The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAKCQAVFLLVGALCVLSLDDVAKAPVSQFHIQGLVYCDTCRIQFMTRISTIMEGATVKL
ECRNITAGTQTFKAEAVTDKVGQYSIPVNGDFEDDICEIELVKSPNSECSEVSHDVYAKQ
SAKVSLTSNNGEASDIRSANALGFMRKEPLEECPEVLKELDLYDVKAN
Sequence Info Allergen Name Length Opt Bits Score E Value
A0A0K1SC10 Ama r 1.0101 168 1097 288.5 6.5e-80
AAL07319 Che a 1 168 1025 270.0 2.4e-74
A0A0K1SC44 Koc s 1.0101 167 988 260.5 1.7e-71
AKV72167 Pro j 1.0101 150 930 245.7 4.4e-67
A0A0K1SC24 Aca f 1 150 868 229.8 2.8e-62
ADK22842 Sal k 5.0101 151 729 194.1 1.6e-51
CAA33854 Lyc e LAT52 161 485 131.3 1.3e-32
X76396 Ole e 1.0103 145 419 114.5 1.4e-27
AAN32987 Phl p 11.0101 143 408 111.7 9.5e-27
CAA73037 Ole e 1.0106 146 407 111.4 1.2e-26
CAA73036 Ole e 1.0107 146 405 110.9 1.7e-26
AAQ83588 Fra e 1.0201 146 404 110.6 2e-26
P19963 Ole e 1 145 401 109.9 3.4e-26
O82015 Lig v 1 145 398 109.1 5.8e-26
CAA54819 Lig v 1.0102 145 395 108.3 9.9e-26
X76397 Ole e 1.0104 145 394 108.1 1.2e-25
X76395 Ole e 1.0102 145 394 108.1 1.2e-25
CAA73038 Ole e 1.0105 146 394 108.0 1.2e-25
Q7M1X5 Lol p 11.0101 134 386 106.1 4.3e-25
AAQ08947 Fra e 1.0101 145 382 105.0 1e-24
AAV74343 Fra e 1.0102 145 381 104.7 1.2e-24
AAB32652 Ole e 1.0101 130 325 90.4 2.1e-20
P82242 Pla l 1 131 238 68.1 1.2e-13
CAC41635 Pla l 1.0103 131 228 65.5 6.9e-13
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Ama r 1.0101 Sequence ID: A0A0K1SC10

 Score = 288.5 bits 1097,  Expect = 6e-80
 Identities = 168/168 100%, Positives = 168/168 100%, Gaps = 0/168 0%
Query  1    MAKCQAVFLLVGALCVLSLDDVAKAPVSQFHIQGLVYCDTCRIQFMTRISTIMEGATVKL 60
            MAKCQAVFLLVGALCVLSLDDVAKAPVSQFHIQGLVYCDTCRIQFMTRISTIMEGATVKL
Sbjct  1    MAKCQAVFLLVGALCVLSLDDVAKAPVSQFHIQGLVYCDTCRIQFMTRISTIMEGATVKL 60
Query  61   ECRNITAGTQTFKAEAVTDKVGQYSIPVNGDFEDDICEIELVKSPNSECSEVSHDVYAKQ 120
            ECRNITAGTQTFKAEAVTDKVGQYSIPVNGDFEDDICEIELVKSPNSECSEVSHDVYAKQ
Sbjct  61   ECRNITAGTQTFKAEAVTDKVGQYSIPVNGDFEDDICEIELVKSPNSECSEVSHDVYAKQ 120
Query  121  SAKVSLTSNNGEASDIRSANALGFMRKEPLEECPEVLKELDLYDVKAN 168
            SAKVSLTSNNGEASDIRSANALGFMRKEPLEECPEVLKELDLYDVKAN
Sbjct  121  SAKVSLTSNNGEASDIRSANALGFMRKEPLEECPEVLKELDLYDVKAN 168

