The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAITIVSVRARQIFDSRGNPTVEADVKLSDGYLARAAVPRGASTGIYEALELRDGGSDYL
GKGVSKAVENVNIIIGPALVGKDPTDQVGIDNFMVQQLDGTVNEWGWCKQKLGANAILAV
SLAVCKAGAHVKGIPLYKHVANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVG
ASSFKEAMKMGAEVYHHLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKA
GYTGKVVIGMDVAASEFYGSDKTYDLNFKEENNNGSQKISGDVLKDLYKSFVTEYPIVSI
EDPFDQDDWEHYAKLTSEIGVKVQIVGDDLLVTNPKRVEKAIKEKACNALLLKVNQIGSV
TESIEAVKMSKRAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQL
LRIEEELGAEAVYAGANFRTPVEPY
Sequence Info Allergen Name Length Opt Bits Score E Value
Q9LEI9 Hev b 9 445 2880 662.8 9.7e-192
Q9LEJ0 Hev b 9 445 2821 649.3 1.1e-187
A0A1B2H9Q5 Amb a 12.0102 445 2611 601.5 2.8e-173
A0A1B2H9Q1 Amb a 12.0101 431 2501 576.4 9.5e-166
XP_034156632 Pan h 2.0101 434 1926 445.3 2.7e-126
A0A2U9IY94 Cyp c 2.0101 433 1920 444.0 7e-126
B5DGQ7 Sal s 2.0101 434 1912 442.1 2.5e-125
P07322 Gal d 9.0101 434 1833 424.1 6.6e-120
Q870B9 Rho m 1.0101 439 1668 386.5 1.4e-108
P42040 Cla h 6 440 1666 386.1 1.9e-108
AAK49451 Asp f 22.0101 438 1662 385.2 3.6e-108
CAA55070 Cla h 6 440 1636 379.2 2.2e-106
AAK51201 Pen c 22.0101 438 1630 377.9 5.7e-106
Q9HDT3 Alt a 5 438 1629 377.6 6.6e-106
AAK67491 Cur l 2.0101 440 1498 347.8 6.5e-97
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Hev b 9 Sequence ID: Q9LEI9

 Score = 662.8 bits 2880,  Expect = 1e-191
 Identities = 445/445 100%, Positives = 445/445 100%, Gaps = 0/445 0%
Query  1    MAITIVSVRARQIFDSRGNPTVEADVKLSDGYLARAAVPRGASTGIYEALELRDGGSDYL 60
            MAITIVSVRARQIFDSRGNPTVEADVKLSDGYLARAAVPRGASTGIYEALELRDGGSDYL
Sbjct  1    MAITIVSVRARQIFDSRGNPTVEADVKLSDGYLARAAVPRGASTGIYEALELRDGGSDYL 60
Query  61   GKGVSKAVENVNIIIGPALVGKDPTDQVGIDNFMVQQLDGTVNEWGWCKQKLGANAILAV 120
            GKGVSKAVENVNIIIGPALVGKDPTDQVGIDNFMVQQLDGTVNEWGWCKQKLGANAILAV
Sbjct  61   GKGVSKAVENVNIIIGPALVGKDPTDQVGIDNFMVQQLDGTVNEWGWCKQKLGANAILAV 120
Query  121  SLAVCKAGAHVKGIPLYKHVANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVG 180
            SLAVCKAGAHVKGIPLYKHVANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVG
Sbjct  121  SLAVCKAGAHVKGIPLYKHVANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVG 180
Query  181  ASSFKEAMKMGAEVYHHLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKA 240
            ASSFKEAMKMGAEVYHHLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKA
Sbjct  181  ASSFKEAMKMGAEVYHHLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKA 240
Query  241  GYTGKVVIGMDVAASEFYGSDKTYDLNFKEENNNGSQKISGDVLKDLYKSFVTEYPIVSI 300
            GYTGKVVIGMDVAASEFYGSDKTYDLNFKEENNNGSQKISGDVLKDLYKSFVTEYPIVSI
Sbjct  241  GYTGKVVIGMDVAASEFYGSDKTYDLNFKEENNNGSQKISGDVLKDLYKSFVTEYPIVSI 300
Query  301  EDPFDQDDWEHYAKLTSEIGVKVQIVGDDLLVTNPKRVEKAIKEKACNALLLKVNQIGSV 360
            EDPFDQDDWEHYAKLTSEIGVKVQIVGDDLLVTNPKRVEKAIKEKACNALLLKVNQIGSV
Sbjct  301  EDPFDQDDWEHYAKLTSEIGVKVQIVGDDLLVTNPKRVEKAIKEKACNALLLKVNQIGSV 360
Query  361  TESIEAVKMSKRAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQL 420
            TESIEAVKMSKRAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQL
Sbjct  361  TESIEAVKMSKRAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQL 420
Query  421  LRIEEELGAEAVYAGANFRTPVEPY 445
            LRIEEELGAEAVYAGANFRTPVEPY
Sbjct  421  LRIEEELGAEAVYAGANFRTPVEPY 445

