The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAKLVFSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGGLIETWNPNNK
PFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEPQQPQQR
GQSSRPQDRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPR
RFYLAGNQEQEFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVDKQIA
KNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRP
RGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSAE
FGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVV
AARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNNPF
KFLVPPQESQKRAVA
Sequence Info Allergen Name Length Opt Bits Score E Value
P04776 Gly m 6.0101 495 3356 558.3 3.5e-160
AAA33966 Gly m glycinin G1 495 3356 558.3 3.5e-160
CAA68460 Gly m glycinin G2 485 2750 459.3 2.2e-130
P04405 Gly m 6.0201 485 2750 459.3 2.2e-130
Q2TPW5 Jug r 4.0101 507 1527 259.4 3.5e-70
A0A1L6K371 Jug n 4.0101 510 1513 257.1 1.7e-69
ABW86978 Car i 4.0101 505 1507 256.1 3.3e-69
AAL73404 Cor a 9 515 1378 235.0 7.6e-63
P11828 Gly m 6.0301 481 1229 210.7 1.5e-55
P09800 Gos h 4 516 1223 209.7 3.2e-55
O82580 Ara h 3 507 1102 189.9 2.8e-49
AAC63045 Ara h 3 510 1102 189.9 2.8e-49
AAD47382 Ara h 4 530 1028 177.8 1.3e-45
EU410073 Pis v 5.0101 473 935 162.6 4.2e-41
ADN39440 Pru du 6.0101 551 881 153.7 2.4e-38
3EHK_A Pru du 6 531 878 153.3 3.1e-38
AAN76862 Ana o 2 457 767 135.2 7.3e-33
ADN39441 Pru du 6.0201 504 750 132.4 5.8e-32
Q2TLW0 Sin a 2.0101 510 729 128.9 6.3e-31
QYS16039 Zan b 2.03 389 616 110.6 1.5e-25
Q9SB11 Gly m 6.0401 563 618 110.7 2.1e-25
Q7GC77 Gly m 6.0501 517 592 106.5 3.6e-24
P13744 Cuc ma 4.0101 480 578 104.3 1.6e-23
DQ631676 Pis v 2.0101 496 577 104.1 1.8e-23
QYU76046 Zan b 2.0102 388 568 102.8 3.5e-23
P09802 Gos h 3 509 571 103.1 3.8e-23
DQ631677 Pis v 2.0201 472 570 103.0 3.8e-23
QYU76045 Zan b 2.0101 389 565 102.3 5e-23
Q9AUD2 Ses i 7.0101 497 559 101.2 1.4e-22
QYU76044 Zan b 2.02 383 542 98.6 6.6e-22
AAO38859 Ber e 2 465 510 93.2 3.3e-20
Q9XFM4 Fag e 1 538 471 86.7 3.4e-18
BAA21758 Fag e 1 565 471 86.7 3.6e-18
Q9XHP0 Ses i 6.0101 459 441 81.9 8e-17
BAA21760 Fag e 1 504 442 82.0 8.2e-17
BAB21619 Gly m Bd28K 473 217 45.3 8.8e-06
A0A0S3B0K0 Coc n 1.0101 490 201 42.7 5.7e-05
AAL86739 Cor a 11 448 165 36.8 0.0029
Q9FZP9 Gly m 5.0201 559 161 36.0 0.0064
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Gly m 6.0101 Sequence ID: P04776

 Score = 558.3 bits 3356,  Expect = 3e-160
 Identities = 495/495 100%, Positives = 495/495 100%, Gaps = 0/495 0%
Query  1    MAKLVFSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGGLIETWNPNNK 60
            MAKLVFSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGGLIETWNPNNK
Sbjct  1    MAKLVFSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGGLIETWNPNNK 60
Query  61   PFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEPQQPQQR 120
            PFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEPQQPQQR
Sbjct  61   PFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEPQQPQQR 120
Query  121  GQSSRPQDRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPR 180
            GQSSRPQDRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPR
Sbjct  121  GQSSRPQDRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPR 180
Query  181  RFYLAGNQEQEFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVDKQIA 240
            RFYLAGNQEQEFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVDKQIA
Sbjct  181  RFYLAGNQEQEFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVDKQIA 240
Query  241  KNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRP 300
            KNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRP
Sbjct  241  KNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRP 300
Query  301  RGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSAE 360
            RGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSAE
Sbjct  301  RGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSAE 360
Query  361  FGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVV 420
            FGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVV
Sbjct  361  FGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVV 420
Query  421  AARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNNPF 480
            AARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNNPF
Sbjct  421  AARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNNPF 480
Query  481  KFLVPPQESQKRAVA 495
            KFLVPPQESQKRAVA
Sbjct  481  KFLVPPQESQKRAVA 495

Sequence Alignment: 2. Allergen Name: Gly m glycinin G1 Sequence ID: AAA33966

 Score = 558.3 bits 3356,  Expect = 3e-160
 Identities = 495/495 100%, Positives = 495/495 100%, Gaps = 0/495 0%
Query  1    MAKLVFSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGGLIETWNPNNK 60
            MAKLVFSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGGLIETWNPNNK
Sbjct  1    MAKLVFSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGGLIETWNPNNK 60
Query  61   PFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEPQQPQQR 120
            PFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEPQQPQQR
Sbjct  61   PFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEPQQPQQR 120
Query  121  GQSSRPQDRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPR 180
            GQSSRPQDRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPR
Sbjct  121  GQSSRPQDRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPR 180
Query  181  RFYLAGNQEQEFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVDKQIA 240
            RFYLAGNQEQEFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVDKQIA
Sbjct  181  RFYLAGNQEQEFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVDKQIA 240
Query  241  KNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRP 300
            KNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRP
Sbjct  241  KNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRP 300
Query  301  RGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSAE 360
            RGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSAE
Sbjct  301  RGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSAE 360
Query  361  FGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVV 420
            FGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVV
Sbjct  361  FGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVV 420
Query  421  AARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNNPF 480
            AARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNNPF
Sbjct  421  AARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNNPF 480
Query  481  KFLVPPQESQKRAVA 495
            KFLVPPQESQKRAVA
Sbjct  481  KFLVPPQESQKRAVA 495

Sequence Alignment: 3. Allergen Name: Gly m glycinin G2 Sequence ID: CAA68460

 Score = 459.3 bits 2750,  Expect = 2e-130
 Identities = 414/484 85%, Positives = 445/484 91%, Gaps = 12/484 2%
Query  1    MAKLVFSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGGLIETWNPNNK 60
            MAKLV+SLCFLLFSGC   F+ REQ QQNECQIQKLNALKPDNRIESEGG+IETWNPNNK
Sbjct  1    MAKLVLSLCFLLFSGC---FALREQAQQNECQIQKLNALKPDNRIESEGGFIETWNPNNK 57
Query  61   PFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEPQQPQQR 120
            PFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQG GIFGMI+PGCPST++EPQ+ QQR
Sbjct  58   PFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGNGIFGMIFPGCPSTYQEPQESQQR 117
Query  121  GQSSRPQDRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPR 180
            G+S RPQDRHQK++ FREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPR
Sbjct  118  GRSQRPQDRHQKVHRFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPR 177
Query  181  RFYLAGNQEQEFLKYQQEQ-GGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVDKQI 239
            RFYLAGNQEQEFLKYQQ+Q GG QSQKGK QQEEENEG +ILSGF  EFL+ AF V+ QI
Sbjct  178  RFYLAGNQEQEFLKYQQQQQGGSQSQKGK-QQEEENEGSNILSGFAPEFLKEAFGVNMQI 236
Query  240  AKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQR 299
             +NLQGENE ED GAIVTVKGGL V  P   + QQ   EE++++E+E+PQC   DK CQR
Sbjct  237  VRNLQGENEEEDSGAIVTVKGGLRVTAPAMRKPQQ---EEDDDDEEEQPQCVETDKGCQR 293
Query  300  PRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSA 359
                QSK  RNGIDETICTMRLR+NIGQ SSPDIYNPQAGS+TTATSLDFPAL  L+LSA
Sbjct  294  ----QSKRSRNGIDETICTMRLRQNIGQNSSPDIYNPQAGSITTATSLDFPALWLLKLSA 349
Query  360  EFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFV 419
            ++GSLRKNAMFVPHY LNANSIIYALNGRAL+QVVNCNGERVFDGELQEG VLIVPQNF 
Sbjct  350  QYGSLRKNAMFVPHYTLNANSIIYALNGRALVQVVNCNGERVFDGELQEGGVLIVPQNFA 409
Query  420  VAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNNP 479
            VAA+SQSDNFEYVSFKTND P IG LAGANSLLNALPEEVIQHTFNLKSQQARQ+KNNNP
Sbjct  410  VAAKSQSDNFEYVSFKTNDRPSIGNLAGANSLLNALPEEVIQHTFNLKSQQARQVKNNNP 469
Query  480  FKFLVPPQESQKRAVA 495
            F FLVPPQESQ+RAVA
Sbjct  470  FSFLVPPQESQRRAVA 485

Sequence Alignment: 4. Allergen Name: Gly m 6.0201 Sequence ID: P04405

 Score = 459.3 bits 2750,  Expect = 2e-130
 Identities = 414/484 85%, Positives = 445/484 91%, Gaps = 12/484 2%
Query  1    MAKLVFSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGGLIETWNPNNK 60
            MAKLV+SLCFLLFSGC   F+ REQ QQNECQIQKLNALKPDNRIESEGG+IETWNPNNK
Sbjct  1    MAKLVLSLCFLLFSGC---FALREQAQQNECQIQKLNALKPDNRIESEGGFIETWNPNNK 57
Query  61   PFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEPQQPQQR 120
            PFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQG GIFGMI+PGCPST++EPQ+ QQR
Sbjct  58   PFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGNGIFGMIFPGCPSTYQEPQESQQR 117
Query  121  GQSSRPQDRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPR 180
            G+S RPQDRHQK++ FREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPR
Sbjct  118  GRSQRPQDRHQKVHRFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPR 177
Query  181  RFYLAGNQEQEFLKYQQEQ-GGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVDKQI 239
            RFYLAGNQEQEFLKYQQ+Q GG QSQKGK QQEEENEG +ILSGF  EFL+ AF V+ QI
Sbjct  178  RFYLAGNQEQEFLKYQQQQQGGSQSQKGK-QQEEENEGSNILSGFAPEFLKEAFGVNMQI 236
Query  240  AKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQR 299
             +NLQGENE ED GAIVTVKGGL V  P   + QQ   EE++++E+E+PQC   DK CQR
Sbjct  237  VRNLQGENEEEDSGAIVTVKGGLRVTAPAMRKPQQ---EEDDDDEEEQPQCVETDKGCQR 293
Query  300  PRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSA 359
                QSK  RNGIDETICTMRLR+NIGQ SSPDIYNPQAGS+TTATSLDFPAL  L+LSA
Sbjct  294  ----QSKRSRNGIDETICTMRLRQNIGQNSSPDIYNPQAGSITTATSLDFPALWLLKLSA 349
Query  360  EFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFV 419
            ++GSLRKNAMFVPHY LNANSIIYALNGRAL+QVVNCNGERVFDGELQEG VLIVPQNF 
Sbjct  350  QYGSLRKNAMFVPHYTLNANSIIYALNGRALVQVVNCNGERVFDGELQEGGVLIVPQNFA 409
Query  420  VAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNNP 479
            VAA+SQSDNFEYVSFKTND P IG LAGANSLLNALPEEVIQHTFNLKSQQARQ+KNNNP
Sbjct  410  VAAKSQSDNFEYVSFKTNDRPSIGNLAGANSLLNALPEEVIQHTFNLKSQQARQVKNNNP 469
Query  480  FKFLVPPQESQKRAVA 495
            F FLVPPQESQ+RAVA
Sbjct  470  FSFLVPPQESQRRAVA 485