Sequence Alignment: 2. Allergen Name: Che a 1 Sequence ID: AAL07319

 Score = 270.0 bits 1025,  Expect = 2e-74
 Identities = 157/168 93%, Positives = 162/168 96%, Gaps = 0/168 0%
Query  1    MAKCQAVFLLVGALCVLSLDDVAKAPVSQFHIQGLVYCDTCRIQFMTRISTIMEGATVKL 60
            MAKCQAVFLLVGALCVLSL  VA A  ++F +QG+VYCDTCRIQFMTRISTIMEGATVKL
Sbjct  1    MAKCQAVFLLVGALCVLSLAGVANAAENHFKVQGMVYCDTCRIQFMTRISTIMEGATVKL 60
Query  61   ECRNITAGTQTFKAEAVTDKVGQYSIPVNGDFEDDICEIELVKSPNSECSEVSHDVYAKQ 120
            ECRNITAGTQTFKAEAVTDKVGQYSIPVNGDFEDDICEIELVKSPNSECSEVSHDVYAKQ
Sbjct  61   ECRNITAGTQTFKAEAVTDKVGQYSIPVNGDFEDDICEIELVKSPNSECSEVSHDVYAKQ 120
Query  121  SAKVSLTSNNGEASDIRSANALGFMRKEPLEECPEVLKELDLYDVKAN 168
            SAKVSLTSNNGEASDIRSANALGFMRKEPL+ECPEVLKELDLYDVKAN
Sbjct  121  SAKVSLTSNNGEASDIRSANALGFMRKEPLKECPEVLKELDLYDVKAN 168

Sequence Alignment: 3. Allergen Name: Koc s 1.0101 Sequence ID: A0A0K1SC44

 Score = 260.5 bits 988,  Expect = 2e-71
 Identities = 150/167 89%, Positives = 160/167 95%, Gaps = 1/167 0%
Query  1    MAKCQAVFLLVGALCVLSLDDVAKAPVSQFHIQGLVYCDTCRIQFMTRISTIMEGATVKL 60
            MAKCQAVFLLVGALCVLSLDDVAKAPVSQFHIQGLVYCDTC     + +  ++EGATVKL
Sbjct  1    MAKCQAVFLLVGALCVLSLDDVAKAPVSQFHIQGLVYCDTCPYP-SSYVLPMLEGATVKL 59
Query  61   ECRNITAGTQTFKAEAVTDKVGQYSIPVNGDFEDDICEIELVKSPNSECSEVSHDVYAKQ 120
            ECRNITAGTQTFKAEAVTDKVGQYSIPV+GDFEDDICEIEL+KSP+++CSEVSHDVYAKQ
Sbjct  60   ECRNITAGTQTFKAEAVTDKVGQYSIPVDGDFEDDICEIELLKSPDNQCSEVSHDVYAKQ 119
Query  121  SAKVSLTSNNGEASDIRSANALGFMRKEPLEECPEVLKELDLYDVKAN 168
            SAKVSLTSNNGEASD+RSANALGFMRKEPLEECPEVLKELDLYDVKAN
Sbjct  120  SAKVSLTSNNGEASDVRSANALGFMRKEPLEECPEVLKELDLYDVKAN 167

Sequence Alignment: 4. Allergen Name: Pro j 1.0101 Sequence ID: AKV72167

 Score = 245.7 bits 930,  Expect = 4e-67
 Identities = 141/149 94%, Positives = 146/149 97%, Gaps = 1/149 0%
Query  20   DDVAKAPVSQFHIQGLVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVTD 79
            DDVAK PVSQFHIQGLVYCDTCRIQFMTR+STIMEGATVKLECRNITAGTQTFKAEAVTD
Sbjct  1    DDVAKPPVSQFHIQGLVYCDTCRIQFMTRVSTIMEGATVKLECRNITAGTQTFKAEAVTD 60
Query  80   KVGQYSIPVNGDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRSA 139
            KVGQYSIPVNGDFEDDICEIELVKSPNS+CSE+ HDVYAKQSAKVSLTSNNGEASDIRSA
Sbjct  61   KVGQYSIPVNGDFEDDICEIELVKSPNSDCSEIPHDVYAKQSAKVSLTSNNGEASDIRSA 120
Query  140  NALGFMRKEPLEECPEVLKE-LDLYDVKAN 168
            NALGFMRKEPL+ECPEV KE LD+YDVKAN
Sbjct  121  NALGFMRKEPLKECPEVSKEPLDMYDVKAN 150

