The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAKAIVLLSALCILALANFAHCRPEVFDVEGKVYCDTCRVQFETKLSENLEGATVKLQCR
NISTEAETFSVEGVTDKDGKYKLTVNGDHENDICEVTVVKSPREDCKESVSGYEKARIEC
SDNVGIHNAVRFANPLFFMKAESVQGCKEALDELGLFPLEF
Sequence Info Allergen Name Length Opt Bits Score E Value
CAA33854 Lyc e LAT52 161 1070 267.9 9.7e-74
AAL07319 Che a 1 168 496 128.1 1.2e-31
A0A0K1SC10 Ama r 1.0101 168 485 125.4 7.7e-31
AKV72167 Pro j 1.0101 150 430 112.0 7.7e-27
ADK22842 Sal k 5.0101 151 424 110.5 2.1e-26
A0A0K1SC44 Koc s 1.0101 167 419 109.3 5.3e-26
A0A0K1SC24 Aca f 1 150 415 108.3 9.7e-26
Q7M1X5 Lol p 11.0101 134 371 97.5 1.5e-22
AAQ83588 Fra e 1.0201 146 368 96.9 2.7e-22
CAA73036 Ole e 1.0107 146 365 96.1 4.4e-22
X76396 Ole e 1.0103 145 364 95.9 5.2e-22
CAA73038 Ole e 1.0105 146 361 95.2 8.7e-22
P19963 Ole e 1 145 360 94.9 1e-21
O82015 Lig v 1 145 358 94.4 1.4e-21
CAA54819 Lig v 1.0102 145 357 94.2 1.7e-21
X76395 Ole e 1.0102 145 355 93.7 2.4e-21
CAA73037 Ole e 1.0106 146 354 93.5 2.8e-21
X76397 Ole e 1.0104 145 350 92.5 5.5e-21
AAV74343 Fra e 1.0102 145 348 92.0 7.8e-21
AAQ08947 Fra e 1.0101 145 346 91.5 1.1e-20
AAN32987 Phl p 11.0101 143 344 91.0 1.5e-20
AAB32652 Ole e 1.0101 130 329 87.3 1.8e-19
P82242 Pla l 1 131 284 76.3 3.6e-16
CAC41635 Pla l 1.0103 131 274 73.9 1.9e-15
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Lyc e LAT52 Sequence ID: CAA33854

 Score = 267.9 bits 1070,  Expect = 1e-73
 Identities = 161/161 100%, Positives = 161/161 100%, Gaps = 0/161 0%
Query  1    MAKAIVLLSALCILALANFAHCRPEVFDVEGKVYCDTCRVQFETKLSENLEGATVKLQCR 60
            MAKAIVLLSALCILALANFAHCRPEVFDVEGKVYCDTCRVQFETKLSENLEGATVKLQCR
Sbjct  1    MAKAIVLLSALCILALANFAHCRPEVFDVEGKVYCDTCRVQFETKLSENLEGATVKLQCR 60
Query  61   NISTEAETFSVEGVTDKDGKYKLTVNGDHENDICEVTVVKSPREDCKESVSGYEKARIEC 120
            NISTEAETFSVEGVTDKDGKYKLTVNGDHENDICEVTVVKSPREDCKESVSGYEKARIEC
Sbjct  61   NISTEAETFSVEGVTDKDGKYKLTVNGDHENDICEVTVVKSPREDCKESVSGYEKARIEC 120
Query  121  SDNVGIHNAVRFANPLFFMKAESVQGCKEALDELGLFPLEF 161
            SDNVGIHNAVRFANPLFFMKAESVQGCKEALDELGLFPLEF
Sbjct  121  SDNVGIHNAVRFANPLFFMKAESVQGCKEALDELGLFPLEF 161