Sequence Alignment: 2. Allergen Name: Hev b 9 Sequence ID: Q9LEJ0

 Score = 649.3 bits 2821,  Expect = 1e-187
 Identities = 434/445 97%, Positives = 439/445 98%, Gaps = 0/445 0%
Query  1    MAITIVSVRARQIFDSRGNPTVEADVKLSDGYLARAAVPRGASTGIYEALELRDGGSDYL 60
            MAITIVSVRARQIFDSRGNPTVEADVKLSDGYLARAAVP GASTGIYEALELRDGGSDYL
Sbjct  1    MAITIVSVRARQIFDSRGNPTVEADVKLSDGYLARAAVPSGASTGIYEALELRDGGSDYL 60
Query  61   GKGVSKAVENVNIIIGPALVGKDPTDQVGIDNFMVQQLDGTVNEWGWCKQKLGANAILAV 120
            GKGVSKAVENVNIIIGPALVGKDPTDQVGIDNFMVQQLDGTVNEWGWCKQKLGANAILAV
Sbjct  61   GKGVSKAVENVNIIIGPALVGKDPTDQVGIDNFMVQQLDGTVNEWGWCKQKLGANAILAV 120
Query  121  SLAVCKAGAHVKGIPLYKHVANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVG 180
            SLAVCKAGAHVKGIPLY+H+ANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVG
Sbjct  121  SLAVCKAGAHVKGIPLYEHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVG 180
Query  181  ASSFKEAMKMGAEVYHHLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKA 240
            ASSFKEAMKMGAEVYHHLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKA
Sbjct  181  ASSFKEAMKMGAEVYHHLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKA 240
Query  241  GYTGKVVIGMDVAASEFYGSDKTYDLNFKEENNNGSQKISGDVLKDLYKSFVTEYPIVSI 300
            GYTGKVVIGMDVAASEFYGSD+TYDLNFKEENNNGSQKISG+ LKDLYKSFV EYPIVSI
Sbjct  241  GYTGKVVIGMDVAASEFYGSDQTYDLNFKEENNNGSQKISGEALKDLYKSFVAEYPIVSI 300
Query  301  EDPFDQDDWEHYAKLTSEIGVKVQIVGDDLLVTNPKRVEKAIKEKACNALLLKVNQIGSV 360
            EDPFDQDDW HYAKLTSEIG KVQIVGDDLLVTNPKRVEKAIKEKACNALLLKVNQIGSV
Sbjct  301  EDPFDQDDWAHYAKLTSEIGEKVQIVGDDLLVTNPKRVEKAIKEKACNALLLKVNQIGSV 360
Query  361  TESIEAVKMSKRAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQL 420
            TESIEAVKMSKRAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQL
Sbjct  361  TESIEAVKMSKRAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQL 420
Query  421  LRIEEELGAEAVYAGANFRTPVEPY 445
            LRIEEELG+EAVYAGANFR PVEPY
Sbjct  421  LRIEEELGSEAVYAGANFRKPVEPY 445

Sequence Alignment: 3. Allergen Name: Amb a 12.0102 Sequence ID: A0A1B2H9Q5

 Score = 601.5 bits 2611,  Expect = 3e-173
 Identities = 401/442 90%, Positives = 417/442 94%, Gaps = 1/442 0%
Query  4    TIVSVRARQIFDSRGNPTVEADVKLSDGYLARAAVPRGASTGIYEALELRDGGSDYLGKG 63
            TI +V+ARQIFDSRGNPTVE D+ LSDG LARAAVP GASTGIYEALELRDGGSDYLGKG
Sbjct  3    TIKAVKARQIFDSRGNPTVEVDITLSDGTLARAAVPSGASTGIYEALELRDGGSDYLGKG 62
Query  64   VSKAVENVNIIIGPALVGKDPTDQVGIDNFMVQQLDGTVNEWGWCKQKLGANAILAVSLA 123
            VSKAV NVN IIGPALVGKDPTDQ GIDNFMVQQLDGT NEWGWCKQKLGANAILAVSLA
Sbjct  63   VSKAVANVNTIIGPALVGKDPTDQTGIDNFMVQQLDGTQNEWGWCKQKLGANAILAVSLA 122
Query  124  VCKAGAHVKGIPLYKHVANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASS 183
            VCKAGA V   PLYKH+ANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILP+GASS
Sbjct  123  VCKAGASVLKTPLYKHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPIGASS 182
Query  184  FKEAMKMGAEVYHHLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKAGYT 243
            FKEAMKMG EVYH+LKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKAGYT
Sbjct  183  FKEAMKMGVEVYHNLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKAGYT 242
Query  244  GKVVIGMDVAASEFYG-SDKTYDLNFKEENNNGSQKISGDVLKDLYKSFVTEYPIVSIED 302
             KVVIGMDVAASEFYG  DKTYDLNFKEENN+G +KISG+ LKDLYKSFV+EYPIVSIED
Sbjct  243  DKVVIGMDVAASEFYGEKDKTYDLNFKEENNDGKEKISGEQLKDLYKSFVSEYPIVSIED 302
Query  303  PFDQDDWEHYAKLTSEIGVKVQIVGDDLLVTNPKRVEKAIKEKACNALLLKVNQIGSVTE 362
            PFDQDDWEHYAK+T+E G +VQIVGDDLLVTNP RV+KAI EK CNALLLKVNQIGSVTE
Sbjct  303  PFDQDDWEHYAKMTAECGEQVQIVGDDLLVTNPTRVKKAIDEKTCNALLLKVNQIGSVTE 362
Query  363  SIEAVKMSKRAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLR 422
            SIEAV+MSK AGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLR
Sbjct  363  SIEAVRMSKHAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLR 422
Query  423  IEEELGAEAVYAGANFRTPVEPY 445
            IEEELG+EAVYAGANFR PVEPY
Sbjct  423  IEEELGSEAVYAGANFRKPVEPY 445

Sequence Alignment: 4. Allergen Name: Amb a 12.0101 Sequence ID: A0A1B2H9Q1

 Score = 576.4 bits 2501,  Expect = 1e-165
 Identities = 383/424 90%, Positives = 399/424 94%, Gaps = 1/424 0%
Query  22   VEADVKLSDGYLARAAVPRGASTGIYEALELRDGGSDYLGKGVSKAVENVNIIIGPALVG 81
            ++ D+ LSDG LARAAVP GASTGIYEALELRDGGSDYLGKGVSKAV NVN IIGPALVG
Sbjct  7    IKVDITLSDGTLARAAVPSGASTGIYEALELRDGGSDYLGKGVSKAVANVNTIIGPALVG 66
Query  82   KDPTDQVGIDNFMVQQLDGTVNEWGWCKQKLGANAILAVSLAVCKAGAHVKGIPLYKHVA 141
            KDPTDQ GIDNFMVQQLDGT NEWGWCKQKLGANAILAV LAVCKAGA V   PLYKH+A
Sbjct  67   KDPTDQTGIDNFMVQQLDGTQNEWGWCKQKLGANAILAVPLAVCKAGASVLKTPLYKHIA 126
Query  142  NLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMKMGAEVYHHLKSV 201
            NLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILP+GASSFKEAMKMG EVYH+LKSV
Sbjct  127  NLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPIGASSFKEAMKMGVEVYHNLKSV 186
Query  202  IKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKAGYTGKVVIGMDVAASEFYG-S 260
            IKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKAGYT KVVIGMDVAASEFYG  
Sbjct  187  IKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKAGYTDKVVIGMDVAASEFYGEK 246
Query  261  DKTYDLNFKEENNNGSQKISGDVLKDLYKSFVTEYPIVSIEDPFDQDDWEHYAKLTSEIG 320
            DKTYDLNFKEENN+G +KISG+ LKDLYKSFV+EYPIVSIEDPFDQDDWEHYAK+T+E G
Sbjct  247  DKTYDLNFKEENNDGKEKISGEQLKDLYKSFVSEYPIVSIEDPFDQDDWEHYAKMTAECG 306
Query  321  VKVQIVGDDLLVTNPKRVEKAIKEKACNALLLKVNQIGSVTESIEAVKMSKRAGWGVMAS 380
             +VQIVGDDLLVTNP RV+KAI EK CNALLLKVNQIGSVTESIEAV+MSK AGWGVMAS
Sbjct  307  EQVQIVGDDLLVTNPTRVKKAIDEKTCNALLLKVNQIGSVTESIEAVRMSKHAGWGVMAS 366
Query  381  HRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGANFRT 440
            HRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELG+EAVYAGANFR 
Sbjct  367  HRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGANFRK 426
Query  441  PVEPY 445
            PVEPY
Sbjct  427  PVEPY 431