Sequence Alignment: 5. Allergen Name: Aca f 1 Sequence ID: A0A0K1SC24

 Score = 229.8 bits 868,  Expect = 3e-62
 Identities = 130/149 87%, Positives = 139/149 93%, Gaps = 1/149 0%
Query  20   DDVAKAPVSQFHIQGLVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVTD 79
            DDV K PVSQFH+QGLVYCDTCR  F+T  S IMEGATVKLECRNITAGTQTFKAEAVTD
Sbjct  1    DDVPKPPVSQFHVQGLVYCDTCRYPFITEASPIMEGATVKLECRNITAGTQTFKAEAVTD 60
Query  80   KVGQYSIPVNGDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRSA 139
            KVGQYSIPV+GD EDDICEIELVKSP+++CSE+ HDVYAKQSAKVSLTSNNGEASD+RSA
Sbjct  61   KVGQYSIPVDGDHEDDICEIELVKSPDNQCSEIPHDVYAKQSAKVSLTSNNGEASDVRSA 120
Query  140  NALGFMRKEPLEECPEVLKE-LDLYDVKAN 168
            NALGFMRKEPL ECPEVLKE LD+YDVKAN
Sbjct  121  NALGFMRKEPLPECPEVLKEKLDMYDVKAN 150

Sequence Alignment: 6. Allergen Name: Sal k 5.0101 Sequence ID: ADK22842

 Score = 194.1 bits 729,  Expect = 2e-51
 Identities = 101/136 74%, Positives = 126/136 92%, Gaps = 0/136 0%
Query  30   FHIQGLVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIPVN 89
            +H++G+VYCDTCRIQF+TR+ST+MEGATV L+CRN+TAGT+TFKAEAVTDK+G Y+I V+
Sbjct  9    YHVKGMVYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKLGMYTIKVD 68
Query  90   GDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRSANALGFMRKEP 149
            GD EDDIC+I LVKSP  ECSE+ +DVY++Q+AKV+LTSNNGEASD+R+ANALGF++K P
Sbjct  69   GDHEDDICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNGEASDVRNANALGFLKKAP 128
Query  150  LEECPEVLKELDLYDV 165
            L ECPEVLKELD+YDV
Sbjct  129  LPECPEVLKELDMYDV 144

Sequence Alignment: 7. Allergen Name: Lyc e LAT52 Sequence ID: CAA33854

 Score = 131.3 bits 485,  Expect = 1e-32
 Identities = 77/160 48%, Positives = 108/160 67%, Gaps = 6/160 3%
Query  1    MAKCQAVFLLVGALCVLSLDDVAKAPVSQFHIQGLVYCDTCRIQFMTRISTIMEGATVKL 60
            MAK  A+ LL  ALC+L+L + A      F ++G VYCDTCR+QF T++S  +EGATVKL
Sbjct  1    MAK--AIVLL-SALCILALANFAHCRPEVFDVEGKVYCDTCRVQFETKLSENLEGATVKL 57
Query  61   ECRNITAGTQTFKAEAVTDKVGQYSIPVNGDFEDDICEIELVKSPNSECSEVSHDVYAKQ 120
            +CRNI+   +TF  E VTDK G+Y + VNGD E+DICE+ +VKSP  +C E    V   +
Sbjct  58   QCRNISTEAETFSVEGVTDKDGKYKLTVNGDHENDICEVTVVKSPREDCKE---SVSGYE 114
Query  121  SAKVSLTSNNGEASDIRSANALGFMRKEPLEECPEVLKELDLYDVK 166
             A++  + N G  + +R AN L FM+ E ++ C E L EL L+ ++
Sbjct  115  KARIECSDNVGIHNAVRFANPLFFMKAESVQGCKEALDELGLFPLE 160

Sequence Alignment: 8. Allergen Name: Ole e 1.0103 Sequence ID: X76396

 Score = 114.5 bits 419,  Expect = 1e-27
 Identities = 61/141 43%, Positives = 90/141 63%, Gaps = 3/141 2%
Query  20   DDVAKAPVSQFHIQGLVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVTD 79
            +DV + PVSQFHIQG VYCDTCR +F+T +S  + GA+V+L+C++   G+ TF     T 
Sbjct  1    EDVPQPPVSQFHIQGQVYCDTCRARFITELSEFIPGASVRLQCKDGENGSITFTEVGYTR 60
Query  80   KVGQYSIPVNGDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRSA 139
              G YS+ +  D +D+ CEI L+ S   +C E+  + + K S K  L + NG     R+ 
Sbjct  61   AEGLYSMLIERDHKDEFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNTVNGTT---RTI 117
Query  140  NALGFMRKEPLEECPEVLKELDLY 163
            N LGF +KE L +CP+V+ +L +Y
Sbjct  118  NPLGFFKKEALPKCPQVFNKLGMY 141