Sequence Alignment: 2. Allergen Name: Che a 1 Sequence ID: AAL07319

 Score = 128.1 bits 496,  Expect = 1e-31
 Identities = 79/160 49%, Positives = 109/160 68%, Gaps = 6/160 3%
Query  1    MAK--AIVLL-SALCILALANFAHCRPEVFDVEGKVYCDTCRVQFETKLSENLEGATVKL 57
            MAK  A+ LL  ALC+L+LA  A+     F V+G VYCDTCR+QF T++S  +EGATVKL
Sbjct  1    MAKCQAVFLLVGALCVLSLAGVANAAENHFKVQGMVYCDTCRIQFMTRISTIMEGATVKL 60
Query  58   QCRNISTEAETFSVEGVTDKDGKYKLTVNGDHENDICEVTVVKSPREDCKE---SVSGYE 114
            +CRNI+   +TF  E VTDK G+Y + VNGD E+DICE+ +VKSP  +C E    V   +
Sbjct  61   ECRNITAGTQTFKAEAVTDKVGQYSIPVNGDFEDDICEIELVKSPNSECSEVSHDVYAKQ 120
Query  115  KARIECSDNVGIHNAVRFANPLFFMKAESVQGCKEALDELGLFPLE 160
             A++  + N G  + +R AN L FM+ E ++ C E L EL L+ ++
Sbjct  121  SAKVSLTSNNGEASDIRSANALGFMRKEPLKECPEVLKELDLYDVK 166

Sequence Alignment: 3. Allergen Name: Ama r 1.0101 Sequence ID: A0A0K1SC10

 Score = 125.4 bits 485,  Expect = 8e-31
 Identities = 77/160 48%, Positives = 108/160 67%, Gaps = 6/160 3%
Query  1    MAK--AIVLL-SALCILALANFAHCRPEVFDVEGKVYCDTCRVQFETKLSENLEGATVKL 57
            MAK  A+ LL  ALC+L+L + A      F ++G VYCDTCR+QF T++S  +EGATVKL
Sbjct  1    MAKCQAVFLLVGALCVLSLDDVAKAPVSQFHIQGLVYCDTCRIQFMTRISTIMEGATVKL 60
Query  58   QCRNISTEAETFSVEGVTDKDGKYKLTVNGDHENDICEVTVVKSPREDCKE---SVSGYE 114
            +CRNI+   +TF  E VTDK G+Y + VNGD E+DICE+ +VKSP  +C E    V   +
Sbjct  61   ECRNITAGTQTFKAEAVTDKVGQYSIPVNGDFEDDICEIELVKSPNSECSEVSHDVYAKQ 120
Query  115  KARIECSDNVGIHNAVRFANPLFFMKAESVQGCKEALDELGLFPLE 160
             A++  + N G  + +R AN L FM+ E ++ C E L EL L+ ++
Sbjct  121  SAKVSLTSNNGEASDIRSANALGFMRKEPLEECPEVLKELDLYDVK 166

Sequence Alignment: 4. Allergen Name: Pro j 1.0101 Sequence ID: AKV72167

 Score = 112.0 bits 430,  Expect = 8e-27
 Identities = 65/131 49%, Positives = 89/131 67%, Gaps = 5/131 3%
Query  23   RPEV--FDVEGKVYCDTCRVQFETKLSENLEGATVKLQCRNISTEAETFSVEGVTDKDGK 80
            +P V  F ++G VYCDTCR+QF T++S  +EGATVKL+CRNI+   +TF  E VTDK G+
Sbjct  5    KPPVSQFHIQGLVYCDTCRIQFMTRVSTIMEGATVKLECRNITAGTQTFKAEAVTDKVGQ 64
Query  81   YKLTVNGDHENDICEVTVVKSPREDCKE---SVSGYEKARIECSDNVGIHNAVRFANPLF 137
            Y + VNGD E+DICE+ +VKSP  DC E    V   + A++  + N G  + +R AN L 
Sbjct  65   YSIPVNGDFEDDICEIELVKSPNSDCSEIPHDVYAKQSAKVSLTSNNGEASDIRSANALG 124
Query  138  FMKAESVQGCKEALDE 153
            FM+ E ++ C E   E
Sbjct  125  FMRKEPLKECPEVSKE 140

