8 bits 510,  Expect = 6e-19
 Identities = 76/109 69%, Positives = 91/109 83%, Gaps = 0/109 0%
Query  1    MAITDILSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIE 60
            MA   IL+  DI AAL++CQAA+SF YK FF+ VGL  K+ + +KK F ++DQDKSGFIE
Sbjct  1    MAFAGILTEADITAALAACQAADSFKYKDFFTKVGLAAKTPEDIKKAFAVIDQDKSGFIE 60
Query  61   EDELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVKA 109
            EDEL+LFL+NFS+ ARALTDAETKAFL AGD+DGDGKIG+DEF ALVKA
Sbjct  61   EDELKLFLQNFSAGARALTDAETKAFLMAGDSDGDGKIGIDEFAALVKA 109

Sequence Alignment: 5. Allergen Name: Cten i 1.0101 Sequence ID: QCY53440

 Score = 84.0 bits 505,  Expect = 1e-18
 Identities = 78/109 71%, Positives = 90/109 82%, Gaps = 0/109 0%
Query  1    MAITDILSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIE 60
            MA   IL+  DI AAL +C+AA+SFN+K+FF+ VGL  KS D VKK F I+DQDKSGFIE
Sbjct  1    MAFAGILNDADIAAALEACKAADSFNHKAFFAKVGLSAKSGDDVKKAFAIIDQDKSGFIE 60
Query  61   EDELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVKA 109
            EDEL+LFL+NF + ARALTDAETK FL AGD+DGDGKIGVDEF ALVKA
Sbjct  61   EDELKLFLQNFKADARALTDAETKIFLKAGDSDGDGKIGVDEFAALVKA 109

Sequence Alignment: 6. Allergen Name: Cyp c 1.02 Sequence ID: CAC83659

 Score = 84.0 bits 505,  Expect = 1e-18
 Identities = 77/109 70%, Positives = 90/109 82%, Gaps = 0/109 0%
Query  1    MAITDILSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIE 60
            MA   +L+  DI AAL +C+AA+SFN+K+FF+ VGL  KSAD VKK F I+DQDKSGFIE
Sbjct  1    MAFAGVLNDADITAALEACKAADSFNHKTFFAKVGLTSKSADDVKKAFAIIDQDKSGFIE 60
Query  61   EDELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVKA 109
            EDEL+LFL+NF + ARALTD ETK FL AGD+DGDGKIGVDEF ALVKA
Sbjct  61   EDELKLFLQNFKAGARALTDGETKTFLKAGDSDGDGKIGVDEFTALVKA 109

Sequence Alignment: 7. Allergen Name: Ran e 2 Sequence ID: CAC95152

 Score = 83.7 bits 503,  Expect = 1e-18
 Identities = 81/109 74%, Positives = 92/109 84%, Gaps = 0/109 0%
Query  1    MAITDILSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIE 60
            M+ITDI+S KDI+AAL S +AA SFNYK FF  VGL GKSA   KKVF ILD+DKSGFIE
Sbjct  1    MSITDIVSEKDIDAALESVKAAGSFNYKIFFQKVGLAGKSAADAKKVFEILDRDKSGFIE 60
Query  61   EDELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVKA 109
            +DEL LFL+NF +SAR L+DAET AFL AGD+DGDGKIGV+EFQALVKA
Sbjct  61   QDELGLFLQNFRASARVLSDAETSAFLKAGDSDGDGKIGVEEFQALVKA 109

Sequence Alignment: 8. Allergen Name: Pan h 1.0101 Sequence ID: XP_026772003

 Score = 83.0 bits 498,  Expect = 2e-18
 Identities = 77/109 70%, Positives = 89/109 81%, Gaps = 0/109 0%
Query  1    MAITDILSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIE 60
            MA   +L+  DI AAL +C+A  SF++K+FF+ VGL GKSAD VKK F I+DQDKSGFIE
Sbjct  1    MAFAGVLNDADIAAALDACKADGSFDHKAFFTKVGLTGKSADDVKKAFSIIDQDKSGFIE 60
Query  61   EDELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVKA 109
            EDEL+LFL+NF S ARALTD ETK FL AGDTDGDGKIGVDEF +LVKA
Sbjct  61   EDELKLFLQNFKSDARALTDNETKIFLKAGDTDGDGKIGVDEFASLVKA 109