Sequence Alignment: 5. Allergen Name: Jug r 4.0101 Sequence ID: Q2TPW5

 Score = 259.4 bits 1527,  Expect = 3e-70
 Identities = 234/473 49%, Positives = 331/473 69%, Gaps = 18/473 3%
Query  12   LFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGGLIETWNPNNKPFQCAGVALSR 71
            LF+GC      R+Q Q  +CQ+ +L+AL+P NRIE+E G+IE+W+PNN+ FQCAGVA+ R
Sbjct  17   LFNGCLAQSGGRQQQQFGQCQLNRLDALEPTNRIEAEAGVIESWDPNNQQFQCAGVAVVR 76
Query  72   CTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEPQQPQQRGQSSR-PQDRH 130
             T+  N L  P Y+N PQ +YI +G+GI G+++PGCP TFEE Q+  Q+GQS    QDRH
Sbjct  77   RTIEPNGLLLPQYSNAPQLVYIARGRGITGVLFPGCPETFEESQRQSQQGQSREFQQDRH 136
Query  131  QKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQ 190
            QKI +FREGD+IA P GVA W YN+   PVVA+S++DTN+  NQLDQ PR FYLAGN + 
Sbjct  137  QKIRHFREGDIIAFPAGVAHWSYNDGSNPVVAISLLDTNNNANQLDQNPRNFYLAGNPDD 196
Query  191  EFL-KYQQEQGGHQSQK------GKHQQEEENEGGSILSGFTLEFLEHAFSVDKQIAKNL 243
            EF  + QQE   H+ Q+      G+H Q++   G +++SGF  +FL  AF+VD + A+ L
Sbjct  197  EFRPQGQQEYEQHRRQQQRQQRPGEHGQQQRGLGNNVFSGFDADFLADAFNVDTETARRL 256
Query  244  QGENEGEDKGAIVTVKG-GLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRPRG 302
            Q EN+   + +IV V+G  L VI+P       R   EE+E E+ K + + ++   +R + 
Sbjct  257  QSEND--HRRSIVRVEGRQLQVIRP-------RWSREEQEREERKERERERESESERRQS 307
Query  303  SQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSAEFG 362
             +     NG++ETICT+RLR NIG  S  DIY  +AG ++T  S  +P L WL+LSAE G
Sbjct  308  RRGGRDDNGLEETICTLRLRENIGDPSRADIYTEEAGRISTVNSHTLPVLRWLQLSAERG 367
Query  363  SLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVVAA 422
            +L  +A++VPH+NLNA+S++YAL GRA +QVV+  G+ VFD EL+EG++L +PQNF V  
Sbjct  368  ALYSDALYVPHWNLNAHSVVYALRGRAEVQVVDNFGQTVFDDELREGQLLTIPQNFAVVK 427
Query  423  RSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNNPFKF 482
            R++++ FE+VSFKTN+  M+  LAG  S + ALPEEV+   F +  + AR++K N     
Sbjct  428  RARNEGFEWVSFKTNENAMVSPLAGRTSAIRALPEEVLATAFQIPREDARRLKFNRQEST 487
Query  483  LVPPQESQKRA 493
            LV  + S+ R+
Sbjct  488  LVRSRPSRSRS 498

Sequence Alignment: 6. Allergen Name: Jug n 4.0101 Sequence ID: A0A1L6K371

 Score = 257.1 bits 1513,  Expect = 2e-69
 Identities = 240/484 49%, Positives = 341/484 70%, Gaps = 26/484 5%
Query  1    MAK---LVFSLCFL-LFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGGLIETWN 56
            MAK   L  SLC++ L +GC      R+QP+  EC++++L AL+P NRIE+E G+IE+W+
Sbjct  1    MAKPILLSISLCLVALVNGCLAQSGGRQQPRFGECKLKRLVALEPSNRIEAEAGVIESWD 60
Query  57   PNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEPQQ 116
            PNN+ FQCAGVA+ R T+  N L  P Y+N PQ +YI +G+GI G+++PGCP TFEE QQ
Sbjct  61   PNNQQFQCAGVAVVRRTIEPNGLLLPQYSNAPQLLYIVKGRGITGVLFPGCPETFEESQQ 120
Query  117  PQQRGQ-----SSRPQDRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSL 171
             Q R +     +S  +DRHQKI +FREGD+IA P GVA W YN+ DTPVVAV+++DT + 
Sbjct  121  GQSRIRPSLRSASFQRDRHQKIRHFREGDVIAFPAGVAHWCYNDGDTPVVAVALMDTTNN 180
Query  172  ENQLDQMPRRFYLAGNQEQEFL-KYQQE------QGGHQSQKGKHQQEEENEGGSILSGF 224
             NQLDQ PR FYLAGN + EF  + QQE      Q  HQ + G+  Q++   G +++SGF
Sbjct  181  ANQLDQNPRNFYLAGNPDDEFRPQGQQEYEQHRRQQQHQQRHGEPGQQQRGSGNNVFSGF 240
Query  225  TLEFLEHAFSVDKQIAKNLQGENEGEDKGAIVTVKG-GLSVIKPPTDEQQQRPQEEEEEE 283
              +FL  AF+VD + A+ LQ EN  + + +IV V+G  L VI+P       R   EE+E 
Sbjct  241  DADFLADAFNVDTETARRLQSEN--DHRRSIVRVEGRQLQVIRP-------RWSREEQER 291
Query  284  EDEKPQCKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTT 343
            E+ K + + ++   +R +  +     NG++ETICT+RLR NIG  S  DIY  +AG ++T
Sbjct  292  EERKERERERESESERRQSRRGGRDDNGLEETICTLRLRENIGDPSRADIYTEEAGRIST 351
Query  344  ATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFD 403
            A S  +P L WL+LSAE G+L  +A++VPH+NLNA+S++YAL GRA +QVV+  G+ VFD
Sbjct  352  ANSHTLPVLRWLQLSAERGALYSDALYVPHWNLNAHSVVYALRGRAEVQVVDNFGQTVFD 411
Query  404  GELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHT 463
             EL+EG++L +PQNF V  R++++ FE+VSFKTN+  M+  LAG  S + ALPEEV+ + 
Sbjct  412  DELREGQLLTIPQNFAVVKRARNEGFEWVSFKTNENAMVSPLAGRTSAIRALPEEVLANA 471
Query  464  FNLKSQQARQIKNNNPFKFLVPPQESQKRA 493
            + +  + AR++K N     LV  + S  R+
Sbjct  472  LQIPREDARRLKFNRQESTLVRSRPSSSRS 501

Sequence Alignment: 7. Allergen Name: Car i 4.0101 Sequence ID: ABW86978

 Score = 256.1 bits 1507,  Expect = 3e-69
 Identities = 234/484 48%, Positives = 339/484 70%, Gaps = 24/484 4%
Query  1    MAK---LVFSLCFL---LFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGGLIET 54
            MAK   L   LC++   LF+GC      R+Q +  +CQ+ +L+AL+P NRIE+E G+IE+
Sbjct  1    MAKPILLSIYLCLIIVALFNGCLAQSGGRQQHKFGQCQLNRLDALEPTNRIEAEAGVIES 60
Query  55   WNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEP 114
            W+PN++ +QCAGVA+ R T+  N L  P Y+N PQ +YI +G+GI G+++PGCP TFEE 
Sbjct  61   WDPNHQQLQCAGVAVVRRTIEPNGLLLPHYSNAPQLVYIARGRGITGVLFPGCPETFEES 120
Query  115  QQPQQRGQSSR-PQDRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLEN 173
            Q+  Q+GQ     QDRHQKI +FREGD+IA P GVA W YN+  +PVVA+ ++DT++  N
Sbjct  121  QRQSQQGQRREFQQDRHQKIRHFREGDIIAFPAGVAHWCYNDGSSPVVAIFLLDTHNNAN 180
Query  174  QLDQMPRRFYLAGNQEQEFL-KYQQE------QGGHQSQKGKHQQEEENEGGSILSGFTL 226
            QLDQ PR FYLAGN + EF  + QQE      Q  HQ ++G+H +++ + G +++SGF  
Sbjct  181  QLDQNPRNFYLAGNPDDEFRPQGQQEYEQHRRQQQHQQRRGEHGEQQRDLGNNVFSGFDA 240
Query  227  EFLEHAFSVDKQIAKNLQGENEGEDKGAIVTVKG-GLSVIKPPTDEQQQRPQEEEEEEED 285
            EFL  AF+VD + A+ LQ EN  + +G+IV V+G  L VI+P       R   EE+E E+
Sbjct  241  EFLADAFNVDTETARRLQSEN--DHRGSIVRVEGRQLQVIRP-------RWSREEQEHEE 291
Query  286  EKPQCKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTAT 345
             K + + ++   +R +  +     NG++ETICT+ LR NIG  S  DIY  +AG ++T  
Sbjct  292  RKERERERESESERRQSRRGGRDDNGLEETICTLSLRENIGDPSRADIYTEEAGRISTVN 351
Query  346  SLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGE 405
            S ++P L WL+LSAE G+L  +A++VPH+NLNA+S++YAL GRA +QVV+  G+ VFD E
Sbjct  352  SHNLPILRWLQLSAERGALYSDALYVPHWNLNAHSVVYALRGRAEVQVVDNFGQTVFDDE 411
Query  406  LQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFN 465
            L+EG++L +PQNF V  R++ + FE+VSFKTN+  M+  LAG  S + ALPEEV+ + F 
Sbjct  412  LREGQLLTIPQNFAVVKRARDEGFEWVSFKTNENAMVSPLAGRTSAIRALPEEVLVNAFQ 471
Query  466  LKSQQARQIKNNNPFKFLVPPQESQKRA 493
            +  + AR++K N     LV  +    R+
Sbjct  472  IPREDARRLKFNRQESTLVRSRSRSSRS 499