Sequence Alignment: 5. Allergen Name: Sal k 5.0101 Sequence ID: ADK22842

 Score = 110.5 bits 424,  Expect = 2e-26
 Identities = 63/132 47%, Positives = 89/132 67%, Gaps = 3/132 2%
Query  26   VFDVEGKVYCDTCRVQFETKLSENLEGATVKLQCRNISTEAETFSVEGVTDKDGKYKLTV 85
            ++ V+G VYCDTCR+QF T++S  +EGATV LQCRN++   ETF  E VTDK G Y + V
Sbjct  8    LYHVKGMVYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKLGMYTIKV 67
Query  86   NGDHENDICEVTVVKSPREDCKE---SVSGYEKARIECSDNVGIHNAVRFANPLFFMKAE 142
            +GDHE+DIC++ +VKSP ++C E    V   + A++  + N G  + VR AN L F+K  
Sbjct  68   DGDHEDDICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNGEASDVRNANALGFLKKA 127
Query  143  SVQGCKEALDELGLF 157
             +  C E L EL ++
Sbjct  128  PLPECPEVLKELDMY 142

Sequence Alignment: 6. Allergen Name: Koc s 1.0101 Sequence ID: A0A0K1SC44

 Score = 109.3 bits 419,  Expect = 5e-26
 Identities = 72/159 45%, Positives = 101/159 63%, Gaps = 7/159 4%
Query  1    MAK--AIVLL-SALCILALANFAHCRPEVFDVEGKVYCDTCRVQFETKLSENLEGATVKL 57
            MAK  A+ LL  ALC+L+L + A      F ++G VYCDTC     + +   LEGATVKL
Sbjct  1    MAKCQAVFLLVGALCVLSLDDVAKAPVSQFHIQGLVYCDTCPYP-SSYVLPMLEGATVKL 59
Query  58   QCRNISTEAETFSVEGVTDKDGKYKLTVNGDHENDICEVTVVKSPREDCKE---SVSGYE 114
            +CRNI+   +TF  E VTDK G+Y + V+GD E+DICE+ ++KSP   C E    V   +
Sbjct  60   ECRNITAGTQTFKAEAVTDKVGQYSIPVDGDFEDDICEIELLKSPDNQCSEVSHDVYAKQ 119
Query  115  KARIECSDNVGIHNAVRFANPLFFMKAESVQGCKEALDELGLFPLE 160
             A++  + N G  + VR AN L FM+ E ++ C E L EL L+ ++
Sbjct  120  SAKVSLTSNNGEASDVRSANALGFMRKEPLEECPEVLKELDLYDVK 165

Sequence Alignment: 7. Allergen Name: Aca f 1 Sequence ID: A0A0K1SC24

 Score = 108.3 bits 415,  Expect = 1e-25
 Identities = 66/131 50%, Positives = 86/131 65%, Gaps = 5/131 3%
Query  23   RPEV--FDVEGKVYCDTCRVQFETKLSENLEGATVKLQCRNISTEAETFSVEGVTDKDGK 80
            +P V  F V+G VYCDTCR  F T+ S  +EGATVKL+CRNI+   +TF  E VTDK G+
Sbjct  5    KPPVSQFHVQGLVYCDTCRYPFITEASPIMEGATVKLECRNITAGTQTFKAEAVTDKVGQ 64
Query  81   YKLTVNGDHENDICEVTVVKSPREDCKE---SVSGYEKARIECSDNVGIHNAVRFANPLF 137
            Y + V+GDHE+DICE+ +VKSP   C E    V   + A++  + N G  + VR AN L 
Sbjct  65   YSIPVDGDHEDDICEIELVKSPDNQCSEIPHDVYAKQSAKVSLTSNNGEASDVRSANALG 124
Query  138  FMKAESVQGCKEALDE 153
            FM+ E +  C E L E
Sbjct  125  FMRKEPLPECPEVLKE 140