Sequence Alignment: 5. Allergen Name: Pan h 2.0101 Sequence ID: XP_034156632

 Score = 445.3 bits 1926,  Expect = 3e-126
 Identities = 301/428 70%, Positives = 367/428 85%, Gaps = 14/428 3%
Query  3    ITIVSVRARQIFDSRGNPTVEADVKLSDGYLARAAVPRGASTGIYEALELRDGG-SDYLG 61
            ++IV + AR+I+DSRGNPTVE D+    G + RAAVP GASTG++EALELRDG  + +LG
Sbjct  1    MSIVKIHAREILDSRGNPTVEVDLYTEKGRF-RAAVPSGASTGVHEALELRDGDKTRFLG 59
Query  62   KGVSKAVENVNIIIGPALVGKDPT--DQVGIDNFMVQQLDGTVNEWGWCKQKLGANAILA 119
            KGV+KAV++VN  I P L+ K  +  DQ  ID +M++ LD T N     K K+GANAIL 
Sbjct  60   KGVTKAVDHVNKDIAPKLLEKKLSVVDQEKIDKLMLE-LDATEN-----KSKFGANAILG 113
Query  120  VSLAVCKAGAHVKGIPLYKHVANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPV 179
            VSLAVCKAGA  KG+PL++H+A+LAG+ +++LPVPAFNVINGGSHAGNKLAMQEFMILPV
Sbjct  114  VSLAVCKAGAAEKGVPLFRHIADLAGHADVILPVPAFNVINGGSHAGNKLAMQEFMILPV 173
Query  180  GASSFKEAMKMGAEVYHHLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAK 239
            GA++F+EAM++GAEVYH+LK VIK KYG+DATNVGDEGGFAPNI EN E LELLK+AI K
Sbjct  174  GAANFREAMRIGAEVYHNLKGVIKGKYGKDATNVGDEGGFAPNILENNEALELLKSAIEK 233
Query  240  AGYTGKVVIGMDVAASEFYGSDKTYDLNFKEENNNGSQKISGDVLKDLYKSFVTEYPIVS 299
            AGY  K+VIGMDVAASEFY S K YDL+FK  ++   + I+GD L DLYKSF+  YP++S
Sbjct  234  AGYADKIVIGMDVAASEFYRSGK-YDLDFKSPDDP-KRHITGDQLADLYKSFIKNYPVLS 291
Query  300  IEDPFDQDDWEHYAKLTSEIGVKVQIVGDDLLVTNPKRVEKAIKEKACNALLLKVNQIGS 359
            IEDPFDQDDWE++ K+TS   V +QIVGDDL VTNPKR+++A+++KACN LLLKVNQIGS
Sbjct  292  IEDPFDQDDWENWTKFTS--SVDIQIVGDDLTVTNPKRIQQAVEKKACNCLLLKVNQIGS 349
Query  360  VTESIEAVKMSKRAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQ 419
            VTESI+A K++++ GWGVM SHRSGETEDTFIADL VGL TGQIKTGAPCRSERLAKYNQ
Sbjct  350  VTESIQACKLAQKNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQ 409
Query  420  LLRIEEELGAEAVYAGANFRTP 441
            L+RIEE+LG +A +AG +FR P
Sbjct  410  LMRIEEQLGDKAKFAGKDFRHP 431

Sequence Alignment: 6. Allergen Name: Cyp c 2.0101 Sequence ID: A0A2U9IY94

 Score = 444.0 bits 1920,  Expect = 7e-126
 Identities = 300/428 70%, Positives = 363/428 84%, Gaps = 14/428 3%
Query  3    ITIVSVRARQIFDSRGNPTVEADVKLSDGYLARAAVPRGASTGIYEALELRDGG-SDYLG 61
            ++I  + AR+I+DSRGNPTVE D+  + G + RAAVP GASTG++EALELRDG  + YLG
Sbjct  1    MSISKIHAREILDSRGNPTVEVDLYTAKGRF-RAAVPSGASTGVHEALELRDGDKTRYLG 59
Query  62   KGVSKAVENVNIIIGPALVGKDPT--DQVGIDNFMVQQLDGTVNEWGWCKQKLGANAILA 119
            KG  KAV++VN  I P L+ K  +  +Q  ID FM++ LDGT N     K K+GANAIL 
Sbjct  60   KGTQKAVDHVNKEIAPKLIEKKFSVVEQEKIDKFMLE-LDGTEN-----KSKFGANAILG 113
Query  120  VSLAVCKAGAHVKGIPLYKHVANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPV 179
            VSLAVCKAGA  KG+PLY+H+A+LAGNK+++LPVPAFNVINGGSHAGNKLAMQEFMILPV
Sbjct  114  VSLAVCKAGAAEKGVPLYRHIADLAGNKDVILPVPAFNVINGGSHAGNKLAMQEFMILPV 173
Query  180  GASSFKEAMKMGAEVYHHLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAK 239
            GA +F EAM++GAEVYH+LK+VIK KYG+DATNVGDEGGFAPNI EN E LELLK+AI K
Sbjct  174  GAKNFHEAMRIGAEVYHNLKNVIKAKYGKDATNVGDEGGFAPNILENNEALELLKSAIEK 233
Query  240  AGYTGKVVIGMDVAASEFYGSDKTYDLNFKEENNNGSQKISGDVLKDLYKSFVTEYPIVS 299
            AGY  K++IGMDVAASEF+ + K YDL+FK  ++   + I+GD L DLYKSF+  YP+ S
Sbjct  234  AGYPDKIIIGMDVAASEFFKNGK-YDLDFKSPDDP-KRHITGDQLGDLYKSFIKNYPVQS 291
Query  300  IEDPFDQDDWEHYAKLTSEIGVKVQIVGDDLLVTNPKRVEKAIKEKACNALLLKVNQIGS 359
            IEDPFDQDDWE+++K+T    V +Q+VGDDL VTNPKR+++A ++KACN LLLKVNQIGS
Sbjct  292  IEDPFDQDDWENWSKFTG--SVDIQVVGDDLTVTNPKRIQQACEKKACNCLLLKVNQIGS 349
Query  360  VTESIEAVKMSKRAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQ 419
            VTESI+A K+++  GWGVM SHRSGETEDTFIADL VGL TGQIKTGAPCRSERLAKYNQ
Sbjct  350  VTESIQACKLAQSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQ 409
Query  420  LLRIEEELGAEAVYAGANFRTP 441
            L+RIEEELG +A +AG +FR P
Sbjct  410  LMRIEEELGDKAKFAGKDFRHP 431