Sequence Alignment: 8. Allergen Name: Cor a 9 Sequence ID: AAL73404

 Score = 235.0 bits 1378,  Expect = 8e-63
 Identities = 235/479 49%, Positives = 334/479 69%, Gaps = 30/479 6%
Query  1    MAKLV---FSLCFL-LFSGCC-FAFSSREQPQQ--NECQIQKLNALKPDNRIESEGGLIE 53
            MAKL+   FSLC+L LF+GC       R Q Q+   EC + +LNAL+P NRIE+E   IE
Sbjct  1    MAKLILVSFSLCLLVLFNGCLGINVGLRRQQQRYFGECNLDRLNALEPTNRIEAEACQIE 60
Query  54   TWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFEE 113
            +W+ N++ FQCAGVA+ R T+  N L  P Y+N P+ IYI++G+GI G+++PGCP TFE+
Sbjct  61   SWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGCPETFED 120
Query  114  PQQPQQRGQ------SSRP-QDRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSII 166
            PQQ  Q+GQ      S R  QDRHQKI +FREGD+IA+P GVA W YN+ D+PVV VS++
Sbjct  121  PQQQSQQGQRQGQGQSQRSEQDRHQKIRHFREGDIIALPAGVAHWCYNDGDSPVVTVSLL 180
Query  167  DTNSLENQLDQMPRRFYLAGNQEQEFLKYQQEQGGHQSQKGKH------QQEEENEGGSI 220
             TN+  NQLD+ PR FYLAGN + E  +  Q+Q G++ ++ +H      +QE++ EG ++
Sbjct  181  HTNNYANQLDENPRHFYLAGNPDDEHQRQGQQQFGQRRRQQQHSHGEQGEQEQQGEGNNV 240
Query  221  LSGFTLEFLEHAFSVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEE 280
            +SGF  EFL  AF+VD   A+ LQ     + +  IV V+G L V++P    Q+   QE +
Sbjct  241  FSGFDAEFLADAFNVDVDTARRLQSNQ--DKRRNIVKVEGRLQVVRPERSRQEWERQERQ 298
Query  281  EEEEDEKPQCKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGS 340
            E E ++       ++  QR +G + +   NG +ETIC++RLR NI   S  DIY  Q G 
Sbjct  299  ERESEQ-------ERERQRRQGGRGRDV-NGFEETICSLRLRENICTRSRADIYTEQVGR 350
Query  341  VTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGER 400
            + T  S  +P L WL+LSAE G L++  ++VPH+NLNA+S++YA+ GRA +QVV+ NG  
Sbjct  351  INTVNSNTLPVLRWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGNT 410
Query  401  VFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVI 460
            VFD EL++G+VL +PQNF VA R++S+ FE+V+FKTND   I  LAG  S + ALP++V+
Sbjct  411  VFDDELRQGQVLTIPQNFAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRALPDDVL 470
Query  461  QHTFNLKSQQARQIKNNNPFKFLVPPQES 489
             + F +  ++AR++K N     LV    S
Sbjct  471  ANAFQISREEARRLKYNRQETTLVRSSRS 499

Sequence Alignment: 9. Allergen Name: Gly m 6.0301 Sequence ID: P11828

 Score = 210.7 bits 1229,  Expect = 1e-55
 Identities = 427/479 89%, Positives = 456/479 95%, Gaps = 18/479 3%
Query  1    MAKLVFSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGGLIETWNPNNK 60
            MAKLV+SLCFLLFSGCCFAFS REQPQQNECQIQ+LNALKPDNRIESEGG+IETWNPNNK
Sbjct  1    MAKLVLSLCFLLFSGCCFAFSFREQPQQNECQIQRLNALKPDNRIESEGGFIETWNPNNK 60
Query  61   PFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEPQQPQQR 120
            PFQCAGVALSRCTLNRNALRRPSYTN PQEIYIQQG GIFGMI+PGCPSTFEEPQQ   +
Sbjct  61   PFQCAGVALSRCTLNRNALRRPSYTNAPQEIYIQQGSGIFGMIFPGCPSTFEEPQQ---K 117
Query  121  GQSSRPQDRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPR 180
            GQSSRPQDRHQKIY+FREGDLIAVPTG A+WMYNNEDTPVVAVS+IDTNS++NQLDQMPR
Sbjct  118  GQSSRPQDRHQKIYHFREGDLIAVPTGFAYWMYNNEDTPVVAVSLIDTNSFQNQLDQMPR 177
Query  181  RFYLAGNQEQEFLKYQ--QEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVDKQ 238
            RFYLAGNQEQEFL+YQ  ++QGG QSQKGK QQEEENEGGSILSGF  EFLEHAF VD+Q
Sbjct  178  RFYLAGNQEQEFLQYQPQKQQGGTQSQKGKRQQEEENEGGSILSGFAPEFLEHAFVVDRQ 237
Query  239  IAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQ 298
            I + LQGENE E+KGAIVTVKGGLSVI PPT+EQQQRP+EE      EKP C  KDKHCQ
Sbjct  238  IVRKLQGENEEEEKGAIVTVKGGLSVISPPTEEQQQRPEEE------EKPDCDEKDKHCQ 291
Query  299  RPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLS 358
                SQS   RNGIDETICTMRLRHNIGQTSSPDI+NPQAGS+TTATSLDFPALSWL+LS
Sbjct  292  ----SQS---RNGIDETICTMRLRHNIGQTSSPDIFNPQAGSITTATSLDFPALSWLKLS 344
Query  359  AEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNF 418
            A+FGSLRKNAMFVPHYNLNANSIIYALNGRAL+QVVNCNGERVFDGELQEG+VLIVPQNF
Sbjct  345  AQFGSLRKNAMFVPHYNLNANSIIYALNGRALVQVVNCNGERVFDGELQEGQVLIVPQNF 404
Query  419  VVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNN 478
             VAARSQSDNFEYVSFKTND P IG LAGANSLLNALPEEVIQ+TFNL+ QQARQ+KNNN
Sbjct  405  AVAARSQSDNFEYVSFKTNDRPSIGNLAGANSLLNALPEEVIQQTFNLRRQQARQVKNNN 464
Query  479  PFKFLVPPQESQKRAVA 495
            PF FLVPP+ESQ+R VA
Sbjct  465  PFSFLVPPKESQRRVVA 481

Sequence Alignment: 10. Allergen Name: Gos h 4 Sequence ID: P09800

 Score = 209.7 bits 1223,  Expect = 3e-55
 Identities = 202/478 42%, Positives = 323/478 67%, Gaps = 42/478 8%
Query  4    LVFSLCFL-LFSGCCFA------------FSSREQPQ---QNECQIQKLNALKPDNRIES 47
            L FS+C+L LF GCC              +   +QPQ   Q++CQ+Q LNAL+P +R  S
Sbjct  7    LSFSVCLLVLFHGCCAQIDLVTNHHQDPPWGQPQQPQPRHQSQCQLQNLNALQPKHRFRS 66
Query  48   EGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGC 107
            E G  E W+ N   FQCAGVA+ R  + R  L  PS+T+ P   Y++QG+GI G ++PGC
Sbjct  67   EAGETEFWDQNEDQFQCAGVAFLRHKIQRKGLLLPSFTSAPMLFYVEQGEGIHGAVFPGC 126
Query  108  PSTFEEPQQPQQRGQSSRPQ-DRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSII 166
            P T++   Q QQ  Q  RPQ D+HQK+  ++EGD++A+P GVA W++NN  + +V V+++
Sbjct  127  PETYQ--SQSQQNIQD-RPQRDQHQKLRRLKEGDVVALPAGVAHWIFNNGRSQLVLVALV 183
Query  167  DTNSLENQLDQMPRRFYLAGNQEQEFLKYQQEQGGHQ----SQKGKHQQEEENEGG--SI 220
            D  +  NQLD+  R+F+LAG+ +   ++  Q +  +Q    +Q+G+ ++EE  E G  ++
Sbjct  184  DVGNDANQLDENFRKFFLAGSPQGGVVRGGQSRDRNQRQSRTQRGEREEEESQESGGNNV 243
Query  221  LSGFTLEFLEHAFSVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEE 280
            LSGF   +L +AF +D ++A+ LQ  NE +++GAIV ++ G+   + P +E Q+R   EE
Sbjct  244  LSGFRDNLLAQAFGIDTRLARKLQ--NERDNRGAIVRMEHGF---EWP-EEGQRRQGREE 297
Query  281  EEEEDEKP--------QCKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPD 332
            E EE+ +P        Q +G ++  +  RG   +   NG++ET C+MRL+H     SS D
Sbjct  298  EGEEEREPKWQRRQESQEEGSEEEEREERGRGRRRSGNGLEETFCSMRLKHRT-PASSAD 356
Query  333  IYNPQAGSVTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQ 392
            ++NP+ G +TT  S+++P L +L+LSAE G L  NA++ PH+N+NA+SI+Y   G   IQ
Sbjct  357  VFNPRGGRITTVNSFNLPILQYLQLSAERGVLYNNAIYAPHWNMNAHSIVYITRGNGRIQ 416
Query  393  VVNCNGERVFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLL 452
            +V+ NGE +FD +++ G+V+ VPQN  V  ++    FE+++FKTN    I  +AG  S++
Sbjct  417  IVSENGEAIFDEQVERGQVITVPQNHAVVKKAGRRGFEWIAFKTNANAKISQIAGRVSIM 476
Query  453  NALPEEVIQHTFNLKSQQARQIKNN-NPFKFLVPPQESQK 491
              LP +V+ ++F +  ++A ++K+N      + P Q SQ+
Sbjct  477  RGLPVDVLANSFGISREEAMRLKHNRQEVSVFSPRQGSQQ 516