Sequence Alignment: 9. Allergen Name: Clu h 1.0201 Sequence ID: CAQ72971

 Score = 81.3 bits 486,  Expect = 7e-18
 Identities = 75/109 68%, Positives = 88/109 80%, Gaps = 0/109 0%
Query  1    MAITDILSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIE 60
            MA   +LS  DI AAL +C AA++F++KSFF  VGL GKSAD VKK F I+DQDKSGFIE
Sbjct  1    MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIE 60
Query  61   EDELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVKA 109
            E+EL+LFL+NF + ARAL+D ETKAFLAAGD DGDG IGVDEF  +VKA
Sbjct  61   EEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVKA 109

Sequence Alignment: 10. Allergen Name: Sal s 1 Sequence ID: Q91483

 Score = 80.3 bits 479,  Expect = 1e-17
 Identities = 72/102 70%, Positives = 88/102 86%, Gaps = 0/102 0%
Query  7    LSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIEEDELQL 66
            L+  D+ AAL++C AA+SFN+K+FF+ VGL  KS+D VKK F ++DQDKSGFIEEDEL+L
Sbjct  5    LNDADVAAALAACTAADSFNHKAFFAKVGLASKSSDDVKKAFYVIDQDKSGFIEEDELKL 64
Query  67   FLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVK 108
            FL+NFS+SARALTDAETKAFLA GD DGDG IGVDEF A++K
Sbjct  65   FLQNFSASARALTDAETKAFLADGDKDGDGMIGVDEFAAMIK 106

Sequence Alignment: 11. Allergen Name: Sal s 1 Sequence ID: CAA66404

 Score = 80.3 bits 479,  Expect = 1e-17
 Identities = 72/102 70%, Positives = 88/102 86%, Gaps = 0/102 0%
Query  7    LSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIEEDELQL 66
            L+  D+ AAL++C AA+SFN+K+FF+ VGL  KS+D VKK F ++DQDKSGFIEEDEL+L
Sbjct  6    LNDADVAAALAACTAADSFNHKAFFAKVGLASKSSDDVKKAFYVIDQDKSGFIEEDELKL 65
Query  67   FLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVK 108
            FL+NFS+SARALTDAETKAFLA GD DGDG IGVDEF A++K
Sbjct  66   FLQNFSASARALTDAETKAFLADGDKDGDGMIGVDEFAAMIK 107

Sequence Alignment: 12. Allergen Name: The c 1 Sequence ID: Q90YK7

 Score = 80.3 bits 479,  Expect = 1e-17
 Identities = 72/109 66%, Positives = 90/109 82%, Gaps = 0/109 0%
Query  1    MAITDILSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIE 60
            MA   IL   ++ AAL +C++A SF++  FF + GL GKS+D VKK FGI+DQD+S FIE
Sbjct  1    MAFAGILKDAEVAAALEACKSAGSFDHTKFFKSCGLAGKSSDDVKKAFGIIDQDQSDFIE 60
Query  61   EDELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVKA 109
            E+EL+LFL+NFS+SARAL+DAETKAFL AGD+DGDGKIGVDEF A+VKA
Sbjct  61   EEELKLFLQNFSASARALSDAETKAFLKAGDSDGDGKIGVDEFAAMVKA 109

Sequence Alignment: 13. Allergen Name: Sco j 1 Sequence ID: P59747

 Score = 80.1 bits 478,  Expect = 1e-17
 Identities = 69/108 63%, Positives = 86/108 79%, Gaps = 0/108 0%
Query  1    MAITDILSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIE 60
            MA   +L   ++ AAL  C+AA SF++K FF   GL GKS D+VKK F I+DQDKSGFIE
Sbjct  1    MAFASVLKDAEVTAALDGCKAAGSFDHKKFFKACGLSGKSTDEVKKAFAIIDQDKSGFIE 60
Query  61   EDELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVK 108
            E+EL+LFL+NF + ARAL+DAETKAFL AGD+DGDGKIG+DEF A++K
Sbjct  61   EEELKLFLQNFKAGARALSDAETKAFLKAGDSDGDGKIGIDEFAAMIK 108

Sequence Alignment: 14. Allergen Name: Gad m 1.0101 Sequence ID: AAK63086

 Score = 80.0 bits 477,  Expect = 2e-17
 Identities = 73/109 66%, Positives = 88/109 80%, Gaps = 0/109 0%
Query  1    MAITDILSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIE 60
            MA   IL+  D  AA+ +C+AAESF+YK+FF+  GL GKSAD +KK F ++DQDKSGFIE
Sbjct  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
Query  61   EDELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVKA 109
            EDEL+LFL+ F + ARALTDAETKAFL AGD+DGDG IGVDE+  LVKA
Sbjct  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVKA 109