Sequence Alignment: 7. Allergen Name: Sal s 2.0101 Sequence ID: B5DGQ7

 Score = 442.1 bits 1912,  Expect = 3e-125
 Identities = 300/428 70%, Positives = 364/428 85%, Gaps = 14/428 3%
Query  3    ITIVSVRARQIFDSRGNPTVEADVKLSDGYLARAAVPRGASTGIYEALELRDGG-SDYLG 61
            ++I  + AR+I+DSRGNPTVE D+  + G + RAAVP GASTG++EALELRDG  S YLG
Sbjct  1    MSITKIHAREILDSRGNPTVEVDLYTAKGRF-RAAVPSGASTGVHEALELRDGDKSRYLG 59
Query  62   KGVSKAVENVNIIIGPALVGKDPT--DQVGIDNFMVQQLDGTVNEWGWCKQKLGANAILA 119
            KG  KAV++VN  I   L+ K  +  DQ  ID+FM++ LDGT N     K K+GANAIL 
Sbjct  60   KGTVKAVDHVNKDIAAKLIEKKFSVVDQEKIDHFMLE-LDGTEN-----KSKFGANAILG 113
Query  120  VSLAVCKAGAHVKGIPLYKHVANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPV 179
            VSLAVCKAGA  KG+PLY+H+A+LAG+K+++LP PAFNVINGGSHAGNKLAMQEFMILP+
Sbjct  114  VSLAVCKAGAAEKGVPLYRHIADLAGHKDVILPCPAFNVINGGSHAGNKLAMQEFMILPI 173
Query  180  GASSFKEAMKMGAEVYHHLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAK 239
            GAS+F EAM++GAEVYH+LK+VIK KYG+DATNVGDEGGFAPNI EN E LELLKTAI K
Sbjct  174  GASNFHEAMRIGAEVYHNLKNVIKAKYGKDATNVGDEGGFAPNILENNEALELLKTAIEK 233
Query  240  AGYTGKVVIGMDVAASEFYGSDKTYDLNFKEENNNGSQKISGDVLKDLYKSFVTEYPIVS 299
            AGY  K++IGMDVAASEFY + K YDL+FK  ++  ++ I+GD L DLYKSF+  YP+ S
Sbjct  234  AGYPDKIIIGMDVAASEFYKAGK-YDLDFKSPDDP-ARYITGDQLGDLYKSFIKGYPVQS 291
Query  300  IEDPFDQDDWEHYAKLTSEIGVKVQIVGDDLLVTNPKRVEKAIKEKACNALLLKVNQIGS 359
            IEDPFDQDDW  + K+T+   V +Q+VGDDL VTNPKR+++A+++KACN LLLKVNQIGS
Sbjct  292  IEDPFDQDDWAAWTKFTA--AVDIQVVGDDLTVTNPKRIQQAVEKKACNCLLLKVNQIGS 349
Query  360  VTESIEAVKMSKRAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQ 419
            VTESI+A K+++  GWGVM SHRSGETEDTFIADL VGL TGQIKTGAPCRSERLAKYNQ
Sbjct  350  VTESIKACKLAQSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQ 409
Query  420  LLRIEEELGAEAVYAGANFRTP 441
            L+RIEEELGA+A +AG ++R P
Sbjct  410  LMRIEEELGAKAKFAGKDYRHP 431

Sequence Alignment: 8. Allergen Name: Gal d 9.0101 Sequence ID: P07322

 Score = 424.1 bits 1833,  Expect = 7e-120
 Identities = 289/428 67%, Positives = 348/428 81%, Gaps = 14/428 3%
Query  3    ITIVSVRARQIFDSRGNPTVEADVKLSDGYLARAAVPRGASTGIYEALELRDGGSD-YLG 61
            ++I  + AR+I+DSRG PTVE D+  + G++ RAAVP GASTGI+EALE RDG    +LG
Sbjct  1    MSIQKIHAREILDSRGEPTVEVDLHTAKGHF-RAAVPSGASTGIHEALEPRDGDKKRFLG 59
Query  62   KGVSKAVENVNIIIGPALVGKDPT--DQVGIDNFMVQQLDGTVNEWGWCKQKLGANAILA 119
            KGV KAVE++N  IGPAL+ K  +  +Q  ID  M++ +DGT N     K K+GANAIL 
Sbjct  60   KGVLKAVEHINKTIGPALIEKKISVVEQEKIDKVMIE-MDGTEN-----KSKFGANAILG 113
Query  120  VSLAVCKAGAHVKGIPLYKHVANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILPV 179
            VSLAVCKAGA  KG+PLY+H+A+LAGN  L+LPVPAFNVINGGSHAGNKLAMQEFM+LPV
Sbjct  114  VSLAVCKAGAAEKGVPLYRHIADLAGNTELILPVPAFNVINGGSHAGNKLAMQEFMVLPV 173
Query  180  GASSFKEAMKMGAEVYHHLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAK 239
            GA+SF +AM++GAEVYH LK VIK KYG+DATNVG EGGFAPNI +N E LELLK AIA+
Sbjct  174  GAASFHDAMRVGAEVYHSLKGVIKAKYGKDATNVGGEGGFAPNILDNHEALELLKAAIAQ 233
Query  240  AGYTGKVVIGMDVAASEFYGSDKTYDLNFKEENNNGSQKISGDVLKDLYKSFVTEYPIVS 299
            AGYT KVVIGMDVAASEF   D  Y L+FK   +   + I+G+ L ++Y+ F+ +YP+VS
Sbjct  234  AGYTDKVVIGMDVAASEFC-RDGRYHLDFKSPPHT-KRYITGEQLGEIYRGFIKDYPVVS 291
Query  300  IEDPFDQDDWEHYAKLTSEIGVKVQIVGDDLLVTNPKRVEKAIKEKACNALLLKVNQIGS 359
            IEDPFDQDDWE + ++     V +Q+VGDDL VTNPKR+    ++ ACN LLLKVNQIGS
Sbjct  292  IEDPFDQDDWEAWKRFV--FHVDIQVVGDDLTVTNPKRIAHGAEQHACNCLLLKVNQIGS 349
Query  360  VTESIEAVKMSKRAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQ 419
            VTESI+A K+++  GWGVM SHRSGETEDTFIADL VGL TGQIKTGAPCRSERLAKYNQ
Sbjct  350  VTESIQACKLAQSHGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQ 409
Query  420  LLRIEEELGAEAVYAGANFRTP 441
            L+RIEE LG +A +AG  FR P
Sbjct  410  LMRIEEALGDKAKFAGRKFRNP 431