Sequence Alignment: 11. Allergen Name: Ara h 3 Sequence ID: O82580

 Score = 189.9 bits 1102,  Expect = 3e-49
 Identities = 295/465 63%, Positives = 372/465 80%, Gaps = 50/465 10%
Query  23   REQPQQNECQIQKLNALKPDNRIESEGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRP 82
            R+QP++N CQ Q+LNA +PDNRIESEGG IETWNPNN+ F+CAGVALSR  L RNALRRP
Sbjct  1    RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRP 60
Query  83   SYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEPQQPQQRGQSSRP-------------QDR 129
             Y+N PQEI+IQQG+G FG+I+PGCP  +EEP+   +R QS RP             +D 
Sbjct  61   FYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDS 120
Query  130  HQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQE 189
            HQK++ F EGDLIAVPTGVA+W+YN+ DT VVAVS+ DTN+ +NQLDQ PRRF LAGN E
Sbjct  121  HQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTE 180
Query  190  QEFLKYQQEQG------------GHQSQ----------KGKHQ------QEEENEGGSIL 221
            QEFL+YQQ+                QSQ          +G+H       QEEENEGG+I+
Sbjct  181  QEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIF 240
Query  222  SGFTLEFLEHAFSVD-KQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEE 280
            SGFT EFLE+AF VD +QI +NL+GE E E++GAIVTV+GGL ++ P   ++++R  EEE
Sbjct  241  SGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSP---DRKRRADEEE 297
Query  281  EEEEDEKPQCKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGS 340
            E +EDE       D+   R RG  S+ R NGI+ETICT   + NIG+  SPDIYNPQAGS
Sbjct  298  EYDEDEYEY----DEE-DRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGS 352
Query  341  VTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGER 400
            + TA  L++  L WL  SAE+G+L +NA+FV HYN NA+SIIY L GRA +QVV+ NG R
Sbjct  353  LKTANDLNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNR 412
Query  401  VFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVI 460
            V+D ELQEG VL+VPQNF VA +SQS+NFEYV+FKT+  P I  LAG NS+++ LPEEV+
Sbjct  413  VYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVV 472
Query  461  QHTFNLKSQQARQIKNNNPFKFLVPPQESQKRAVA 495
             +++ L+ +QARQ+KNNNPFKF+VPP +   RAVA
Sbjct  473  ANSYGLQREQARQLKNNNPFKFFVPPSQQSPRAVA 507

Sequence Alignment: 12. Allergen Name: Ara h 3 Sequence ID: AAC63045

 Score = 189.9 bits 1102,  Expect = 3e-49
 Identities = 296/467 63%, Positives = 373/467 79%, Gaps = 50/467 10%
Query  21   SSREQPQQNECQIQKLNALKPDNRIESEGGLIETWNPNNKPFQCAGVALSRCTLNRNALR 80
            S R+QP++N CQ Q+LNA +PDNRIESEGG IETWNPNN+ F+CAGVALSR  L RNALR
Sbjct  2    SFRQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALR 61
Query  81   RPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEPQQPQQRGQSSRP-------------Q 127
            RP Y+N PQEI+IQQG+G FG+I+PGCP  +EEP+   +R QS RP             +
Sbjct  62   RPFYSNAPQEIFIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQR 121
Query  128  DRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGN 187
            D HQK++ F EGDLIAVPTGVA+W+YN+ DT VVAVS+ DTN+ +NQLDQ PRRF LAGN
Sbjct  122  DSHQKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGN 181
Query  188  QEQEFLKYQQEQG------------GHQSQ----------KGKHQ------QEEENEGGS 219
             EQEFL+YQQ+                QSQ          +G+H       QEEENEGG+
Sbjct  182  TEQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGN 241
Query  220  ILSGFTLEFLEHAFSVD-KQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQE 278
            I+SGFT EFLE+AF VD +QI +NL+GE E E++GAIVTV+GGL ++ P   ++++R  E
Sbjct  242  IFSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSP---DRKRRADE 298
Query  279  EEEEEEDEKPQCKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQA 338
            EEE +EDE       D+   R RG  S+ R NGI+ETICT   + NIG+  SPDIYNPQA
Sbjct  299  EEEYDEDEYEY----DEE-DRRRGRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQA 353
Query  339  GSVTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNG 398
            GS+ TA  L++  L WL  SAE+G+L +NA+FV HYN NA+SIIY L GRA +QVV+ NG
Sbjct  354  GSLKTANDLNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNG 413
Query  399  ERVFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEE 458
             RV+D ELQEG VL+VPQNF VA +SQS+NFEYV+FKT+  P I  LAG NS+++ LPEE
Sbjct  414  NRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEE 473
Query  459  VIQHTFNLKSQQARQIKNNNPFKFLVPPQESQKRAVA 495
            V+ +++ L+ +QARQ+KNNNPFKF+VPP +   RAVA
Sbjct  474  VVANSYGLQREQARQLKNNNPFKFFVPPSQQSPRAVA 510

Sequence Alignment: 13. Allergen Name: Ara h 4 Sequence ID: AAD47382

 Score = 177.8 bits 1028,  Expect = 1e-45
 Identities = 297/485 61%, Positives = 382/485 78%, Gaps = 55/485 11%
Query  1    MAKLV---FSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGGLIETWNP 57
            MAKL+   F +CFL++     +F  R+QP++N CQ Q+LNA +PDNRIESEGG IETWNP
Sbjct  1    MAKLLELSFCFCFLVLGASSISF--RQQPEENACQFQRLNAQRPDNRIESEGGYIETWNP 58
Query  58   NNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEPQQP 117
            NN+ F+CAGVALSR  L RNALRRP Y+N PQEI+IQQG+G FG+I+PGCPST+EEP Q 
Sbjct  59   NNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPSTYEEPAQQ 118
Query  118  QQRGQSSRP-------------QDRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVS 164
             +R QS RP             QD HQK++ F EGDLIAVPTGVA+W+YN+ DT VVAVS
Sbjct  119  GRRYQSQRPPRRLQEEDQSQQQQDSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVS 178
Query  165  IIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQEQG------------------------ 200
            + DTN+ +NQLDQ PRRF LAGN+EQEFL+YQQ+                          
Sbjct  179  LTDTNNNDNQLDQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREERE 238
Query  201  ----GHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVD-KQIAKNLQGENEGEDKGAI 255
                G++S++ +  QEEE+EGG+I+SGFT EFLE+AF VD +QI +NL GENE E++GAI
Sbjct  239  FRPRGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAI 298
Query  256  VTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRPRGSQSKSRRNGIDET 315
            VTV+GGL ++ P   +  +   EEEE +ED   Q +  ++  +R RGS+     NGI+ET
Sbjct  299  VTVRGGLRILSP---DGTRGADEEEEYDED---QYEYHEQDGRRGRGSRGGG--NGIEET 350
Query  316  ICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYN 375
            ICT  ++ NIG   SP IY+PQ         L++  L WL LSAE+G+L +NA+FVPHYN
Sbjct  351  ICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLYRNALFVPHYN 410
Query  376  LNANSIIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFK 435
             NA+SIIYAL GRA +QVV+ NG RV+D ELQEG VL+VPQNF VA +SQS+NFEYV+FK
Sbjct  411  TNAHSIIYALRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFK 470
Query  436  TNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNNPFKFLVPPQESQKRAVA 495
            T+  P I  +AG NS+++ LPEEV+ +++ L  +QARQ+KNNNPFKF+VPP +   RAVA
Sbjct  471  TDSRPSIANFAGENSFIDNLPEEVVANSYGLPREQARQLKNNNPFKFFVPPFQQSPRAVA 530

Sequence Alignment: 14. Allergen Name: Pis v 5.0101 Sequence ID: EU410073

 Score = 162.6 bits 935,  Expect = 4e-41
 Identities = 238/460 51%, Positives = 335/460 72%, Gaps = 30/460 6%
Query  4    LVFSLCFL-LFSGCCFAFSSREQ-PQQNECQIQKLNALKPDNRIESEGGLIETWNPNNKP 61
            L +S+C+L LF GC   ++SR+Q  QQNECQI +L+AL+PDNR+E E G++ETW+PN++ 
Sbjct  7    LSLSVCLLILFHGC---LASRQQGQQQNECQIDQLDALEPDNRVEYEAGMVETWDPNHEQ 63
Query  62   FQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEPQQPQQRG 121
            F+CAGVA++R T+  N LR P Y+N P  +YI +G+G+ G + PGCP T++ PQQ QQ G
Sbjct  64   FRCAGVAVARHTIQPNGLRLPEYSNAPTLMYIVEGEGMTGTLIPGCPETYQAPQQGQQHG 123
Query  122  QSSRPQDRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRR 181
            QSSR QD+HQKI  FR+GD+IA+P GVA W YN  ++PVV V+++D ++ +NQLD  PR+
Sbjct  124  QSSRFQDKHQKIQRFRKGDIIALPAGVANWCYNEGNSPVVTVTLLDVSNSQNQLDMYPRK 183
Query  182  FYLAGNQEQEFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVDKQIAK 241
            F LAGN E EF + QQ+Q      +G+ Q ++++   +I+ GF  + L   F V++ + K
Sbjct  184  FNLAGNPEDEFQQQQQQQS-----RGRRQSQQKSCN-NIFCGFDTKILAEVFQVEQSLVK 237
Query  242  NLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRPR 301
             LQ  NE +++GAIV VKG L VI+PP   Q +R  E EEE E E+    G+       R
Sbjct  238  QLQ--NEKDNRGAIVKVKGDLQVIRPPR-RQSERGFESEEESEYER----GR-------R 283
Query  302  GSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSAEF 361
            G     R NG++ETICTM+L+ NI   S  DIY P+ G +T+  SL++P L WL+LSAE 
Sbjct  284  G-----RDNGLEETICTMKLKENIHDPSRSDIYTPEVGRITSLNSLNLPILKWLQLSAER 338
Query  362  GSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVVA 421
            G L+ NA+ VPH+N+NA+SI+Y   G A +QVV+  G  VFDGE+ EG++++VPQNF V 
Sbjct  339  GVLQNNALMVPHWNFNAHSIVYGCKGNAQVQVVDNFGNTVFDGEVSEGQIFVVPQNFAVV 398
Query  422  ARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNNPFK 481
             R++   FE++SFKTND  MI  LAG+ S+L A+PEEV+ + F +  + AR+IK NN   
Sbjct  399  KRARGQRFEWISFKTNDRAMISPLAGSTSVLRAMPEEVLANAFQISREDARKIKFNNEQP 458
Query  482  FLVPPQESQK 491
             L   Q SQ+
Sbjct  459  TLSSGQSSQQ 468