Sequence Alignment: 9. Allergen Name: Phl p 11.0101 Sequence ID: AAN32987

 Score = 111.7 bits 408,  Expect = 1e-26
 Identities = 62/132 46%, Positives = 86/132 65%, Gaps = 4/132 3%
Query  30   FHIQGLVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIPVN 89
            F + G VYCD CR  F T +S  ++GATV ++CR    G   +KAEA TD +G Y I ++
Sbjct  6    FVVTGRVYCDPCRAGFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGLGWYKIEID 65
Query  90   GDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNG-EASDIRSANALGFMRKE 148
             D +++ICE+ L KSP++ CSE+      +  A+V LTSNNG +   IR AN + F RKE
Sbjct  66   QDHQEEICEVVLAKSPDTTCSEIEE---FRDRARVPLTSNNGIKQQGIRYANPIAFFRKE 122
Query  149  PLEECPEVLKELDLYD 164
            PL+EC  +L+  DL D
Sbjct  123  PLKECGGILQAYDLRD 138

Sequence Alignment: 10. Allergen Name: Ole e 1.0106 Sequence ID: CAA73037

 Score = 111.4 bits 407,  Expect = 1e-26
 Identities = 61/142 42%, Positives = 90/142 63%, Gaps = 3/142 2%
Query  19   LDDVAKAPVSQFHIQGLVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVT 78
            ++DV + PVSQFHIQG VYCDTCR  F+T +S  + GA+V+L+C++   G  TF     T
Sbjct  1    MEDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYT 60
Query  79   DKVGQYSIPVNGDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRS 138
               G YS+ V  D +++ CEI L+ S   +C+E+  + +AK S K  L++ NG     R+
Sbjct  61   RAEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILSTVNGTT---RT 117
Query  139  ANALGFMRKEPLEECPEVLKELDLY 163
             N LGF +KE L +C +V  +L +Y
Sbjct  118  VNPLGFYKKEALPKCAQVYNKLGMY 142

Sequence Alignment: 11. Allergen Name: Ole e 1.0107 Sequence ID: CAA73036

 Score = 110.9 bits 405,  Expect = 2e-26
 Identities = 62/142 43%, Positives = 88/142 61%, Gaps = 3/142 2%
Query  19   LDDVAKAPVSQFHIQGLVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVT 78
            ++DV + PVSQFHIQG VYCDTCR +F+T +S  + GA+V+L+CR    G  TF     T
Sbjct  1    MEDVPQPPVSQFHIQGQVYCDTCRSRFITELSEFIPGASVRLQCREKENGDITFTEIGYT 60
Query  79   DKVGQYSIPVNGDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRS 138
               G YS+ V  D +++ CEI L+ S   +C E+  + +AK S K  L + NG     R+
Sbjct  61   RAEGLYSMLVERDHKNEFCEITLISSGRKDCDEIPIEGWAKPSLKFILNTVNGTT---RT 117
Query  139  ANALGFMRKEPLEECPEVLKELDLY 163
             N LGF +KE L +C +V  +L +Y
Sbjct  118  VNPLGFFKKEALPKCAQVYNKLGMY 142

Sequence Alignment: 12. Allergen Name: Fra e 1.0201 Sequence ID: AAQ83588

 Score = 110.6 bits 404,  Expect = 2e-26
 Identities = 61/142 42%, Positives = 90/142 63%, Gaps = 3/142 2%
Query  19   LDDVAKAPVSQFHIQGLVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVT 78
            ++DV + PVSQFHIQG VYCDTCR +F+T++S  + GA+V+L+CR+   G  TF     T
Sbjct  1    MEDVPQPPVSQFHIQGQVYCDTCRARFITKLSEFITGASVRLQCRDKENGDVTFTEIGYT 60
Query  79   DKVGQYSIPVNGDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRS 138
               G YS+ V  D +++ CEI L+ S   +C+E+  + + K S K  L + NG     R+
Sbjct  61   RGEGLYSMFVERDHKNEFCEITLLSSGRKDCNEIPIEGWVKPSLKFILNTVNGTT---RT 117
Query  139  ANALGFMRKEPLEECPEVLKELDLY 163
             N LGF +KE L +C +V  +L +Y
Sbjct  118  INPLGFFKKEALPQCAQVYNKLGMY 142