Sequence Alignment: 9. Allergen Name: Rho m 1.0101 Sequence ID: Q870B9

 Score = 386.5 bits 1668,  Expect = 1e-108
 Identities = 270/428 63%, Positives = 334/428 78%, Gaps = 13/428 3%
Query  3    ITIVSVRARQIFDSRGNPTVEADVKLSDGYLARAAVPRGASTGIYEALELRDGG-SDYLG 61
            + I  + +R ++DSRGNPTVE ++    G + R+ VP GASTG++EALELRDG  S +LG
Sbjct  1    MAISKIHSRYVYDSRGNPTVEVELTTEKGTF-RSIVPSGASTGVHEALELRDGDKSKWLG 59
Query  62   KGVSKAVENVNIIIGPALV--GKDPTDQVGIDNFMVQQLDGTVNEWGWCKQKLGANAILA 119
            KGV KAV NVN  I PAL+    D  DQ  ID F+++ LDGT N     K KLGANAIL 
Sbjct  60   KGVLKAVANVNDTIAPALIEANIDVADQAKIDEFLLK-LDGTPN-----KAKLGANAILG 113
Query  120  VSLAVCKAGAHVKGIPLYKHVANLAGNKN--LVLPVPAFNVINGGSHAGNKLAMQEFMIL 177
            VSLA  KAGA  K +PLYKH+A+++  K   +VLPVP  NV+NGGSHAG  LA QEFMI+
Sbjct  114  VSLAAAKAGAAQKDVPLYKHIADISKAKEGKFVLPVPFQNVLNGGSHAGGDLAFQEFMIV 173
Query  178  PVGASSFKEAMKMGAEVYHHLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAI 237
            P GA SF E +++G+EVYHHLKS+ KKKYGQ A NVGDEGG AP+I+  KE L+L+ +AI
Sbjct  174  PSGAPSFSEGLRIGSEVYHHLKSLTKKKYGQSAGNVGDEGGVAPDIKTAKEALDLIVSAI 233
Query  238  AKAGYTGKVVIGMDVAASEFYGSDKTYDLNFKEENNNGSQKISGDVLKDLYKSFVTEYPI 297
              AGYTG+V I MDVA+SEFY  D  YDL+FK  N++ S+ I+G  L +LY+ ++ EYPI
Sbjct  234  EAAGYTGQVDIAMDVASSEFY-KDGLYDLDFKNPNSDKSKWITGPQLAELYEQLLNEYPI 292
Query  298  VSIEDPFDQDDWEHYAKLTSEIGVKVQIVGDDLLVTNPKRVEKAIKEKACNALLLKVNQI 357
            VSIEDPF +DDWE ++ + S++  K QIVGDDL VTNP R++KAI+ KA +ALLLKVNQI
Sbjct  293  VSIEDPFAEDDWEAWSHFFSKVEGKTQIVGDDLTVTNPIRIKKAIETKAADALLLKVNQI 352
Query  358  GSVTESIEAVKMSKRAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKY 417
            G++TESI+A   S  AGWGVM SHRSGETEDTFIADLSVG+ +GQ KTGAP RSERLAK 
Sbjct  353  GTLTESIQAANDSYAAGWGVMVSHRSGETEDTFIADLSVGIRSGQTKTGAPARSERLAKL 412
Query  418  NQLLRIEEELGAEAVYAGANF 438
            NQ+LRIEEELG +A+YAG +F
Sbjct  413  NQILRIEEELGDKAIYAGKDF 433