Sequence Alignment: 15. Allergen Name: Pru du 6.0101 Sequence ID: ADN39440

 Score = 153.7 bits 881,  Expect = 2e-38
 Identities = 232/478 48%, Positives = 344/478 71%, Gaps = 88/478 18%
Query  1    MAK-LVFSLCFLL-FSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGGLIETWNPN 58
            MAK +VFSLC+LL F+GC  A  S+  PQ N+CQ+ +L A +PDNRI++E G IETWN N
Sbjct  1    MAKAFVFSLCLLLVFNGCLAARQSQLSPQ-NQCQLNQLQAREPDNRIQAEAGQIETWNFN 59
Query  59   NKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEPQQP- 117
             + FQCAGVA SR T+ RN L  PSY+N PQ IYI QG+G++G ++ GCP TFEE QQ  
Sbjct  60   QEDFQCAGVAASRITIQRNGLHLPSYSNAPQLIYIVQGRGVLGAVFSGCPETFEESQQSS 119
Query  118  --------------------------------------------------QQRGQSSRPQ 127
                                                              QQ+GQ  RPQ
Sbjct  120  QQGRQQEQEQERQQQQQGEQGRQQGQQEQQQERQGRQQGRQQQEEGRQQEQQQGQQGRPQ 179
Query  128  --------DRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMP 179
                    DRHQK    REGD++A+P GVA+W YN+ D  +VAV++   +S  NQLDQ P
Sbjct  180  QQQQFRQFDRHQKTRRIREGDVVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNP 239
Query  180  RRFYLAGNQEQEFLKY---QQEQGGHQSQKGKHQQ--------EEENEGGSILSGFTLEF 228
            R+FYLAGN E EF +    Q  Q G Q + G+HQQ        E++  G +++SGF  ++
Sbjct  240  RKFYLAGNPENEFNQQGQSQPRQQGEQGRPGQHQQPFGRPRQQEQQGSGNNVFSGFNTQL 299
Query  229  LEHAFSVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKP 288
            L +A++V+++ A+NLQG+N+  ++  I+ V+G L  ++PP      R ++E E EE ++ 
Sbjct  300  LAQALNVNEETARNLQGQND--NRNQIIRVRGNLDFVQPP------RGRQEREHEERQQE 351
Query  289  QCKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLD 348
            Q + ++++ Q   G Q  +  NG++ET C++RL+ NIG     DI++P+AG ++T  S +
Sbjct  352  QLQ-QERQQQ---GGQLMA--NGLEETFCSLRLKENIGNPERADIFSPRAGRISTLNSHN 405
Query  349  FPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQE 408
            +P L +LRLSAE G + +N ++ PH+N+NA+S++Y + G A +QVVN NG+ ++D E+Q+
Sbjct  406  LPILRFLRLSAERGFFYRNGIYSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQQ 465
Query  409  GRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKS 468
            G+++IVPQN  V  ++ +  FEY +FKT +   I TLAG  S+L ALP+EV+ + + +  
Sbjct  466  GQLFIVPQNHGVIQQAGNQGFEYFAFKTEENAFINTLAGRTSFLRALPDEVLANAYQISR 525
Query  469  QQARQIKNNNPFKFLVPPQESQKRAV 494
            +QARQ+K N   + +      Q+RAV
Sbjct  526  EQARQLKYNRQ-ETIALSSSQQRRAV 550

Sequence Alignment: 16. Allergen Name: Pru du 6 Sequence ID: 3EHK_A

 Score = 153.3 bits 878,  Expect = 3e-38
 Identities = 215/460 46%, Positives = 323/460 70%, Gaps = 86/460 18%
Query  19   AFSSREQPQQNECQIQKLNALKPDNRIESEGGLIETWNPNNKPFQCAGVALSRCTLNRNA 78
            A  S+  PQ N+CQ+ +L A +PDNRI++E G IETWN N   FQCAGVA SR T+ RN 
Sbjct  1    ARQSQLSPQ-NQCQLNQLQAREPDNRIQAEAGQIETWNFNQGDFQCAGVAASRITIQRNG 59
Query  79   LRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEPQQP--------------------- 117
            L  PSY+N PQ IYI QG+G++G ++ GCP TFEE QQ                      
Sbjct  60   LHLPSYSNAPQLIYIVQGRGVLGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGEQ 119
Query  118  ------------------------------QQRGQSSRPQ--------DRHQKIYNFREG 139
                                          QQ+GQ  RPQ        DRHQK    REG
Sbjct  120  GRQQGQQEQQQERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQLDRHQKTRRIREG 179
Query  140  DLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLKY---Q 196
            D++A+P GVA+W YN+ D  +VAV++   +S  NQLDQ PR+FYLAGN E EF +    Q
Sbjct  180  DVVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNPENEFNQQGQSQ 239
Query  197  QEQGGHQSQKGKHQQ--------EEENEGGSILSGFTLEFLEHAFSVDKQIAKNLQGENE 248
              Q G Q + G+HQQ        E++  G +++SGF  ++L +A++V+++ A+NLQG+N+
Sbjct  240  PRQQGEQGRPGQHQQPFGRPRQQEQQGNGNNVFSGFNTQLLAQALNVNEETARNLQGQND 299
Query  249  GEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRPRGSQSKSR 308
              ++  I+ V+G L  ++PP   Q++  +E ++E+  ++ Q +G+               
Sbjct  300  NRNQ--IIQVRGNLDFVQPPRGRQEREHEERQQEQLQQERQQQGEQLMA----------- 346
Query  309  RNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSAEFGSLRKNA 368
             NG++ET C++RL+ NIG     DI++P+AG ++T  S ++P L +LRLSAE G + +N 
Sbjct  347  -NGLEETFCSLRLKENIGNPERADIFSPRAGRISTLNSHNLPILRFLRLSAERGFFYRNG 405
Query  369  MFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVVAARSQSDN 428
            ++ PH+N+NA+S++Y + G A +QVVN NG+ ++D E+Q+G+++IVPQN  V  ++ +  
Sbjct  406  IYSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQG 465
Query  429  FEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNNPFKFLVPPQE 488
            FEY +FKT +   I TLAG  S+L ALP+EV+ + + +  +QARQ+K N   + +     
Sbjct  466  FEYFAFKTEENAFINTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQ-ETIALSSS 524
Query  489  SQKRAV 494
             Q+RAV
Sbjct  525  QQRRAV 530

Sequence Alignment: 17. Allergen Name: Ana o 2 Sequence ID: AAN76862

 Score = 135.2 bits 767,  Expect = 7e-33
 Identities = 235/449 52%, Positives = 324/449 72%, Gaps = 38/449 8%
Query  6    FSLCFL-LFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGGLIETWNPNNKPFQC 64
            +S+CFL LF GC +A S +E  QQ+ECQI +L+AL+PDNR+E E G +E W+PN++ F+C
Sbjct  1    LSVCFLILFHGC-LA-SRQEWQQQDECQIDRLDALEPDNRVEYEAGTVEAWDPNHEQFRC 58
Query  65   AGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEPQQPQQRGQSS 124
            AGVAL R T+  N L  P Y+N PQ IY+ QG+G+ G+ YPGCP T++ PQQ +Q+GQS 
Sbjct  59   AGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGCPETYQAPQQGRQQGQSG 118
Query  125  RPQDRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYL 184
            R QDRHQKI  FR GD+IA+P GVA W YN  ++PVV V+++D ++ +NQLD+ PR+F+L
Sbjct  119  RFQDRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHL 178
Query  185  AGNQEQEFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVDKQIAKNLQ 244
            AGN +  F + QQ    HQS+           G +++SGF  E+L  AF VD+++ K L+
Sbjct  179  AGNPKDVFQQQQQ----HQSR-----------GRNLFSGFDTELLAEAFQVDERLIKQLK 223
Query  245  GENEGEDKGAIVTVKGG-LSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRPRGS 303
             E+   ++G IV VK   L VI+P +  Q +R  E EEE EDEK           R  G 
Sbjct  224  SED---NRGGIVKVKDDELRVIRP-SRSQSERGSESEEESEDEK-----------RRWGQ 268
Query  304  QSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSAEFGS 363
                R NGI+ETICTMRL+ NI   +  DIY P+ G +TT  SL++P L WL+LS E G 
Sbjct  269  ----RDNGIEETICTMRLKENINDPARADIYTPEVGRLTTLNSLNLPILKWLQLSVEKGV 324
Query  364  LRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVVAAR 423
            L KNA+ +PH+NLN++SIIY   G+  +QVV+  G RVFDGE++EG++L+VPQNF V  R
Sbjct  325  LYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQMLVVPQNFAVVKR 384
Query  424  SQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNNPFKFL 483
            ++ + FE++SFKTND  M   LAG  S+L  +PEEV+ + F +  + AR+IK NN    L
Sbjct  385  AREERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEVLANAFQISREDARKIKFNNQQTTL 444
Query  484  VPPQESQ 490
               + S+
Sbjct  445  TSGESSH 451

Sequence Alignment: 18. Allergen Name: Pru du 6.0201 Sequence ID: ADN39441

 Score = 132.4 bits 750,  Expect = 6e-32
 Identities = 215/467 46%, Positives = 328/467 70%, Gaps = 40/467 8%
Query  9    CFLL-FSGCCFAFSSREQ--PQQNECQIQKLNALKPDNRIESEGGLIETWNPNNKPFQCA 65
            C+LL F+GC   ++SR++   Q  E Q+ +L A +PDN I+SE G+ E+WNP++  FQ A
Sbjct  1    CLLLLFNGC---LASRQHIFGQNKEWQLNQLEAREPDNHIQSEAGVTESWNPSDPQFQLA 57
Query  66   GVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFEE--PQQPQQRGQS 123
            GVA+ R T+  N L  PSY N PQ IYI +G+G++G ++PGC  TFE+  PQQ QQ+ Q 
Sbjct  58   GVAVVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFPGCAETFEDSQPQQFQQQQQQ 117
Query  124  S--RP-----------------QDRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVS 164
               RP                 QDRHQKI + REGD+IA+P GVA+W YNN + P+VAVS
Sbjct  118  QQFRPSRQEGGQGQQQFQGEDQQDRHQKIRHIREGDIIALPAGVAYWSYNNGEQPLVAVS 177
Query  165  IIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGF 224
            ++D N+ +NQLDQ+PRRFYLAGN + EF    Q+QG +Q Q+   QQ ++  G +I+SGF
Sbjct  178  LLDLNNDQNQLDQVPRRFYLAGNPQDEF--NPQQQGRQQQQQ---QQGQQGNGNNIFSGF 232
Query  225  TLEFLEHAFSVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEE 284
              ++L +A++V+ + A+NLQG+++  ++  IV V+G L  + P +     R  +E ++EE
Sbjct  233  DTQLLAQALNVNPETARNLQGQDD--NRNEIVRVQGQLDFVSPFSRSAGGRGDQERQQEE 290
Query  285  DEKPQCKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTA 344
             +  + + + +  Q  +G   +   NG++ET C+ RL +NIG  S  D YNPQ G ++  
Sbjct  291  QQSQREREEKQREQEQQGGGGQD--NGVEETFCSARLSQNIGDPSRADFYNPQGGRISVV 348
Query  345  TSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDG 404
                +P L +LRLSAE G L  NA++ PH++ NAN+++YA+ G A +QVVN NG+ ++D 
Sbjct  349  NRNHLPILRYLRLSAEKGVLYNNAIYTPHWHTNANALVYAIRGNARVQVVNENGDPILDD 408
Query  405  ELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTF 464
            E++EG+++++PQN  V  ++ ++ FEY+SF+T++     TLAG  S+L ALP+EV+Q+ F
Sbjct  409  EVREGQLFLIPQNHAVITQASNEGFEYISFRTDENGFTNTLAGRTSVLRALPDEVLQNAF 468
Query  465  NLKSQQARQIKNNNPFKFLV----PPQ 487
             +  Q+AR +K N     L+    PP+
Sbjct  469  RISRQEARNLKYNRQESRLLSATSPPR 495