Sequence Alignment: 8. Allergen Name: Lol p 11.0101 Sequence ID: Q7M1X5

 Score = 97.5 bits 371,  Expect = 2e-22
 Identities = 52/121 42%, Positives = 75/121 61%, Gaps = 1/121 0%
Query  27   FDVEGKVYCDTCRVQFETKLSENLEGATVKLQCRNISTEAETFSVEGVTDKDGKYKLTVN 86
            F V G+VYCD CR  FET +S N+EGATV + CR        +  E  TDKDG YK+ ++
Sbjct  6    FVVTGRVYCDPCRAGFETNVSHNVEGATVAVDCRPFDGGESKLKAEATTDKDGWYKIEID 65
Query  87   GDHENDICEVTVVKSPREDCKESVSGYEKARIECSDNVGI-HNAVRFANPLFFMKAESVQ 145
             DH+ +ICEV + KSP + C E     ++AR+  + N GI +  +R+ANP+ F + E ++
Sbjct  66   QDHQEEICEVVLAKSPDKSCSEIEEFRDRARVPLTSNXGIKQQGIRYANPIAFFRKEPLK 125
Query  146  GC 147
             C
Sbjct  126  EC 127

Sequence Alignment: 9. Allergen Name: Fra e 1.0201 Sequence ID: AAQ83588

 Score = 96.9 bits 368,  Expect = 3e-22
 Identities = 56/135 41%, Positives = 87/135 64%, Gaps = 4/135 2%
Query  23   RPEV--FDVEGKVYCDTCRVQFETKLSENLEGATVKLQCRNISTEAETFSVEGVTDKDGK 80
            +P V  F ++G+VYCDTCR +F TKLSE + GA+V+LQCR+      TF+  G T  +G 
Sbjct  6    QPPVSQFHIQGQVYCDTCRARFITKLSEFITGASVRLQCRDKENGDVTFTEIGYTRGEGL 65
Query  81   YKLTVNGDHENDICEVTVVKSPREDCKE-SVSGYEKARIECSDNVGIHNAVRFANPLFFM 139
            Y + V  DH+N+ CE+T++ S R+DC E  + G+ K  ++   N  ++   R  NPL F 
Sbjct  66   YSMFVERDHKNEFCEITLLSSGRKDCNEIPIEGWVKPSLKFILNT-VNGTTRTINPLGFF 124
Query  140  KAESVQGCKEALDELGLFP 158
            K E++  C +  ++LG++P
Sbjct  125  KKEALPQCAQVYNKLGMYP 143

Sequence Alignment: 10. Allergen Name: Ole e 1.0107 Sequence ID: CAA73036

 Score = 96.1 bits 365,  Expect = 4e-22
 Identities = 55/135 40%, Positives = 86/135 63%, Gaps = 4/135 2%
Query  23   RPEV--FDVEGKVYCDTCRVQFETKLSENLEGATVKLQCRNISTEAETFSVEGVTDKDGK 80
            +P V  F ++G+VYCDTCR +F T+LSE + GA+V+LQCR       TF+  G T  +G 
Sbjct  6    QPPVSQFHIQGQVYCDTCRSRFITELSEFIPGASVRLQCREKENGDITFTEIGYTRAEGL 65
Query  81   YKLTVNGDHENDICEVTVVKSPREDCKE-SVSGYEKARIECSDNVGIHNAVRFANPLFFM 139
            Y + V  DH+N+ CE+T++ S R+DC E  + G+ K  ++   N  ++   R  NPL F 
Sbjct  66   YSMLVERDHKNEFCEITLISSGRKDCDEIPIEGWAKPSLKFILNT-VNGTTRTVNPLGFF 124
Query  140  KAESVQGCKEALDELGLFP 158
            K E++  C +  ++LG++P
Sbjct  125  KKEALPKCAQVYNKLGMYP 143