Sequence Alignment: 10. Allergen Name: Cla h 6 Sequence ID: P42040

 Score = 386.1 bits 1666,  Expect = 2e-108
 Identities = 269/433 62%, Positives = 331/433 76%, Gaps = 12/433 2%
Query  3    ITIVSVRARQIFDSRGNPTVEADVKLSDGYLARAAVPRGASTGIYEALELRDGG-SDYLG 61
            + I  + +R ++DSRGNPTVE D+    G L RA VP GASTG +EA ELRDG  S + G
Sbjct  1    MPISKIHSRYVYDSRGNPTVEVDIVTETG-LHRAIVPSGASTGSHEACELRDGDKSKWAG 59
Query  62   KGVSKAVENVNIIIGPALVGK--DPTDQVGIDNFMVQQLDGTVNEWGWCKQKLGANAILA 119
            KGV+KAV NVN II PAL+ +  D  DQ  +D F+  +LDGT N     K K+GANAIL 
Sbjct  60   KGVTKAVANVNEIIAPALIKENLDVKDQAAVDAFL-NKLDGTTN-----KTKIGANAILG 113
Query  120  VSLAVCKAGAHVKGIPLYKHVANLAGNKN-LVLPVPAFNVINGGSHAGNKLAMQEFMILP 178
            VS+AV KA A  K +PLY H+++L+G K  +VLPVP  NV+NGGSHAG +LA QEFMI+P
Sbjct  114  VSMAVAKAAAAEKRVPLYAHISDLSGTKKPFVLPVPFMNVVNGGSHAGGRLAFQEFMIVP 173
Query  179  VGASSFKEAMKMGAEVYHHLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIA 238
             GA SF EAM+ GAEVY+ LKS+ KK+YGQ A NVGDEGG AP+IQ  +E L+L+  AI 
Sbjct  174  SGAPSFTEAMRQGAEVYQKLKSLTKKRYGQSAGNVGDEGGVAPDIQTAEEALDLITDAIE 233
Query  239  KAGYTGKVVIGMDVAASEFYGSD-KTYDLNFKEENNNGSQKISGDVLKDLYKSFVTEYPI 297
            +AGYTG++ I MDVA+SEFY +D K YDL+FK  +++ S+ I+ + L D YK +  +YPI
Sbjct  234  EAGYTGQIKIAMDVASSEFYKADEKKYDLDFKNPDSDKSKWITYEQLADQYKQLAAKYPI 293
Query  298  VSIEDPFDQDDWEHYAKLTSEIGVKVQIVGDDLLVTNPKRVEKAIKEKACNALLLKVNQI 357
            VSIEDPF +DDWE ++ +    G   QIVGDDL VTNP+ ++KAI+ KACNALLLKVNQI
Sbjct  294  VSIEDPFAEDDWEAWSYFYKTSGSDFQIVGDDLTVTNPEFIKKAIETKACNALLLKVNQI 353
Query  358  GSVTESIEAVKMSKRAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKY 417
            G++TE+I A K S  AGWGVM SHRSGETED  IAD+ VGL  GQIKTGAP RSERLAK 
Sbjct  354  GTITEAINAAKDSFAAGWGVMVSHRSGETEDVTIADIVVGLRAGQIKTGAPARSERLAKL 413
Query  418  NQLLRIEEELGAEAVYAGANFRTPV 442
            NQ+LRIEEELG +AVYAG NFRT +
Sbjct  414  NQILRIEEELGDKAVYAGDNFRTAI 438

Sequence Alignment: 11. Allergen Name: Asp f 22.0101 Sequence ID: AAK49451

 Score = 385.2 bits 1662,  Expect = 4e-108
 Identities = 274/429 63%, Positives = 333/429 77%, Gaps = 18/429 4%
Query  3    ITIVSVRARQIFDSRGNPTVEADVKLSDGYLARAAVPRGASTGIYEALELRDGG-SDYLG 61
            + I  + AR ++DSRGNPTVE DV    G L RA VP GASTG +EA ELRDG  + + G
Sbjct  1    MPISKIHARSVYDSRGNPTVEVDVATETG-LHRAIVPSGASTGQHEAHELRDGDKTQWGG 59
Query  62   KGVSKAVENVNIIIGPALVGK--DPTDQVGIDNFMVQQLDGTVNEWGWCKQKLGANAILA 119
            KGV KAV+NVN  IGPAL+ +  D  DQ  +D F+  +LDGT N     K  LGANAIL 
Sbjct  60   KGVLKAVKNVNETIGPALIKENIDVKDQSKVDEFL-NKLDGTAN-----KSNLGANAILG 113
Query  120  VSLAVCKAGAHVKGIPLYKHVANLAGNKN-LVLPVPAFNVINGGSHAGNKLAMQEFMILP 178
            VSLAV KAGA  KG+PLY H+++LAG K   VLPVP  NV+NGGSHAG +LA QEFMI+P
Sbjct  114  VSLAVAKAGAAEKGVPLYAHISDLAGTKKPYVLPVPFQNVLNGGSHAGGRLAFQEFMIVP 173
Query  179  VGASSFKEAMKMGAEVYHHLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIA 238
              A SF EA++ GAEVY+ LK++ KKKYGQ A NVGDEGG AP+IQ  +E L+L+  AI 
Sbjct  174  DSAPSFSEALRQGAEVYQKLKALAKKKYGQSAGNVGDEGGVAPDIQTAEEALDLITEAIE 233
Query  239  KAGYTGKVVIGMDVAASEFYGSD-KTYDLNFKEENNNGSQKISGDVLKDLYKSFVTEYPI 297
            +AGYTGK+ I MDVA+SEFY +D K YDL+FK   ++ S+ ++ + L DLYKS+  +YPI
Sbjct  234  QAGYTGKIKIAMDVASSEFYKADVKKYDLDFKNPESDPSKWLTYEQLADLYKSLAAKYPI 293
Query  298  VSIEDPFDQDDWEHYAKL--TSEIGVKVQIVGDDLLVTNPKRVEKAIKEKACNALLLKVN 355
            VSIEDPF +DDWE ++ +  TS+     QIVGDDL VTNP R++KAI+ K+CNALLLKVN
Sbjct  294  VSIEDPFAEDDWEAWSYFYKTSDF----QIVGDDLTVTNPGRIKKAIELKSCNALLLKVN 349
Query  356  QIGSVTESIEAVKMSKRAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLA 415
            QIG++TESI+A K S    WGVM SHRSGETED  IAD++VGL +GQIKTGAPCRSERLA
Sbjct  350  QIGTLTESIQAAKDSYADNWGVMVSHRSGETEDVTIADIAVGLRSGQIKTGAPCRSERLA 409
Query  416  KYNQLLRIEEELGAEAVYAGANFRTPV 442
            K NQ+LRIEEELG   VYAG+ FRT V
Sbjct  410  KLNQILRIEEELGENTVYAGSKFRTAV 436