Sequence Alignment: 15. Allergen Name: Gad m 1.0202 Sequence ID: CAM56786

 Score = 79.3 bits 472,  Expect = 3e-17
 Identities = 71/109 65%, Positives = 90/109 82%, Gaps = 0/109 0%
Query  1    MAITDILSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIE 60
            MA   IL+  DI AAL++C+A  SF++K+FF+ VGL  KS+  +KKVF I+DQDKS F+E
Sbjct  1    MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSSADIKKVFEIIDQDKSDFVE 60
Query  61   EDELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVKA 109
            EDEL+LFL+NFS+ ARAL+DAETK FL AGD+DGDGKIGVDEF A++KA
Sbjct  61   EDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA 109

Sequence Alignment: 16. Allergen Name: Gad m 1.0102 Sequence ID: CAM56785

 Score = 79.1 bits 471,  Expect = 3e-17
 Identities = 72/109 66%, Positives = 88/109 80%, Gaps = 0/109 0%
Query  1    MAITDILSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIE 60
            MA   IL+  D  AA+ +C+AAESF+YK+FF+  GL GKSAD +KK F ++DQDKSGFIE
Sbjct  1    MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIE 60
Query  61   EDELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVKA 109
            EDEL+LFL+ F + ARALTDAETKAFL AGD+DGDG IGV+E+  LVKA
Sbjct  61   EDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVEEWAVLVKA 109

Sequence Alignment: 17. Allergen Name: Gad m 1.0201 Sequence ID: Q90YK9

 Score = 79.0 bits 470,  Expect = 3e-17
 Identities = 71/109 65%, Positives = 89/109 81%, Gaps = 0/109 0%
Query  1    MAITDILSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIE 60
            MA   IL+  DI AAL++C+A  SF++K+FF+ VGL  KS   +KKVF I+DQDKS F+E
Sbjct  1    MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSPADIKKVFEIIDQDKSDFVE 60
Query  61   EDELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVKA 109
            EDEL+LFL+NFS+ ARAL+DAETK FL AGD+DGDGKIGVDEF A++KA
Sbjct  61   EDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA 109

Sequence Alignment: 18. Allergen Name: Gad m 1.0201 Sequence ID: AAK63087

 Score = 79.0 bits 470,  Expect = 3e-17
 Identities = 71/109 65%, Positives = 89/109 81%, Gaps = 0/109 0%
Query  1    MAITDILSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIE 60
            MA   IL+  DI AAL++C+A  SF++K+FF+ VGL  KS   +KKVF I+DQDKS F+E
Sbjct  1    MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSPADIKKVFEIIDQDKSDFVE 60
Query  61   EDELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVKA 109
            EDEL+LFL+NFS+ ARAL+DAETK FL AGD+DGDGKIGVDEF A++KA
Sbjct  61   EDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA 109

Sequence Alignment: 19. Allergen Name: Ras k 1.0101 Sequence ID: A0A1B1V0G7

 Score = 78.7 bits 468,  Expect = 4e-17
 Identities = 70/108 64%, Positives = 83/108 76%, Gaps = 0/108 0%
Query  1    MAITDILSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIE 60
            MA   +L   +I AAL  C+A  SF++K FF   GL GKS D VKK F I+DQDKSGFIE
Sbjct  1    MAFASVLKDAEITAALDGCKADGSFDHKKFFKACGLAGKSGDDVKKAFAIIDQDKSGFIE 60
Query  61   EDELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVK 108
            E+EL+LFL+NF + AR L+DAETKAFL AGDTDGDGKIGVDEF A++K
Sbjct  61   EEELKLFLQNFKAGARTLSDAETKAFLKAGDTDGDGKIGVDEFAAMIK 108

Sequence Alignment: 20. Allergen Name: Xip g 1.0101 Sequence ID: FM202668

 Score = 78.3 bits 465,  Expect = 5e-17
 Identities = 70/109 64%, Positives = 85/109 77%, Gaps = 0/109 0%
Query  1    MAITDILSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIE 60
            MA   +LS  D+ AAL +C+ A +F+YK FF + GL  KS D VKK F I+DQDKSGFIE
Sbjct  1    MAFAGVLSDADVAAALEACKDAGTFDYKKFFKSCGLAAKSTDDVKKAFAIIDQDKSGFIE 60
Query  61   EDELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVKA 109
            EDEL+LFL+NF ++AR LTDAET+AFL AGD+DGDGKIG +EF ALV A
Sbjct  61   EDELKLFLQNFKAAARPLTDAETEAFLKAGDSDGDGKIGAEEFAALVTA 109