Sequence Alignment: 11. Allergen Name: Ole e 1.0103 Sequence ID: X76396

 Score = 95.9 bits 364,  Expect = 5e-22
 Identities = 53/135 39%, Positives = 89/135 65%, Gaps = 4/135 2%
Query  23   RPEV--FDVEGKVYCDTCRVQFETKLSENLEGATVKLQCRNISTEAETFSVEGVTDKDGK 80
            +P V  F ++G+VYCDTCR +F T+LSE + GA+V+LQC++    + TF+  G T  +G 
Sbjct  5    QPPVSQFHIQGQVYCDTCRARFITELSEFIPGASVRLQCKDGENGSITFTEVGYTRAEGL 64
Query  81   YKLTVNGDHENDICEVTVVKSPREDCKE-SVSGYEKARIECSDNVGIHNAVRFANPLFFM 139
            Y + +  DH+++ CE+T++ S R+DC E  V G+ K  ++   N  ++   R  NPL F 
Sbjct  65   YSMLIERDHKDEFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNT-VNGTTRTINPLGFF 123
Query  140  KAESVQGCKEALDELGLFP 158
            K E++  C + +++LG++P
Sbjct  124  KKEALPKCPQVFNKLGMYP 142

Sequence Alignment: 12. Allergen Name: Ole e 1.0105 Sequence ID: CAA73038

 Score = 95.2 bits 361,  Expect = 9e-22
 Identities = 54/135 40%, Positives = 85/135 62%, Gaps = 4/135 2%
Query  23   RPEV--FDVEGKVYCDTCRVQFETKLSENLEGATVKLQCRNISTEAETFSVEGVTDKDGK 80
            +P V  F ++G+VYCDTCR  F T+LSE + GA+V+LQC++      TF+  G T  +G 
Sbjct  6    QPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTRAEGL 65
Query  81   YKLTVNGDHENDICEVTVVKSPREDCKE-SVSGYEKARIECSDNVGIHNAVRFANPLFFM 139
            Y + V  DH+N+ CE+T++ S R+DC E    G+ K  ++   N  ++   R  NPL F 
Sbjct  66   YSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILNT-VNGTTRTVNPLRFY 124
Query  140  KAESVQGCKEALDELGLFP 158
            K E++  C +  ++LG++P
Sbjct  125  KKEALPKCAQVYNKLGMYP 143

Sequence Alignment: 13. Allergen Name: Ole e 1 Sequence ID: P19963

 Score = 94.9 bits 360,  Expect = 1e-21
 Identities = 53/135 39%, Positives = 85/135 62%, Gaps = 4/135 2%
Query  23   RPEV--FDVEGKVYCDTCRVQFETKLSENLEGATVKLQCRNISTEAETFSVEGVTDKDGK 80
            +P V  F ++G+VYCDTCR  F T+LSE + GA+++LQC++      TF+  G T  +G 
Sbjct  5    QPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGL 64
Query  81   YKLTVNGDHENDICEVTVVKSPREDCKE-SVSGYEKARIECSDNVGIHNAVRFANPLFFM 139
            Y + V  DH+N+ CE+T++ S R+DC E    G+ K  ++   N  ++   R  NPL F 
Sbjct  65   YSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNT-VNGTTRTVNPLGFF 123
Query  140  KAESVQGCKEALDELGLFP 158
            K E++  C +  ++LG++P
Sbjct  124  KKEALPKCAQVYNKLGMYP 142

Sequence Alignment: 14. Allergen Name: Lig v 1 Sequence ID: O82015

 Score = 94.4 bits 358,  Expect = 1e-21
 Identities = 53/135 39%, Positives = 86/135 63%, Gaps = 4/135 2%
Query  23   RPEV--FDVEGKVYCDTCRVQFETKLSENLEGATVKLQCRNISTEAETFSVEGVTDKDGK 80
            +P V  F ++G+VYCDTCR +F T+LSE + GA V+LQC++      TF+  G T  +G 
Sbjct  5    QPPVSQFYIQGQVYCDTCRARFITELSEFIPGAGVRLQCKDGENGKVTFTEVGYTKAEGL 64
Query  81   YKLTVNGDHENDICEVTVVKSPREDCKE-SVSGYEKARIECSDNVGIHNAVRFANPLFFM 139
            Y + +  DH+N+ CE+T++ S R+DC E    G+ K  ++   N  ++   R  NPL F+
Sbjct  65   YNMLIERDHKNEFCEITLISSSRKDCDEIPTEGWVKPSLKFVLNT-VNGTTRTINPLGFL 123
Query  140  KAESVQGCKEALDELGLFP 158
            K E +  C + +++LG++P
Sbjct  124  KKEVLPKCPQVFNKLGMYP 142