Sequence Alignment: 13. Allergen Name: Ole e 1 Sequence ID: P19963

 Score = 109.9 bits 401,  Expect = 3e-26
 Identities = 59/141 41%, Positives = 88/141 62%, Gaps = 3/141 2%
Query  20   DDVAKAPVSQFHIQGLVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVTD 79
            +D+ + PVSQFHIQG VYCDTCR  F+T +S  + GA+++L+C++   G  TF     T 
Sbjct  1    EDIPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTR 60
Query  80   KVGQYSIPVNGDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRSA 139
              G YS+ V  D +++ CEI L+ S   +C+E+  + +AK S K  L + NG     R+ 
Sbjct  61   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNTVNGTT---RTV 117
Query  140  NALGFMRKEPLEECPEVLKELDLY 163
            N LGF +KE L +C +V  +L +Y
Sbjct  118  NPLGFFKKEALPKCAQVYNKLGMY 141

Sequence Alignment: 14. Allergen Name: Lig v 1 Sequence ID: O82015

 Score = 109.1 bits 398,  Expect = 6e-26
 Identities = 58/141 41%, Positives = 89/141 63%, Gaps = 3/141 2%
Query  20   DDVAKAPVSQFHIQGLVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVTD 79
            +DV + PVSQF+IQG VYCDTCR +F+T +S  + GA V+L+C++   G  TF     T 
Sbjct  1    EDVPQPPVSQFYIQGQVYCDTCRARFITELSEFIPGAGVRLQCKDGENGKVTFTEVGYTK 60
Query  80   KVGQYSIPVNGDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRSA 139
              G Y++ +  D +++ CEI L+ S   +C E+  + + K S K  L + NG     R+ 
Sbjct  61   AEGLYNMLIERDHKNEFCEITLISSSRKDCDEIPTEGWVKPSLKFVLNTVNGTT---RTI 117
Query  140  NALGFMRKEPLEECPEVLKELDLY 163
            N LGF++KE L +CP+V+ +L +Y
Sbjct  118  NPLGFLKKEVLPKCPQVFNKLGMY 141

Sequence Alignment: 15. Allergen Name: Lig v 1.0102 Sequence ID: CAA54819

 Score = 108.3 bits 395,  Expect = 1e-25
 Identities = 59/141 41%, Positives = 88/141 62%, Gaps = 3/141 2%
Query  20   DDVAKAPVSQFHIQGLVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVTD 79
            +DV + PVSQF+IQG VYCDTCR +F+T +S  + GA V+L+C++   G  TF     T 
Sbjct  1    EDVPQPPVSQFYIQGQVYCDTCRARFITELSEFIPGAGVRLQCKDGENGKITFTEVGYTR 60
Query  80   KVGQYSIPVNGDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRSA 139
              G YS+ +  D +++ CEI L+ S   +C E+  + + K S K  L + NG     R+ 
Sbjct  61   AEGLYSMLIERDHKNEFCEITLLSSSRKDCDEIPIEGWVKPSLKFMLNTVNGTT---RTI 117
Query  140  NALGFMRKEPLEECPEVLKELDLY 163
            N LGF +KE L +CP+V+ +L +Y
Sbjct  118  NPLGFFKKEALPKCPQVFNKLGMY 141

Sequence Alignment: 16. Allergen Name: Ole e 1.0104 Sequence ID: X76397

 Score = 108.1 bits 394,  Expect = 1e-25
 Identities = 57/141 40%, Positives = 87/141 61%, Gaps = 3/141 2%
Query  20   DDVAKAPVSQFHIQGLVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVTD 79
            +DV + P+SQF++QG VYCDTCR +F+T  S  + GA V+L+C++   G  TF     T 
Sbjct  1    EDVPQPPISQFYVQGQVYCDTCRTRFITEFSEFIPGAGVRLQCKDGENGKITFTEVGYTR 60
Query  80   KVGQYSIPVNGDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRSA 139
              G YS+ +  D +++ CEI L+ S   +C E+  + + K S K  L + NG     R+ 
Sbjct  61   AEGLYSMLIERDHKNEFCEITLLSSSRKDCDEIPTEGWVKPSVKFILNTVNGTT---RTI 117
Query  140  NALGFMRKEPLEECPEVLKELDLY 163
            N LGF +KE L +CP+V+ +L +Y
Sbjct  118  NPLGFFKKEALPKCPQVFNKLGMY 141