Sequence Alignment: 19. Allergen Name: Sin a 2.0101 Sequence ID: Q2TLW0

 Score = 128.9 bits 729,  Expect = 6e-31
 Identities = 193/435 44%, Positives = 283/435 65%, Gaps = 83/435 19%
Query  4    LVFSLCFLLFSGCCFAFSSREQPQQ--NECQIQKLNALKPDNRIESEGGLIETWNPNNKP 61
            LV ++  LL    C+A  S   P Q  + C +  L+ L+P   I+SE G +E W+ N+  
Sbjct  8    LVATVGVLLVLNGCLARQSLGVPPQVKDACNLDNLDVLQPTEVIKSEAGQVEYWDHNHPQ 67
Query  62   FQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTF--EEP---QQ 116
             +CAGV+++R  + +  L  P++ + P   Y+ QG GI G + PGC  TF   +P   QQ
Sbjct  68   IRCAGVSIARLVIQKGGLYLPTFFSSPFISYVVQGMGISGRVIPGCAETFMDSQPMQGQQ 127
Query  117  PQQRGQSSRP-------------------------------------QDRHQKIYNFREG 139
             QQ+GQ  +                                      +D HQK+ + R G
Sbjct  128  GQQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQGFRDMHQKVEHVRHG 187
Query  140  DLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQEQ 199
            D IA+  G A W+YN  D P++ VS+ID  + +NQLD+ PR F LAGN +Q         
Sbjct  188  DAIAMTPGSAQWIYNTGDQPLIIVSLIDIANYQNQLDRNPRTFRLAGNNQQ--------- 238
Query  200  GGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVDKQIAKNLQGENEGEDKGAIVTVK 259
            G  Q Q    QQ+++N    ILSGF  + L +A+ +D ++A+ LQ  N+ + +G IV VK
Sbjct  239  GSSQQQ----QQQQQN----ILSGFDPQVLAQALKIDVRLAQELQ--NQQDKRGNIVRVK 288
Query  260  GGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRPRGSQSKSRRNGIDETICTM 319
            G + V++PP      R   E E+            +H   PRG     + NG++ETIC+M
Sbjct  289  GPFQVVRPPL-----RQAYESEQW-----------RH---PRGPPQSPQDNGLEETICSM 329
Query  320  RLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNAN 379
            R   NI   +  DIY P  G VT+  S  +P L ++RLSA  G L+ +AM +P YN+NAN
Sbjct  330  RTHENIDDPARADIYKPNLGRVTSVNSYTLPILQYIRLSATRGILQGSAMVLPKYNMNAN 389
Query  380  SIIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDT 439
             I+Y   G+A IQVVN NG+ V+D ++Q+G+++++PQ F    +SQ +NFE++SFKTN  
Sbjct  390  EILYCTQGQARIQVVNDNGQNVLDQQVQKGQLVVIPQGFAYVVQSQ-NNFEWISFKTNAN 448
Query  440  PMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNN 477
             MI TLAG  S L ALP EVI + + +  ++AR+IK N
Sbjct  449  AMISTLAGRTSALRALPLEVITNAYQISLEEARKIKFN 486

Sequence Alignment: 20. Allergen Name: Zan b 2.03 Sequence ID: QYS16039

 Score = 110.6 bits 616,  Expect = 2e-25
 Identities = 182/380 47%, Positives = 261/380 68%, Gaps = 44/380 11%
Query  48   EGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGC 107
            E G+ E W+ NN+ +QCA VA+ R  + +N L  P+YTN P+  Y+ QG+GI G + PGC
Sbjct  1    EAGVTEFWDQNNQQLQCANVAVFRHRIQQNGLLVPAYTNTPELFYVVQGRGIHGAVIPGC 60
Query  108  PSTFEEPQQPQQR----GQSSRPQDRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAV 163
            P T+++ QQ QQ      + SR QD+HQK+   REGD+IA+PTG A W+YNN  + +V V
Sbjct  61   PETYQDEQQQQQSFSYPSEGSRSQDQHQKVRQIREGDIIALPTGSAHWIYNNGQSQLVLV 120
Query  164  SIIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQEQGGHQSQKGKHQQ-----EEENEGG 218
            +++D  + +NQLDQ  R+FYL GN +       Q QG  QSQ G++Q+     +      
Sbjct  121  ALVDVGNSDNQLDQYFRKFYLGGNPQ------PQLQGTSQSQGGRYQERLGGGDSSRRSA 174
Query  219  SILSGFTLEFLEHAFSVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQE 278
            +I++GF   +L  AF+V+ ++ + LQ       +G I+ V+  + V+ P      QR QE
Sbjct  175  NIFNGFDERLLAEAFNVNPELIRRLQRPQM--QRGIIIRVEEEFRVLTP------QRGQE 226
Query  279  EEEEEEDEKPQCKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQA 338
              E +                P G     R NG++ET+CTMRLRHNI   S  D+YNP+A
Sbjct  227  SYESD----------------PYG-----RYNGVEETLCTMRLRHNINDPSRADVYNPRA 265
Query  339  GSVTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNG 398
            G VTT   L++P L WL+LSAE G+L KNA+  PH+NLNA+SI+Y   G   +Q+V+ NG
Sbjct  266  GRVTTVNRLNLPVLRWLQLSAEKGNLYKNALTAPHWNLNAHSIVYITRGNGRVQIVSENG 325
Query  399  ERVFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEE 458
              VFDGE++EG++++VPQ F V  R+ +  +E++SFKTND  M   LAG  S+L ALP +
Sbjct  326  NNVFDGEIREGQLIVVPQGFAVVKRASNRGLEWISFKTNDYAMTNQLAGRVSVLRALPLD 385
Query  459  VIQH 462
            VIQ+
Sbjct  386  VIQN 389

Sequence Alignment: 21. Allergen Name: Gly m 6.0401 Sequence ID: Q9SB11

 Score = 110.7 bits 618,  Expect = 2e-25
 Identities = 243/476 51%, Positives = 346/476 72%, Gaps = 77/476 16%
Query  7    SLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGGLIETWNPNNKPFQCAG 66
            SLC+LL+S  CFA SS    + NECQ+  LNAL+PD+R+ESEGGLI+TWN  +  ++CAG
Sbjct  11   SLCLLLLSSACFAISSS---KLNECQLNNLNALEPDHRVESEGGLIQTWNSQHPELKCAG 67
Query  67   VALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEPQ-QPQQRGQSSR 125
            V +S+ TLNRN L  PSY+  P+ I I QGKG +G+  PGCP TFEEPQ Q  +RG  S+
Sbjct  68   VTVSKLTLNRNGLHLPSYSPYPRMIIIAQGKGALGVAIPGCPETFEEPQEQSNRRGSRSQ 127
Query  126  PQ---DRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRF 182
             Q   D HQKI +F EGD++ +P GV +W YN  D PVVA+S++DT+++ NQLDQ PR F
Sbjct  128  KQQLQDSHQKIRHFNEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVF 187
Query  183  YLAGNQEQEF---LKYQQEQGGHQSQK-GKHQQEEENEGGSILSGFTLEFLEHAFSVDKQ 238
            YLAGN + E+   ++ QQ+Q  H  +K G+HQQEEE EGGS+LSGF+  FL ++F+ ++ 
Sbjct  188  YLAGNPDIEYPETMQQQQQQKSHGGRKQGQHQQEEEEEGGSVLSGFSKHFLAQSFNTNED 247
Query  239  IAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQ--------------------QRP-- 276
            IA+ LQ  ++  ++  IVTV+GGLSVI P   EQQ                    +RP  
Sbjct  248  IAEKLQSPDD--ERKQIVTVEGGLSVISPKWQEQQDEDEDEDEDDEDEQIPSHPPRRPSH 305
Query  277  ----QEEEEEEEDEKPQ----CKGKDKHCQ---------------------------RPR 301
                Q+E+E+E+++KP+     +GK ++ Q                           RPR
Sbjct  306  GKREQDEDEDEDEDKPRPSRPSQGKREQDQDQDEDEDEDEDQPRKSREWRSKKTQPRRPR 365
Query  302  GSQSKSR----RNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRL 357
              + + R    RNG++E ICT++L  NI + S  D YNP+AG ++T  SL +PAL  ++L
Sbjct  366  QEEPRERGCETRNGVEENICTLKLHENIARPSRADFYNPKAGRISTLNSLTLPALRQFQL 425
Query  358  SAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQN 417
            SA++  L KN ++ PH+NLNANS+IY   G+  ++VVNC G  VFDGEL+ G++L+VPQN
Sbjct  426  SAQYVVLYKNGIYSPHWNLNANSVIYVTRGQGKVRVVNCQGNAVFDGELRRGQLLVVPQN 485
Query  418  FVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNN 477
            FVVA ++    FEY+ FKT+   +   L     ++ A+P EV+ H++NL+  Q  ++K  
Sbjct  486  FVVAEQAGEQGFEYIVFKTHHNAVTSYL---KDVFRAIPSEVLAHSYNLRQSQVSELKYE 542
Query  478  NPFKFLVPPQESQ 490
              +  LV P+  Q
Sbjct  543  GNWGPLVNPESQQ 555