Sequence Alignment: 15. Allergen Name: Lig v 1.0102 Sequence ID: CAA54819

 Score = 94.2 bits 357,  Expect = 2e-21
 Identities = 53/135 39%, Positives = 87/135 64%, Gaps = 4/135 2%
Query  23   RPEV--FDVEGKVYCDTCRVQFETKLSENLEGATVKLQCRNISTEAETFSVEGVTDKDGK 80
            +P V  F ++G+VYCDTCR +F T+LSE + GA V+LQC++      TF+  G T  +G 
Sbjct  5    QPPVSQFYIQGQVYCDTCRARFITELSEFIPGAGVRLQCKDGENGKITFTEVGYTRAEGL 64
Query  81   YKLTVNGDHENDICEVTVVKSPREDCKE-SVSGYEKARIECSDNVGIHNAVRFANPLFFM 139
            Y + +  DH+N+ CE+T++ S R+DC E  + G+ K  ++   N  ++   R  NPL F 
Sbjct  65   YSMLIERDHKNEFCEITLLSSSRKDCDEIPIEGWVKPSLKFMLNT-VNGTTRTINPLGFF 123
Query  140  KAESVQGCKEALDELGLFP 158
            K E++  C + +++LG++P
Sbjct  124  KKEALPKCPQVFNKLGMYP 142

Sequence Alignment: 16. Allergen Name: Ole e 1.0102 Sequence ID: X76395

 Score = 93.7 bits 355,  Expect = 2e-21
 Identities = 53/135 39%, Positives = 85/135 62%, Gaps = 4/135 2%
Query  23   RPEV--FDVEGKVYCDTCRVQFETKLSENLEGATVKLQCRNISTEAETFSVEGVTDKDGK 80
            +P V  F ++G+VYCDTCR  F T+LSE + GA+++LQC++      TF+  G T  +G 
Sbjct  5    QPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGL 64
Query  81   YKLTVNGDHENDICEVTVVKSPREDCKE-SVSGYEKARIECSDNVGIHNAVRFANPLFFM 139
            Y + V  DH+N+ CE+T++ S R+DC E    G+ K  ++   N  ++   R  NPL F 
Sbjct  65   YSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWVKPSLKFILNT-VNGTTRTVNPLGFF 123
Query  140  KAESVQGCKEALDELGLFP 158
            K E++  C +  ++LG++P
Sbjct  124  KKEALPKCAQVYNKLGMYP 142

Sequence Alignment: 17. Allergen Name: Ole e 1.0106 Sequence ID: CAA73037

 Score = 93.5 bits 354,  Expect = 3e-21
 Identities = 53/135 39%, Positives = 85/135 62%, Gaps = 4/135 2%
Query  23   RPEV--FDVEGKVYCDTCRVQFETKLSENLEGATVKLQCRNISTEAETFSVEGVTDKDGK 80
            +P V  F ++G+VYCDTCR  F T+LSE + GA+V+LQC++      TF+  G T  +G 
Sbjct  6    QPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTRAEGL 65
Query  81   YKLTVNGDHENDICEVTVVKSPREDCKE-SVSGYEKARIECSDNVGIHNAVRFANPLFFM 139
            Y + V  DH+N+ CE+T++ S R+DC E    G+ K  ++   +  ++   R  NPL F 
Sbjct  66   YSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILST-VNGTTRTVNPLGFY 124
Query  140  KAESVQGCKEALDELGLFP 158
            K E++  C +  ++LG++P
Sbjct  125  KKEALPKCAQVYNKLGMYP 143