Sequence Alignment: 21. Allergen Name: Clu h 1.0301 Sequence ID: CAQ72972

 Score = 78.3 bits 465,  Expect = 5e-17
 Identities = 69/107 64%, Positives = 85/107 79%, Gaps = 0/107 0%
Query  1    MAITDILSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIE 60
            MA    L   DI AAL +C+ A+SF++K+FF+ VGLKGKS D++KK F I+DQDKSGFIE
Sbjct  1    MAFAAFLKEADITAALGACKGADSFDHKAFFAKVGLKGKSGDELKKAFEIIDQDKSGFIE 60
Query  61   EDELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALV 107
            E+EL+LFL+NF   ARALTD ETK FL AGD+D DGKIG+DEF AL+
Sbjct  61   EEELKLFLQNFCKGARALTDGETKKFLKAGDSDNDGKIGIDEFAALI 107

Sequence Alignment: 22. Allergen Name: Sar sa 1.0101 Sequence ID: FM177701

 Score = 78.0 bits 463,  Expect = 6e-17
 Identities = 69/108 63%, Positives = 86/108 79%, Gaps = 0/108 0%
Query  1    MAITDILSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIE 60
            MA+  ++   DI AAL +C+AA+SF++K+FF  VG+ GKSAD++KK F I+DQDKSGFIE
Sbjct  1    MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAIIDQDKSGFIE 60
Query  61   EDELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVK 108
            E+EL+LFL+NF   ARALTD ETK FL AGD  GDGKIG+DEF  LVK
Sbjct  61   EEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGIDEFNHLVK 108

Sequence Alignment: 23. Allergen Name: Lat c 1.0201 Sequence ID: Q6ITU9

 Score = 77.7 bits 461,  Expect = 8e-17
 Identities = 68/108 62%, Positives = 83/108 76%, Gaps = 0/108 0%
Query  1    MAITDILSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIE 60
            MA +++LS  D+ AAL  C+ A +F++K FFS  GL  K++D VKK F I+DQDKSGFIE
Sbjct  1    MAFSNVLSDSDVAAALDGCKDAGTFDHKKFFSACGLSNKTSDDVKKAFAIIDQDKSGFIE 60
Query  61   EDELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVK 108
            E+EL+LFL+NF + AR LTD ET  FL AGDTDGDGKIG DEF ALVK
Sbjct  61   EEELKLFLQNFKADARVLTDVETSTFLKAGDTDGDGKIGADEFTALVK 108

Sequence Alignment: 24. Allergen Name: Clu h 1.0101 Sequence ID: CAQ72970

 Score = 77.1 bits 457,  Expect = 1e-16
 Identities = 68/108 62%, Positives = 85/108 78%, Gaps = 0/108 0%
Query  1    MAITDILSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIE 60
            MA+  +L   DI+AAL +C+A +SF +K FF+ +GL  KSA  +KK F I+DQDKSGFIE
Sbjct  1    MALASLLKGADIDAALKACEAKDSFKHKDFFAKIGLATKSAADLKKAFEIIDQDKSGFIE 60
Query  61   EDELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVK 108
            E+EL+LFL+NF + ARALTDAETKAFL AGD DGDG IGVDEF  ++K
Sbjct  61   EEELKLFLQNFKAGARALTDAETKAFLKAGDADGDGMIGVDEFAVMIK 108

Sequence Alignment: 25. Allergen Name: Seb m 1.0101 Sequence ID: CAQ72968

 Score = 76.5 bits 453,  Expect = 2e-16
 Identities = 67/108 62%, Positives = 86/108 79%, Gaps = 0/108 0%
Query  1    MAITDILSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIE 60
            MA+   L+A DI AAL++C   ++F +K FF  VGL  KSAD +K  F ++DQDKSGFIE
Sbjct  1    MALAASLNAADITAALAACSGVDTFKHKDFFGKVGLSAKSADDIKNAFKVIDQDKSGFIE 60
Query  61   EDELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVK 108
            E+EL+LFL+NFS++ARALT+AET AFL AGD+DGDG IG+DEF A+VK
Sbjct  61   EEELKLFLQNFSATARALTEAETTAFLKAGDSDGDGMIGMDEFAAMVK 108