Sequence Alignment: 22. Allergen Name: Gly m 6.0501 Sequence ID: Q7GC77

 Score = 106.5 bits 592,  Expect = 4e-24
 Identities = 237/471 50%, Positives = 331/471 70%, Gaps = 44/471 9%
Query  7    SLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGGLIETWNPNNKPFQCAG 66
            SLC+LL+S  CFA +S    + NECQ+  LNAL+PD+R+ESEGGLIETWN  +  +QCAG
Sbjct  12   SLCLLLLSSACFAITSS---KFNECQLNNLNALEPDHRVESEGGLIETWNSQHPELQCAG 68
Query  67   VALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEPQQPQ-QRGQSSR 125
            V +S+ TLNRN L  PSY+  PQ I + QGKG  G  +PGCP TFE+PQQ   +RG  S+
Sbjct  69   VTVSKRTLNRNGLHLPSYSPYPQMIIVVQGKGAIGFAFPGCPETFEKPQQQSSRRGSRSQ 128
Query  126  PQ--DRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFY 183
             Q  D HQKI +F EGD++ +P GV +W YN  D PVVA+S++DT+++ NQLDQ PR FY
Sbjct  129  QQLQDSHQKIRHFNEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQNPRVFY 188
Query  184  LAGN---QEQEFLKYQQEQGGHQSQK-GKHQQEEENEGGSILSGFTLEFLEHAFSVDKQI 239
            LAGN   +  E ++ QQ+Q  H  +K G+HQQ+EE EGGS+LSGF+  FL ++F+ ++  
Sbjct  189  LAGNPDIEHPETMQQQQQQKSHGGRKQGQHQQQEE-EGGSVLSGFSKHFLAQSFNTNEDT 247
Query  240  AKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQ------------------QRP---QE 278
            A+ L+  +  +++  IVTV+GGLSVI P   EQ+                  +RP   + 
Sbjct  248  AEKLRSPD--DERKQIVTVEGGLSVISPKWQEQEDEDEDEDEEYEQTPSYPPRRPSHGKH 305
Query  279  EEEEEEDEKPQCKGKDKHCQRP-RGSQSKSR------RNGIDETICTMRLRHNIGQTSSP 331
            E++E+EDE+      D   QRP R  Q + R      RNG++E ICTM+L  NI + S  
Sbjct  306  EDDEDEDEEEDQPRPDHPPQRPSRPEQQEPRGRGCQTRNGVEENICTMKLHENIARPSRA 365
Query  332  DIYNPQAGSVTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALI 391
            D YNP+AG ++T  SL +PAL  + LSA++  L +N ++ PH+NLNANS+IY   G+  +
Sbjct  366  DFYNPKAGRISTLNSLTLPALRQFGLSAQYVVLYRNGIYSPHWNLNANSVIYVTRGKGRV 425
Query  392  QVVNCNGERVFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSL 451
            +VVNC G  VFDGEL+ G++L+VPQNFVVA +     +EYV FKT+   +   +     +
Sbjct  426  RVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQGGEQGLEYVVFKTHHNAVSSYI---KDV 482
Query  452  LNALPEEVIQHTFNLKSQQARQIKNNNPFKFLVPP 486
            + A+P EV+ +++NL   Q RQ+K       LV P
Sbjct  483  FRAIPSEVLSNSYNLGQSQVRQLKYQGNSGPLVNP 517

Sequence Alignment: 23. Allergen Name: Cuc ma 4.0101 Sequence ID: P13744

 Score = 104.3 bits 578,  Expect = 2e-23
 Identities = 190/452 42%, Positives = 291/452 64%, Gaps = 50/452 11%
Query  8    LCFLLF-SGCC--------FAFSSREQPQQNE------CQIQKLNALKPDNRIESEGGLI 52
            LC+ +F +GC         + F   E  QQ+       C+++ L A  P  R E+E  + 
Sbjct  10   LCLAVFINGCLSQIEQQSPWEFQGSEVWQQHRYQSPRACRLENLRAQDPVRRAEAEAIFT 69
Query  53   ETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFE 112
            E W+ +N  FQCAGV + R T+    L  P ++N P+ I++ QG GI G+  PGC  T+ 
Sbjct  70   EVWDQDNDEFQCAGVNMIRHTIRPKGLLLPGFSNAPKLIFVAQGFGIRGIAIPGCAETY- 128
Query  113  EPQQPQQRGQS--SRPQDRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNS 170
              Q   +R QS  S  +D+HQKI  FREGDL+ VP GV+ WMYN   + +V +   DT +
Sbjct  129  --QTDLRRSQSAGSAFKDQHQKIRPFREGDLLVVPAGVSHWMYNRGQSDLVLIVFADTRN 186
Query  171  LENQLDQMPRRFYLAGNQEQEFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLE 230
            + NQ+D   R+FYLAG  EQ  ++   E+    S+KG   ++     G+I+SGF  EFLE
Sbjct  187  VANQIDPYLRKFYLAGRPEQ--VERGVEEWERSSRKGSSGEK----SGNIFSGFADEFLE 240
Query  231  HAFSVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQC 290
             AF +D  + + L+GE++  D+  IV V   + V+ P               E+DE+ + 
Sbjct  241  EAFQIDGGLVRKLKGEDDERDR--IVQVDEDFEVLLP---------------EKDEEERS 283
Query  291  KGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFP 350
            +G+         S+S+S  NG++ETICT+RL++NIG++   D++NP+ G ++TA    +P
Sbjct  284  RGRYIE------SESESE-NGLEETICTLRLKQNIGRSVRADVFNPRGGRISTANYHTLP 336
Query  351  ALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEGR 410
             L  +RLSAE G L  NAM  PHY +N++S++YA  G A +QVV+  G+ VFDGE++EG+
Sbjct  337  ILRQVRLSAERGVLYSNAMVAPHYTVNSHSVMYATRGNARVQVVDNFGQSVFDGEVREGQ 396
Query  411  VLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQ 470
            VL++PQNFVV  R+    FE+++FKTND  +   LAG  S +  LP  V+ + + +  ++
Sbjct  397  VLMIPQNFVVIKRASDRGFEWIAFKTNDNAITNLLAGRVSQMRMLPLGVLSNMYRISREE 456
Query  471  ARQIKNNNPFKFLVPPQESQKR 492
            A+++K       ++ P  SQ R
Sbjct  457  AQRLKYGQQEMRVLSPGRSQGR 478

Sequence Alignment: 24. Allergen Name: Pis v 2.0101 Sequence ID: DQ631676

 Score = 104.1 bits 577,  Expect = 2e-23
 Identities = 208/462 45%, Positives = 305/462 66%, Gaps = 37/462 8%
Query  4    LVFSLCFLLFSGCCFA-------FSSREQPQ--QNECQIQKLNALKPDNRIESEGGLIET 54
            L FSL FLL+  C FA          R+Q Q  Q +CQIQ LNAL+P  RIESE G+ E 
Sbjct  7    LSFSLGFLLLFHCSFAQIEQVVNSQQRQQQQRFQTQCQIQNLNALEPKRRIESEAGVTEF 66
Query  55   WNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEP 114
            W+ N + +QCA VA+ R T+    L  PSY N P+ +Y+ QG GI G ++PGCP TF+E 
Sbjct  67   WDQNEEQLQCANVAVFRHTIQSRGLLVPSYDNAPELVYVVQGSGIHGAVFPGCPETFQEE 126
Query  115  QQPQQRGQSSRPQ-DRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLEN 173
             Q + R + S+   ++HQK+   +EGD+IA+P GVA W+YNN  + +V V++ D  + EN
Sbjct  127  SQSRSRSERSQQSGEQHQKVRPIQEGDVIALPAGVAHWIYNNGQSKLVLVALADVGNSEN 186
Query  174  QLDQMPRRFYLAGNQEQEFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAF 233
            QLDQ  R+F L G+ +QE     Q +   QSQ  +  Q+ + +  +ILS F  E L ++F
Sbjct  187  QLDQYLRKFVLGGSPQQEIQGSGQSRSRSQSQSSRRGQQGQ-QSNNILSAFDEEILAQSF 245
Query  234  SVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGK 293
            ++D Q+A+ LQ E     +G IV V+  L V+ P   EQ+Q     E EEE E+ Q    
Sbjct  246  NIDTQLARRLQKEKR--QRGIIVRVQEDLEVLSPHRQEQEQ-----EYEEERERRQ---- 294
Query  294  DKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALS 353
                           RNG++ET CTM L++NI   S  D+YNP+ G V++  +L++P L 
Sbjct  295  ---------------RNGLEETFCTMTLKYNINDPSRADVYNPRGGRVSSVNALNLPILR 339
Query  354  WLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEGRVLI 413
            +L+LSA+ G L ++A++ PH+N+NA+SI+Y   G   IQ+V+ NGE VFD E++EG++++
Sbjct  340  FLQLSAKKGVLHRDAILAPHWNVNAHSIVYITRGNGRIQIVSENGESVFDEEIREGQLVV 399
Query  414  VPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQ 473
            VPQNF V  R+ SD FE+VSFKTN       LAG  S++ ALP +VI+++F++  + AR+
Sbjct  400  VPQNFAVVKRASSDKFEWVSFKTNGLSQTSQLAGRVSVFRALPLDVIKNSFDISREDARR 459
Query  474  IKNNNPFKFLVPPQESQKR 492
            +K +     +  P  S +R
Sbjct  460  LKESRSETTIFAPGSSSQR 478

Sequence Alignment: 25. Allergen Name: Zan b 2.0102 Sequence ID: QYU76046

 Score = 102.8 bits 568,  Expect = 4e-23
 Identities = 166/386 43%, Positives = 267/386 69%, Gaps = 31/386 8%
Query  48   EGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGC 107
            E G+ E W+ NN+ +QCA VA+ R  + +  L  PSYTN  +  Y+ QG+GI G ++PGC
Sbjct  1    EAGVTEFWDQNNEQLQCANVAVFRHRIQQRGLLVPSYTNTAELFYVVQGRGIHGAVFPGC 60
Query  108  PSTFEEPQQPQ-QRGQSSRPQDRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSII 166
            P T+++ QQ Q ++ + SR QD+HQK+  +REGD++A+PTG A W+YNN  + +V V+++
Sbjct  61   PETYQDQQQQQSHQSEGSRSQDQHQKVRQLREGDIVAMPTGSAHWIYNNGQSQLVLVALV 120
Query  167  DTNSLENQLDQMPRRFYLAGNQEQEFLKYQQEQGGHQSQKGKHQQ-EEENEGGSILSGFT 225
            D  + +NQLDQ  R+FY+ GN +QE+  Y Q QG    Q  + +     + GG+I++GF 
Sbjct  121  DVGNSDNQLDQYLRKFYIGGNPQQELQGYSQSQGSRSYQGSQGEGGSRRSSGGNIFNGFD 180
Query  226  LEFLEHAFSVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEED 285
              +L  AF+V+ +I + LQ       +G IV V+  L V++P      QR ++E+E+E  
Sbjct  181  ERLLADAFNVNPEIIRRLQKPQL--PRGIIVRVEEELEVLRP------QRGEQEQEQE-- 230
Query  286  EKPQCKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTAT 345
                 +G+D               NG++ET CT++L+HNI   S  D+YNP+ G ++T  
Sbjct  231  ----FRGRD---------------NGLEETYCTIKLKHNINNPSDADVYNPRGGRISTVN 271
Query  346  SLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGE 405
            S+++P L W++LSAE G+L +NA + PH+NLN++S++Y   G   +Q+V+ NG  V+DG+
Sbjct  272  SFNLPVLRWIQLSAEKGNLYQNAQLAPHWNLNSHSVVYVTRGSGRVQIVSENGNNVYDGQ 331
Query  406  LQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQH 462
            ++EG++++VPQ + V  ++ +  +E++SFKTND      LAG NS++ ALP +VIQ+
Sbjct  332  IKEGQLIVVPQGYAVLKKASNQGLEWISFKTNDNAETSQLAGRNSVIRALPLDVIQN 388