Sequence Alignment: 12. Allergen Name: Cla h 6 Sequence ID: CAA55070

 Score = 379.2 bits 1636,  Expect = 2e-106
 Identities = 265/433 61%, Positives = 328/433 75%, Gaps = 12/433 2%
Query  3    ITIVSVRARQIFDSRGNPTVEADVKLSDGYLARAAVPRGASTGIYEALELRDGG-SDYLG 61
            + I  + +R ++DSRGNPTVE D+    G L RA VP  ASTG +EA ELRDG  S + G
Sbjct  1    MPISKIHSRYVYDSRGNPTVEVDIVTETG-LHRAIVPSVASTGSHEACELRDGDKSKWAG 59
Query  62   KGVSKAVENVNIIIGPALVGK--DPTDQVGIDNFMVQQLDGTVNEWGWCKQKLGANAILA 119
            KGV+KAV NVN II PAL+ +  D  DQ  +D F+  +LDGT N     K K+GANAIL 
Sbjct  60   KGVTKAVANVNEIIAPALIKENLDVKDQAAVDAFL-NKLDGTTN-----KTKIGANAILG 113
Query  120  VSLAVCKAGAHVKGIPLYKHVANLAGNKN-LVLPVPAFNVINGGSHAGNKLAMQEFMILP 178
            VS+AV KA A  K +PLY H+++L+G K  +VLPVP  NV+NGGSHAG +LA QEFMI+P
Sbjct  114  VSMAVAKAAAAEKRVPLYAHISDLSGTKKPFVLPVPFMNVVNGGSHAGGRLAFQEFMIVP 173
Query  179  VGASSFKEAMKMGAEVYHHLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIA 238
             GA SF EAM+ GAEVY+ LKS+ KK+YGQ A NVGDEGG AP+IQ  +E L+L+  AI 
Sbjct  174  SGAPSFTEAMRQGAEVYQKLKSLTKKRYGQSAGNVGDEGGVAPDIQTAEEALDLITDAIE 233
Query  239  KAGYTGKVVIGMDVAASEFYGSD-KTYDLNFKEENNNGSQKISGDVLKDLYKSFVTEYPI 297
            +AGYTG++ I MDVA+SEFY +D K YDL+FK  +++ S+ I+ + L D Y  +  +YPI
Sbjct  234  EAGYTGQIKIAMDVASSEFYKADEKKYDLDFKNPDSDKSKWITYEQLADQYNELAAKYPI 293
Query  298  VSIEDPFDQDDWEHYAKLTSEIGVKVQIVGDDLLVTNPKRVEKAIKEKACNALLLKVNQI 357
            VSIEDPF +DDWE ++ +    G   QIVGDDL VTNP+ ++KAI+ KACNALLLKVNQI
Sbjct  294  VSIEDPFAEDDWEAWSYFYKTSGSDFQIVGDDLTVTNPEFIKKAIETKACNALLLKVNQI 353
Query  358  GSVTESIEAVKMSKRAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKY 417
            G++TE+I A K S  AGWGVM SHRSGETED  IAD+ VGL  GQIKTGAP RSERLAK 
Sbjct  354  GTITEAINAAKDSFAAGWGVMVSHRSGETEDVTIADIVVGLRAGQIKTGAPARSERLAKL 413
Query  418  NQLLRIEEELGAEAVYAGANFRTPV 442
            NQ+LRIEEELG + +YAG NFRT +
Sbjct  414  NQILRIEEELGDKRLYAGDNFRTAI 438

Sequence Alignment: 13. Allergen Name: Pen c 22.0101 Sequence ID: AAK51201

 Score = 377.9 bits 1630,  Expect = 6e-106
 Identities = 270/429 62%, Positives = 332/429 77%, Gaps = 18/429 4%
Query  3    ITIVSVRARQIFDSRGNPTVEADVKLSDGYLARAAVPRGASTGIYEALELRDGG-SDYLG 61
            + I  V AR ++ SRGNPTVE DV    G L RA VP GASTG +EA+ELRDG  + + G
Sbjct  1    MPIAKVHARSVYVSRGNPTVEVDVVTETG-LHRAIVPSGASTGQHEAVELRDGDKAKWGG 59
Query  62   KGVSKAVENVNIIIGPALVGK--DPTDQVGIDNFMVQQLDGTVNEWGWCKQKLGANAILA 119
            KGV KAV+NVN  IGPAL+ +  D  DQ  +D F+  +LDGT N     K  LGANAIL 
Sbjct  60   KGVLKAVKNVNETIGPALIKENIDVKDQAKVDEFL-NKLDGTAN-----KGNLGANAILG 113
Query  120  VSLAVCKAGAHVKGIPLYKHVANLAGNKN-LVLPVPAFNVINGGSHAGNKLAMQEFMILP 178
            VSLA+ KA A  KG+PLY H+++LAG K   VLPVP  NV+NGGSHAG +LA QEFMI+P
Sbjct  114  VSLAIAKAAAAEKGVPLYVHISDLAGTKKPYVLPVPFQNVLNGGSHAGGRLAFQEFMIVP 173
Query  179  VGASSFKEAMKMGAEVYHHLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIA 238
              A SF E ++ GAEVY+ LK++ KKKYGQ A NVGDEGG AP+IQ  +E L+L+  AI 
Sbjct  174  DTAESFSEGLRQGAEVYQKLKALAKKKYGQSAGNVGDEGGVAPDIQTAEEALDLITEAIE 233
Query  239  KAGYTGKVVIGMDVAASEFYGSD-KTYDLNFKEENNNGSQKISGDVLKDLYKSFVTEYPI 297
            +AGYTGK+ I MDVA+SEFY +D K YDL+FK  +++ ++ ++ + L DLYKS+  +YPI
Sbjct  234  QAGYTGKISIAMDVASSEFYKTDAKKYDLDFKNPDSDPTKWLTYEQLADLYKSLAAKYPI 293
Query  298  VSIEDPFDQDDWEHYAKL--TSEIGVKVQIVGDDLLVTNPKRVEKAIKEKACNALLLKVN 355
            VSIEDPF +DDWE ++ +  TS+     QIVGDDL VTNP R++KAI+ K+CNALLLKVN
Sbjct  294  VSIEDPFAEDDWEAWSYFYKTSDF----QIVGDDLTVTNPLRIKKAIELKSCNALLLKVN 349
Query  356  QIGSVTESIEAVKMSKRAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLA 415
            QIG++TESI+A K S    WGVM SHRSGETED  IAD++VGL +GQIKTGAP RSERLA
Sbjct  350  QIGTLTESIQAAKDSYADNWGVMVSHRSGETEDVTIADIAVGLRSGQIKTGAPARSERLA 409
Query  416  KYNQLLRIEEELGAEAVYAGANFRTPV 442
            K NQ+LRIEEELG  A+YAG NFRT V
Sbjct  410  KLNQILRIEEELGENAIYAGKNFRTSV 436