Sequence Alignment: 18. Allergen Name: Ole e 1.0104 Sequence ID: X76397

 Score = 92.5 bits 350,  Expect = 6e-21
 Identities = 51/131 38%, Positives = 83/131 63%, Gaps = 2/131 1%
Query  27   FDVEGKVYCDTCRVQFETKLSENLEGATVKLQCRNISTEAETFSVEGVTDKDGKYKLTVN 86
            F V+G+VYCDTCR +F T++SE + GA V+LQC++      TF+  G T  +G Y + + 
Sbjct  11   FYVQGQVYCDTCRTRFITEFSEFIPGAGVRLQCKDGENGKITFTEVGYTRAEGLYSMLIE 70
Query  87   GDHENDICEVTVVKSPREDCKE-SVSGYEKARIECSDNVGIHNAVRFANPLFFMKAESVQ 145
             DH+N+ CE+T++ S R+DC E    G+ K  ++   N  ++   R  NPL F K E++ 
Sbjct  71   RDHKNEFCEITLLSSSRKDCDEIPTEGWVKPSVKFILNT-VNGTTRTINPLGFFKKEALP 129
Query  146  GCKEALDELGLFP 158
             C + +++LG++P
Sbjct  130  KCPQVFNKLGMYP 142

Sequence Alignment: 19. Allergen Name: Fra e 1.0102 Sequence ID: AAV74343

 Score = 92.0 bits 348,  Expect = 8e-21
 Identities = 51/132 38%, Positives = 81/132 61%, Gaps = 2/132 1%
Query  26   VFDVEGKVYCDTCRVQFETKLSENLEGATVKLQCRNISTEAETFSVEGVTDKDGKYKLTV 85
            +F V+G+VYCDTCR  F T+LSE ++GA V+LQC+       TF+  G T  +G Y + +
Sbjct  10   LFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKEKENGKVTFTEVGYTRAEGLYSMVI 69
Query  86   NGDHENDICEVTVVKSPREDCKE-SVSGYEKARIECSDNVGIHNAVRFANPLFFMKAESV 144
              DH+N+ CE+ ++ S R+DC E    G+ K  ++   N  ++   R  NPL F K E++
Sbjct  70   ERDHKNEFCEIVLLSSSRKDCHEIPTEGWVKPSLKFILNT-VNGTTRTINPLGFFKKEAL 128
Query  145  QGCKEALDELGLFP 158
              C +  ++LG++P
Sbjct  129  PKCPQVYNKLGMYP 142

Sequence Alignment: 20. Allergen Name: Fra e 1.0101 Sequence ID: AAQ08947

 Score = 91.5 bits 346,  Expect = 1e-20
 Identities = 51/132 38%, Positives = 81/132 61%, Gaps = 2/132 1%
Query  26   VFDVEGKVYCDTCRVQFETKLSENLEGATVKLQCRNISTEAETFSVEGVTDKDGKYKLTV 85
            +F V+G+VYCDTCR  F T+LSE ++GA V+LQC++      TF+  G T  +G Y + +
Sbjct  10   LFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKDKENGKVTFTEVGYTRAEGLYSMVI 69
Query  86   NGDHENDICEVTVVKSPREDCKE-SVSGYEKARIECSDNVGIHNAVRFANPLFFMKAESV 144
              DH+N+ CE+ ++ S R+DC E    G+ K  ++   N  ++   R  NPL F K E +
Sbjct  70   ERDHKNEFCEIVLLSSSRKDCDEIPTEGWVKPSLKFILNT-VNGTTRTINPLGFFKKEVL 128
Query  145  QGCKEALDELGLFP 158
              C +  ++LG++P
Sbjct  129  PKCPQVYNKLGMYP 142