Sequence Alignment: 26. Allergen Name: Cro p 2.0101 Sequence ID: XP_019400389

 Score = 76.3 bits 451,  Expect = 2e-16
 Identities = 72/107 67%, Positives = 85/107 79%, Gaps = 0/107 0%
Query  1    MAITDILSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIE 60
            MA+TD+LSA DI+ A+ +  AAESFN+K FF  VGLK KS D VKKVF ILD+D+SGFIE
Sbjct  1    MAMTDLLSADDIKKAVGAFAAAESFNHKKFFEMVGLKKKSQDDVKKVFHILDKDRSGFIE 60
Query  61   EDELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALV 107
            EDEL+  LK F+  AR L+D ETK +LAAGD DGDGKIGVDEF +LV
Sbjct  61   EDELKSVLKGFTPDARDLSDKETKELLAAGDKDGDGKIGVDEFTSLV 107

Sequence Alignment: 27. Allergen Name: Gal d 8.0101 Sequence ID: C1L370

 Score = 75.7 bits 447,  Expect = 3e-16
 Identities = 69/107 64%, Positives = 85/107 79%, Gaps = 0/107 0%
Query  1    MAITDILSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIE 60
            MA+TD+LSA+DI+ A+ +  AAESFNYK FF  VGLK KS + VKKVF ILD+D+SGFIE
Sbjct  1    MAMTDVLSAEDIKKAVGAFSAAESFNYKKFFEMVGLKKKSPEDVKKVFHILDKDRSGFIE 60
Query  61   EDELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALV 107
            E+EL++ LK F+   R L+D ETKA+LAAGD DGDGKIG DEF  +V
Sbjct  61   EEELKFVLKGFTPDGRDLSDKETKALLAAGDKDGDGKIGADEFATMV 107

Sequence Alignment: 28. Allergen Name: Seb m 1.0201 Sequence ID: CAQ72969

 Score = 75.0 bits 442,  Expect = 5e-16
 Identities = 68/108 62%, Positives = 83/108 76%, Gaps = 1/108 0%
Query  1    MAITDI-LSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFI 59
            MA   + L   DI AAL  C+ A  FN+K+FF T GL GKS+D+VKK F I+DQD SGFI
Sbjct  1    MAFASVGLKDADIAAALDGCKDAGKFNHKTFFKTCGLSGKSSDEVKKAFAIIDQDISGFI 60
Query  60   EEDELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVK 108
            EE+EL+LFL+ F + ARAL+DAETK FL AGD+DGDGKIG DE+ A+VK
Sbjct  61   EEEELKLFLQTFKAGARALSDAETKEFLKAGDSDGDGKIGADEWAAMVK 109

Sequence Alignment: 29. Allergen Name: Sal s 1 Sequence ID: Q91482

 Score = 74.4 bits 438,  Expect = 8e-16
 Identities = 65/108 60%, Positives = 82/108 75%, Gaps = 0/108 0%
Query  1    MAITDILSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIE 60
            MA   +    DI+ AL +C+AA++F++K+FF T+G+  KSAD VKK F ++DQD SGFIE
Sbjct  1    MACAHLCKEADIKTALEACKAADTFSFKTFFHTIGFASKSADDVKKAFKVIDQDASGFIE 60
Query  61   EDELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVK 108
             +EL+LFL+NF   AR LTDAETKAFL AGD DGDG IG+DEF  LVK
Sbjct  61   VEELKLFLQNFCPKARELTDAETKAFLKAGDADGDGMIGIDEFAVLVK 108

Sequence Alignment: 30. Allergen Name: Lep w 1.0101 Sequence ID: AM904681

 Score = 73.8 bits 434,  Expect = 1e-15
 Identities = 66/103 64%, Positives = 81/103 78%, Gaps = 0/103 0%
Query  7    LSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIEEDELQL 66
            L A +I+AAL  C AA+SF+YK FF   GL  KSA++VK  F  +DQD+SGFIEEDEL+L
Sbjct  6    LDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIEEDELKL 65
Query  67   FLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVKA 109
            FL+NFS+SARALTD ET  FL AGD DGDGKIG++EF  LV++
Sbjct  66   FLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVRS 108