Sequence Alignment: 14. Allergen Name: Alt a 5 Sequence ID: Q9HDT3

 Score = 377.6 bits 1629,  Expect = 7e-106
 Identities = 266/431 61%, Positives = 330/431 76%, Gaps = 14/431 3%
Query  3    ITIVSVRARQIFDSRGNPTVEADVKLSDGYLARAAVPRGASTGIYEALELRDGG-SDYLG 61
            +TI  + AR ++DSRGNPTVE D+    G L RA VP GASTG +EA ELRDG  S + G
Sbjct  1    MTITKIHARSVYDSRGNPTVEVDIVTETG-LHRAIVPSGASTGSHEACELRDGDKSKWGG 59
Query  62   KGVSKAVENVNIIIGPALVGK--DPTDQVGIDNFMVQQLDGTVNEWGWCKQKLGANAILA 119
            KGV+KAV NVN  I PAL+ +  D  DQ  +D F+  +LDGT N     K  LGANAIL 
Sbjct  60   KGVTKAVANVNDTIAPALIKEKLDVKDQSAVDAFL-NKLDGTTN-----KTNLGANAILG 113
Query  120  VSLAVCKAGAHVKGIPLYKHVANLAGNKN-LVLPVPAFNVINGGSHAGNKLAMQEFMILP 178
            VS+A+ KA A  KG+PLY H+++LAG K   VLPVP  NV+NGGSHAG +LA QEFMI+P
Sbjct  114  VSMAIAKAAAAEKGVPLYAHISDLAGTKKPYVLPVPFQNVLNGGSHAGGRLAFQEFMIVP 173
Query  179  VGASSFKEAMKMGAEVYHHLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIA 238
              A +F EAM+ GAEVY+ LK++ KK YGQ A NVGDEGG AP+IQ  +E L+L+  AI 
Sbjct  174  CEAPTFSEAMRQGAEVYQKLKALAKKTYGQSAGNVGDEGGVAPDIQTAEEALDLITKAIE 233
Query  239  KAGYTGKVVIGMDVAASEFYGSD-KTYDLNFKEENNNGSQKISGDVLKDLYKSFVTEYPI 297
            +AGYTGK+ I MDVA+SEFY +D K YDL+FK  +++ S+ ++ + L ++YKS+  +YPI
Sbjct  234  EAGYTGKIKIAMDVASSEFYKADEKKYDLDFKNPDSDKSKWLTYEQLAEMYKSLAEKYPI 293
Query  298  VSIEDPFDQDDWEHYAKLTSEIGVKVQIVGDDLLVTNPKRVEKAIKEKACNALLLKVNQI 357
            VSIEDPF +DDWE ++ +        QIVGDDL VTNP+ ++KAI+ K+CNALLLKVNQI
Sbjct  294  VSIEDPFAEDDWEAWSYFFKTYDG--QIVGDDLTVTNPEFIKKAIELKSCNALLLKVNQI 351
Query  358  GSVTESIEAVKMSKRAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKY 417
            G++TE+I+A K +  AGWGVM SHRSGETED  IAD+ VGL +GQIKTGAP RSERLAK 
Sbjct  352  GTITEAIQAAKDAFGAGWGVMVSHRSGETEDVTIADIVVGLRSGQIKTGAPARSERLAKL 411
Query  418  NQLLRIEEELGAEAVYAGANFRTPV 442
            NQ+LRIEEELG  AVYAG NFRT V
Sbjct  412  NQILRIEEELGDNAVYAGNNFRTAV 436

Sequence Alignment: 15. Allergen Name: Cur l 2.0101 Sequence ID: AAK67491

 Score = 347.8 bits 1498,  Expect = 7e-97
 Identities = 253/432 58%, Positives = 324/432 75%, Gaps = 20/432 4%
Query  1    MAITIVSVRARQIFDSRGNPTVEADVKLSDGYLARAAVPRGASTGIYEALELRDGG-SDY 59
            MAIT   + AR ++DSRGNPTVE D+    G L RA VP GASTG +EA ELRDG  + +
Sbjct  1    MAIT--KIHARSVYDSRGNPTVEVDIVTETG-LHRAIVPSGASTGSHEACELRDGDKTKW 57
Query  60   LGKGVSKAVENVNIIIGPALVGK--DPTDQVGIDNFMVQQLDGTVNEWGWCKQKLGANAI 117
             GKGV+KAV NVN II PAL+ +  D  DQ  +D F+  +LDGT N     K KLGANAI
Sbjct  58   GGKGVTKAVANVNDIIAPALIKEKLDVKDQSAVDAFL-NKLDGTEN-----KTKLGANAI 111
Query  118  LAVSLAVCKAGAHVKGIPLYKHVANLAGNKN-LVLPVPAFNVINGGSHAGNKLAMQEFMI 176
            L VS+A+ KA A  KG+PLY H+++LAG K   V+   + NV+NGGSHAG  L  QEFMI
Sbjct  112  LGVSMAIAKAAAAEKGVPLYAHISDLAGTKKPYVFRFLSKNVLNGGSHAGGFLLFQEFMI 171
Query  177  LPVGASSFKEAMKM--GAEVYHHLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLK 234
             P  A +F EA+++  GAEVY+ LK++ KK YGQ A N GDEGG AP+IQ  +E L+L+ 
Sbjct  172  AP--AKTFAEALRIRQGAEVYQKLKALTKKTYGQSAGNYGDEGGVAPDIQTAEEALDLIV 229
Query  235  TAIAKAGYTGKVVIGMDVAASEFYGSD-KTYDLNFKEENNNGSQKISGDVLKDLYKSFVT 293
             AI  AG+TG++ I MDVA+SEF+  D K YDL+FK  +++ S+ ++   L ++YKS+  
Sbjct  230  DAIEAAGHTGQIKIAMDVASSEFFKDDEKKYDLDFKNPDSDKSKWLTYPQLAEMYKSLAE 289
Query  294  EYPIVSIEDPFDQDDWEHYAKLTSEIGVKVQIVGDDLLVTNPKRVEKAIKEKACNALLLK 353
            +YPIVSIEDPF +DDWE ++ +  + G   QIVGDDL VTNP+ ++ AI+ K+CNALLLK
Sbjct  290  KYPIVSIEDPFAEDDWEAWSHFYKD-G-DFQIVGDDLTVTNPEFIKTAIELKSCNALLLK 347
Query  354  VNQIGSVTESIEAVKMSKRAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSER 413
            VNQIG+++E+I A K +  AGWGVM SHRSGETED  IAD+ VGL +GQIKT AP RSER
Sbjct  348  VNQIGTISEAINAAKDAFGAGWGVMVSHRSGETEDVTIADIVVGLRSGQIKTNAPARSER 407
Query  414  LAKYNQLLRIEEELGAEAVYAGANFRTPVEPY 445
            LAKYNQ+LRIEEELG + ++AG  F T +  Y
Sbjct  408  LAKYNQILRIEEELGDKRLFAGNKFHTAINLY 439

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.