Sequence Alignment: 17. Allergen Name: Ole e 1.0102 Sequence ID: X76395

 Score = 108.1 bits 394,  Expect = 1e-25
 Identities = 59/141 41%, Positives = 87/141 61%, Gaps = 3/141 2%
Query  20   DDVAKAPVSQFHIQGLVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVTD 79
            +DV + PVSQFHIQG VYCDTCR  F+T +S  + GA+++L+C++   G  TF     T 
Sbjct  1    EDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTR 60
Query  80   KVGQYSIPVNGDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRSA 139
              G YS+ V  D +++ CEI L+ S   +C+E+  + + K S K  L + NG     R+ 
Sbjct  61   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWVKPSLKFILNTVNGTT---RTV 117
Query  140  NALGFMRKEPLEECPEVLKELDLY 163
            N LGF +KE L +C +V  +L +Y
Sbjct  118  NPLGFFKKEALPKCAQVYNKLGMY 141

Sequence Alignment: 18. Allergen Name: Ole e 1.0105 Sequence ID: CAA73038

 Score = 108.0 bits 394,  Expect = 1e-25
 Identities = 60/142 42%, Positives = 88/142 61%, Gaps = 3/142 2%
Query  19   LDDVAKAPVSQFHIQGLVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVT 78
            ++DV + PVSQFHIQG VYCDTCR  F+T +S  + GA+V+L+C++   G  TF     T
Sbjct  1    MEDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYT 60
Query  79   DKVGQYSIPVNGDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRS 138
               G YS+ V  D +++ CEI L+ S   +C+E+  + +AK S K  L + NG     R+
Sbjct  61   RAEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILNTVNGTT---RT 117
Query  139  ANALGFMRKEPLEECPEVLKELDLY 163
             N L F +KE L +C +V  +L +Y
Sbjct  118  VNPLRFYKKEALPKCAQVYNKLGMY 142

Sequence Alignment: 19. Allergen Name: Lol p 11.0101 Sequence ID: Q7M1X5

 Score = 106.1 bits 386,  Expect = 4e-25
 Identities = 60/126 47%, Positives = 81/126 64%, Gaps = 4/126 3%
Query  30   FHIQGLVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIPVN 89
            F + G VYCD CR  F T +S  +EGATV ++CR    G   +KAEA TDK G Y I ++
Sbjct  6    FVVTGRVYCDPCRAGFETNVSHNVEGATVAVDCRPFDGGESKLKAEATTDKDGWYKIEID 65
Query  90   GDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNG-EASDIRSANALGFMRKE 148
             D +++ICE+ L KSP+  CSE+      +  A+V LTSN G +   IR AN + F RKE
Sbjct  66   QDHQEEICEVVLAKSPDKSCSEIEE---FRDRARVPLTSNXGIKQQGIRYANPIAFFRKE 122
Query  149  PLEECPEVLK 158
            PL+EC  +L+
Sbjct  123  PLKECGGILQ 132

Sequence Alignment: 20. Allergen Name: Fra e 1.0101 Sequence ID: AAQ08947

 Score = 105.0 bits 382,  Expect = 1e-24
 Identities = 57/141 40%, Positives = 86/141 60%, Gaps = 3/141 2%
Query  20   DDVAKAPVSQFHIQGLVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVTD 79
            +DV + PVS F++QG VYCDTCR  F+T +S  ++GA V+L+C++   G  TF     T 
Sbjct  1    EDVPQPPVSLFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKDKENGKVTFTEVGYTR 60
Query  80   KVGQYSIPVNGDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRSA 139
              G YS+ +  D +++ CEI L+ S   +C E+  + + K S K  L + NG     R+ 
Sbjct  61   AEGLYSMVIERDHKNEFCEIVLLSSSRKDCDEIPTEGWVKPSLKFILNTVNGTT---RTI 117
Query  140  NALGFMRKEPLEECPEVLKELDLY 163
            N LGF +KE L +CP+V  +L +Y
Sbjct  118  NPLGFFKKEVLPKCPQVYNKLGMY 141