Sequence Alignment: 31. Allergen Name: Pan h 1.0201 Sequence ID: XP_026803769

 Score = 72.7 bits 426,  Expect = 3e-15
 Identities = 65/107 60%, Positives = 81/107 75%, Gaps = 0/107 0%
Query  1    MAITDILSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIE 60
            MA+ D+L A DI+ AL + + A++F++K FF  VGLK  SA+ VKKVF +LD D SGFIE
Sbjct  1    MAMQDLLKADDIKKALDTFKVADTFDHKKFFELVGLKAMSAENVKKVFSVLDVDASGFIE 60
Query  61   EDELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALV 107
            EDEL++ LK FS   R LTD ETKAFL A D DGDGKIG+DEF+A+V
Sbjct  61   EDELKFVLKGFSKDGRDLTDKETKAFLTAADRDGDGKIGIDEFEAIV 107

Sequence Alignment: 32. Allergen Name: Ran e 1 Sequence ID: CAC83046

 Score = 69.6 bits 405,  Expect = 2e-14
 Identities = 64/107 59%, Positives = 81/107 75%, Gaps = 0/107 0%
Query  1    MAITDILSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIE 60
            M +TD+L+A DI  A+S+  A ESFN+K FF   GLK KS + ++KVF +LDQD+SGFIE
Sbjct  1    MPMTDLLAAGDISKAVSAFAAPESFNHKKFFELCGLKSKSKEIMQKVFHVLDQDQSGFIE 60
Query  61   EDELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALV 107
            ++EL L LK F+   R+L+D ET A+LAAGD DGDGKIGVDEF  LV
Sbjct  61   KEELCLILKGFTPEGRSLSDKETTALLAAGDKDGDGKIGVDEFVTLV 107

Sequence Alignment: 33. Allergen Name: Gad c 1 Sequence ID: P02622

 Score = 69.7 bits 405,  Expect = 2e-14
 Identities = 66/106 62%, Positives = 80/106 75%, Gaps = 0/106 0%
Query  2    AITDILSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIEE 61
            A   ILS  DI+AA ++C    SF+   F++ VGL   SAD++KK+F I D+DK GFIEE
Sbjct  1    AFKGILSNADIKAAEAACFKEGSFDEDGFYAKVGLDAFSADELKKLFKIADEDKEGFIEE 60
Query  62   DELQLFLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALV 107
            DEL+LFL  F++  RALTDAETKAFL AGD+DGDGKIGVDEF ALV
Sbjct  61   DELKLFLIAFAADLRALTDAETKAFLKAGDSDGDGKIGVDEFGALV 106

Sequence Alignment: 34. Allergen Name: Onc m 1.0201 Sequence ID: P86432

 Score = 68.6 bits 398,  Expect = 4e-14
 Identities = 62/102 60%, Positives = 77/102 75%, Gaps = 0/102 0%
Query  7    LSAKDIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIEEDELQL 66
            L+  D+ AAL++C AA+SFN+K+FF+       S D +KK    LDQDKSGF+EEDEL+L
Sbjct  5    LNDADVAAALAACAAADSFNHKAFFAKXXXXXXSPDDLKKXXXXLDQDKSGFLEEDELKL 64
Query  67   FLKNFSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVK 108
            FL+NFS+SARALTDAETK    AGD DGDG +G+DEF  LVK
Sbjct  65   FLQNFSASARALTDAETKXXXXAGDADGDGMLGLDEFAVLVK 106

Sequence Alignment: 35. Allergen Name: Onc m 1.0101 Sequence ID: P86431

 Score = 67.6 bits 391,  Expect = 9e-14
 Identities = 58/98 59%, Positives = 74/98 75%, Gaps = 0/98 0%
Query  11   DIEAALSSCQAAESFNYKSFFSTVGLKGKSADQVKKVFGILDQDKSGFIEEDELQLFLKN 70
            D++ AL +C+AA+SFN+K+FF T+G+  K  D VKK   +LDQD SGF+E +EL+LFL+N
Sbjct  10   DLKTALEACKAADSFNFKTFFHTLGFASKXXDDVKKXXXVLDQDASGFLEVEELKLFLQN 69
Query  71   FSSSARALTDAETKAFLAAGDTDGDGKIGVDEFQALVK 108
            F      LTDAETKAFL AGD DGDG +G+DEF  LVK
Sbjct  70   FCPKXXXLTDAETKAFLKAGDADGDGMLGLDEFAVLVK 107

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.