Sequence Alignment: 21. Allergen Name: Phl p 11.0101 Sequence ID: AAN32987

 Score = 91.0 bits 344,  Expect = 2e-20
 Identities = 51/130 39%, Positives = 75/130 57%, Gaps = 1/130 0%
Query  27   FDVEGKVYCDTCRVQFETKLSENLEGATVKLQCRNISTEAETFSVEGVTDKDGKYKLTVN 86
            F V G+VYCD CR  FET +S N++GATV + CR  +     +  E  TD  G YK+ ++
Sbjct  6    FVVTGRVYCDPCRAGFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGLGWYKIEID 65
Query  87   GDHENDICEVTVVKSPREDCKESVSGYEKARIECSDNVGI-HNAVRFANPLFFMKAESVQ 145
             DH+ +ICEV + KSP   C E     ++AR+  + N GI +  +R+ANP+ F + E ++
Sbjct  66   QDHQEEICEVVLAKSPDTTCSEIEEFRDRARVPLTSNNGIKQQGIRYANPIAFFRKEPLK 125
Query  146  GCKEALDELGL 156
             C   L    L
Sbjct  126  ECGGILQAYDL 136

Sequence Alignment: 22. Allergen Name: Ole e 1.0101 Sequence ID: AAB32652

 Score = 87.3 bits 329,  Expect = 2e-19
 Identities = 49/126 38%, Positives = 76/126 60%, Gaps = 2/126 1%
Query  32   KVYCDTCRVQFETKLSENLEGATVKLQCRNISTEAETFSVEGVTDKDGKYKLTVNGDHEN 91
            +VYCDTCR  F T+LSE + GA+V+LQC+       TF+  G T  +G Y + V  DH+N
Sbjct  1    QVYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHKN 60
Query  92   DICEVTVVKSPREDCKE-SVSGYEKARIECSDNVGIHNAVRFANPLFFMKAESVQGCKEA 150
            + CE+T++ S  +DC E    G+ K  ++   N  ++   R  NPL F K E++  C + 
Sbjct  61   EFCEITLISSGSKDCNEIPTEGWAKPSLKFILNT-VNGTTRTVNPLGFFKKEALPKCAQV 119
Query  151  LDELGLFP 158
             ++LG++P
Sbjct  120  YNKLGMYP 127

Sequence Alignment: 23. Allergen Name: Pla l 1 Sequence ID: P82242

 Score = 76.3 bits 284,  Expect = 4e-16
 Identities = 48/121 39%, Positives = 71/121 58%, Gaps = 8/121 6%
Query  24   PEVFDVEGKVYCDTCRVQ-FETKLSENLEGATVKLQCRNISTEAETFSVEGVTDKDGKYK 82
            P  F VEG+VYC+ C  + +  +LSE + GA V+L C++ S +   +S+ G TD+DG Y+
Sbjct  6    PAKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKDDSKKV-IYSIGGETDQDGVYR 64
Query  83   LTVNGDHENDICEVTVVKSPREDCKE----SVSGYEKARIECSDNVGIHNAVRFANPLFF 138
            L V G HE+  CE+ +VKS R DC E    +    + ++++ S N  I    R   PL F
Sbjct  65   LPVVGYHED--CEIKLVKSSRPDCSEIPKLAKGTIQTSKVDLSKNTTITEKTRHVKPLSF 122
Query  139  MKAESVQGC 147
                   GC
Sbjct  123  RAKTDAPGC 131

Sequence Alignment: 24. Allergen Name: Pla l 1.0103 Sequence ID: CAC41635

 Score = 73.9 bits 274,  Expect = 2e-15
 Identities = 47/121 38%, Positives = 70/121 57%, Gaps = 8/121 6%
Query  24   PEVFDVEGKVYCDTCRVQ-FETKLSENLEGATVKLQCRNISTEAETFSVEGVTDKDGKYK 82
            P  F VEG+VYC+ C  + +  +LSE + GA V+L C++ S +   +S+ G T +DG Y+
Sbjct  6    PAKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKDDSKKV-IYSIGGETGQDGVYR 64
Query  83   LTVNGDHENDICEVTVVKSPREDCKE----SVSGYEKARIECSDNVGIHNAVRFANPLFF 138
            L V G HE+  CE+ +VKS R DC E    +    + ++++ S N  I    R   PL F
Sbjct  65   LPVVGYHED--CEIKLVKSGRPDCSEIPKLAKGTIQTSKVDLSKNTTITEKTRHVKPLSF 122
Query  139  MKAESVQGC 147
                   GC
Sbjct  123  RAKTDAPGC 131

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.