Sequence Alignment: 21. Allergen Name: Fra e 1.0102 Sequence ID: AAV74343

 Score = 104.7 bits 381,  Expect = 1e-24
 Identities = 57/141 40%, Positives = 85/141 60%, Gaps = 3/141 2%
Query  20   DDVAKAPVSQFHIQGLVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVTD 79
            +DV + PVS F++QG VYCDTCR  F+T +S  ++GA V+L+C+    G  TF     T 
Sbjct  1    EDVPQPPVSLFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKEKENGKVTFTEVGYTR 60
Query  80   KVGQYSIPVNGDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRSA 139
              G YS+ +  D +++ CEI L+ S   +C E+  + + K S K  L + NG     R+ 
Sbjct  61   AEGLYSMVIERDHKNEFCEIVLLSSSRKDCHEIPTEGWVKPSLKFILNTVNGTT---RTI 117
Query  140  NALGFMRKEPLEECPEVLKELDLY 163
            N LGF +KE L +CP+V  +L +Y
Sbjct  118  NPLGFFKKEALPKCPQVYNKLGMY 141

Sequence Alignment: 22. Allergen Name: Ole e 1.0101 Sequence ID: AAB32652

 Score = 90.4 bits 325,  Expect = 2e-20
 Identities = 50/125 40%, Positives = 75/125 60%, Gaps = 3/125 2%
Query  36   VYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIPVNGDFEDD 95
            VYCDTCR  F+T +S  + GA+V+L+C+    G  TF     T   G YS+ V  D +++
Sbjct  2    VYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHKNE 61
Query  96   ICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRSANALGFMRKEPLEECPE 155
             CEI L+ S + +C+E+  + +AK S K  L + NG     R+ N LGF +KE L +C +
Sbjct  62   FCEITLISSGSKDCNEIPTEGWAKPSLKFILNTVNGTT---RTVNPLGFFKKEALPKCAQ 118
Query  156  VLKELDLY 163
            V  +L +Y
Sbjct  119  VYNKLGMY 126

Sequence Alignment: 23. Allergen Name: Pla l 1 Sequence ID: P82242

 Score = 68.1 bits 238,  Expect = 1e-13
 Identities = 43/123 34%, Positives = 66/123 53%, Gaps = 5/123 4%
Query  28   SQFHIQGLVYCDTCRIQ-FMTRISTIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSI 86
            ++FH++G VYC+ C  + ++  +S  M GA V+L+C++ +     +     TD+ G Y +
Sbjct  7    AKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKDDSKKV-IYSIGGETDQDGVYRL 65
Query  87   PVNGDFEDDICEIELVKSPNSECSEVSHDVYAK-QSAKVSLTSNNGEASDIRSANALGFM 145
            PV G  ED  CEI+LVKS   +CSE+        Q++KV L+ N       R    L F 
Sbjct  66   PVVGYHED--CEIKLVKSSRPDCSEIPKLAKGTIQTSKVDLSKNTTITEKTRHVKPLSFR 123
Query  146  RKEPLEEC 153
             K     C
Sbjct  124  AKTDAPGC 131

Sequence Alignment: 24. Allergen Name: Pla l 1.0103 Sequence ID: CAC41635

 Score = 65.5 bits 228,  Expect = 7e-13
 Identities = 42/123 34%, Positives = 65/123 52%, Gaps = 5/123 4%
Query  28   SQFHIQGLVYCDTCRIQ-FMTRISTIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSI 86
            ++FH++G VYC+ C  + ++  +S  M GA V+L+C++ +     +     T + G Y +
Sbjct  7    AKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKDDSKKV-IYSIGGETGQDGVYRL 65
Query  87   PVNGDFEDDICEIELVKSPNSECSEVSHDVYAK-QSAKVSLTSNNGEASDIRSANALGFM 145
            PV G  ED  CEI+LVKS   +CSE+        Q++KV L+ N       R    L F 
Sbjct  66   PVVGYHED--CEIKLVKSGRPDCSEIPKLAKGTIQTSKVDLSKNTTITEKTRHVKPLSFR 123
Query  146  RKEPLEEC 153
             K     C
Sbjct  124  AKTDAPGC 131

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.