Sequence Alignment: 26. Allergen Name: Gos h 3 Sequence ID: P09802

 Score = 103.1 bits 571,  Expect = 4e-23
 Identities = 212/472 44%, Positives = 315/472 66%, Gaps = 50/472 10%
Query  4    LVFSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGGLIETWNPNNKPFQ 63
            L +SL FL F+GC    +   Q  QNECQI +L A  P  RI SE G  E WNPN + ++
Sbjct  8    LFLSLLFL-FNGCLARQTFSSQQSQNECQINRLRASAPQTRIRSEAGTTEWWNPNCQQLR 66
Query  64   CAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEPQQPQQRGQS 123
            CAGV++ R T+  N L  PS+TN PQ +YI QG+GI G++ PGC  TF++ QQ Q++ + 
Sbjct  67   CAGVSVMRQTIEPNGLVLPSFTNAPQLLYIVQGRGIQGIVMPGCAETFQDSQQWQHQSRG 126
Query  124  SRPQDRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFY 183
             R QD+HQK+  FR+GD+IA+P GV  W YN+ +  VV ++++DT +  NQLD +PRRF+
Sbjct  127  -RFQDQHQKVRRFRQGDIIALPQGVVHWSYNDGNERVVTINLLDTGNSANQLDNIPRRFH 185
Query  184  LAGN--QEQEFLKY--QQEQG----GHQSQ-----------------KGKHQQEEEN--E 216
            LAGN  +EQ  L+   QQ QG    G +S+                 + +HQ+EEE   E
Sbjct  186  LAGNPEEEQRQLRRLAQQMQGRSERGEESEEEEGEGEEEEEEDNPSRRSRHQEEEEQGRE 245
Query  217  GGS---ILSGFTLEFLEHAFSVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQ 273
              S   +L  F   FL +AF+VD  I + +Q    G ++G I+ V+  L V+ PP     
Sbjct  246  SSSCNNLLCAFDRNFLAQAFNVDHDIIRKIQ-RVRG-NRGTIIRVRDRLQVVTPP----- 298
Query  274  QRPQEEEEEEEDEKPQCKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDI 333
             R +EEE EE  ++          QR R ++  S+ NG++ET C+MR++ N+      DI
Sbjct  299  -RMEEEEREERQQE----------QRYRHTRGGSQDNGLEETFCSMRIKENLADPERADI 347
Query  334  YNPQAGSVTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQV 393
            +NPQAG ++T   +++P L  L LSAE G L   A ++P++N+NA+ I+Y L G A +QV
Sbjct  348  FNPQAGRISTLNRFNLPILQRLELSAERGVLYNRAGLIPQWNVNAHKILYMLRGCARVQV 407
Query  394  VNCNGERVFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLN 453
            VN NG+ VFD  +++G++L VPQNF    ++ ++  E++SF TN       +AG+ S++ 
Sbjct  408  VNHNGDAVFDDNVEQGQLLTVPQNFAFMKQAGNEGAEWISFFTNSEATNTPMAGSVSFMR 467
Query  454  ALPEEVIQHTFNLKSQQARQIKNNNPFKFLVPPQESQKRAVA 495
            ALPEEV+  ++ +  + AR+IK NN   F+  P +S++RA A
Sbjct  468  ALPEEVVAASYQVSREDARRIKFNNKNTFFFTPSQSERRADA 509

Sequence Alignment: 27. Allergen Name: Pis v 2.0201 Sequence ID: DQ631677

 Score = 103.0 bits 570,  Expect = 4e-23
 Identities = 208/448 46%, Positives = 295/448 65%, Gaps = 57/448 12%
Query  4    LVFSLCFLLFSGCCFA-------FSSREQPQ--QNECQIQKLNALKPDNRIESEGGLIET 54
            L FSL FLL+  C FA          R+Q Q  Q +CQIQ LNAL+P  RIESE G+ E 
Sbjct  7    LSFSLGFLLLFHCSFAQIEQVVNSQQRQQQQRFQTQCQIQNLNALEPKRRIESEAGVTEF 66
Query  55   WNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEP 114
            W+ N + +QCA VA+ R T+    L  PSY N P+ +Y+ QG GI G ++PGCP TF+E 
Sbjct  67   WDQNEEQLQCANVAVFRHTIQSRGLLVPSYNNAPELVYVVQGSGIHGAVFPGCPETFQEE 126
Query  115  QQPQQRGQSSRPQ------DRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDT 168
             Q Q R Q SR +      ++HQK+ + REGD+IA+P GVA W+YNN  + +V V++ D 
Sbjct  127  SQSQSRSQHSRSERSQQSGEQHQKVRHIREGDIIALPAGVAHWIYNNGQSKLVLVALADV 186
Query  169  NSLENQLDQMPRRFYLAGNQEQEFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEF 228
             + ENQLDQ  R+F L G+ +QE       QGG QS        +  +  +ILS F  E 
Sbjct  187  GNSENQLDQYLRKFVLGGSPQQEI------QGGGQSWSQSRSSRKGQQSNNILSAFDEEI 240
Query  229  LEHAFSVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKP 288
            L ++F++D Q+ K LQ E +   +G IV VK  L V+ P         Q +E+E  D   
Sbjct  241  LAQSFNIDTQLVKKLQREEK--QRGIIVRVKEDLQVLSP---------QRQEKEYSD--- 286
Query  289  QCKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLD 348
                                 NG++ET CTM L+ NI   S  D+YNP+ G VT+  +L+
Sbjct  287  ---------------------NGLEETFCTMTLKLNINDPSRADVYNPRGGRVTSINALN 325
Query  349  FPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQE 408
            +P L +L+LS E G L +NA+  PH+N+NA+SI+Y   G   +Q+V+ NGE VFD E++E
Sbjct  326  LPILRFLQLSVEKGVLYQNAIMAPHWNMNAHSIVYITRGNGRMQIVSENGESVFDEEIRE 385
Query  409  GRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKS 468
            G++++VPQNF V  R+ SD FE+VSFKTN    I  LAG  S++  LP +VIQ++F++  
Sbjct  386  GQLVVVPQNFAVVKRASSDGFEWVSFKTNGLAKISQLAGRISVMRGLPLDVIQNSFDISR 445
Query  469  QQARQIKNN-NPFKFLVPPQESQKR 492
            + A  +K + +    + P   SQ++
Sbjct  446  EDAWNLKESRSEMTIFAPGSRSQRQ 470

Sequence Alignment: 28. Allergen Name: Zan b 2.0101 Sequence ID: QYU76045

 Score = 102.3 bits 565,  Expect = 5e-23
 Identities = 170/387 43%, Positives = 268/387 69%, Gaps = 30/387 7%
Query  48   EGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGC 107
            E G+ E W+ NN+ +QCA VA+ R  + +  L  PSYTN  +  Y+ QG+GI G ++PGC
Sbjct  1    EAGVTEFWDQNNEQLQCANVAVFRHRIQQRGLLVPSYTNTAELFYVVQGRGIHGAVFPGC 60
Query  108  PSTFEEPQQPQ-QRGQSSRPQDRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSII 166
            P T+++ QQ Q ++ + SR QD+HQK+  +REGD++AVPTG A W+YNN  + +V V+++
Sbjct  61   PETYQDQQQQQSHQSEGSRSQDQHQKVRQLREGDIVAVPTGSAHWIYNNGQSQLVLVALV 120
Query  167  DTNSLENQLDQMPRRFYLAGNQEQEFLKYQQEQGGHQSQKGKHQ-QEEENEGGSILSGFT 225
            D  + +NQLDQ  R+FY+ GN +QE+  Y Q QG    Q  + +     + GG+I++GF 
Sbjct  121  DVGNSDNQLDQYLRKFYIGGNPQQELQGYSQSQGSRSYQGSQGEGSSRRSSGGNIFNGFD 180
Query  226  LEFLEHAFSVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEED 285
              +L  AF+V+ +I + LQ       +G IV V+  L V++P      QR QE+E+E+E 
Sbjct  181  ERLLADAFNVNPEIIRRLQKPQL--PRGIIVRVEEELEVLRP------QRGQEQEQEQE- 231
Query  286  EKPQCKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTAT 345
                 +G+D               NG++ET CT++L+HNI   S  D+YNP+ G ++T  
Sbjct  232  ----FRGRD---------------NGLEETYCTIKLKHNINNPSDADVYNPRGGRISTVN 272
Query  346  SLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGE 405
            S+++P L W++LSAE G+L +NA + PH+NLN++S++Y   G   +Q+V+ NG  V+DG+
Sbjct  273  SFNLPVLRWIQLSAEKGNLYQNAQLAPHWNLNSHSVVYVTRGSGRVQIVSENGNNVYDGQ 332
Query  406  LQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQH 462
            ++EG++++VPQ + V  R+ +  +E++SFKTND      LAG NS++ ALP +VIQ+
Sbjct  333  IKEGQLIVVPQGYAVLKRASNQGLEWISFKTNDNAETSQLAGRNSVIRALPLDVIQN 389

Sequence Alignment: 29. Allergen Name: Ses i 7.0101 Sequence ID: Q9AUD2

 Score = 101.2 bits 559,  Expect = 1e-22
 Identities = 189/410 46%, Positives = 271/410 66%, Gaps = 42/410 10%
Query  28   QNECQIQKLNALKPDNRIESEGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNG 87
            + +C++++L A +P  R ESE GL E W+ NN+ F+CAGVA  R  +    L  P Y N 
Sbjct  46   RTDCRVERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLPHYNNA 105
Query  88   PQEIYIQQGKGIFGMIYPGCPSTFEEPQQPQQRGQSSRPQDRHQKIYNFREGDLIAVPTG 147
            PQ +Y+ +G+GI G + PGC  TFE   QP+Q  +  R  DRHQK+  FR+GD++A+P G
Sbjct  106  PQLLYVVRGRGIQGTVIPGCAETFERDTQPRQ-DRRRRFMDRHQKVRQFRQGDILALPAG 164
Query  148  VAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQEQGGHQSQKG 207
            +  W YNN   P++ V+++DT +  NQLDQ  R F+LAGN           QGG QS  G
Sbjct  165  LTLWFYNNGGEPLITVALLDTGNAANQLDQTFRHFFLAGNP----------QGGRQSYFG 214
Query  208  KHQQE-EENEGGSILSGFTLEFLEHAFSVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIK 266
            + Q E ++ E  +I++GF  E L  AF VD Q A+ L+G+++   +G IV  +  L ++ 
Sbjct  215  RPQTEKQQGETKNIFNGFDDEILADAFGVDVQTARRLKGQDD--LRGRIVRAER-LDIVL 271
Query  267  PPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIG 326
            P          EEEEE  +  P                  S  NG++ET+CT +LR N+ 
Sbjct  272  PG---------EEEEERWERDPY-----------------SGANGLEETLCTAKLRENLD 305
Query  327  QTSSPDIYNPQAGSVTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALN 386
            + +  D+YNP+ G +++  SL +P LSWLRLSAE G L +N +  PH+NLNA+SIIY   
Sbjct  306  EPARADVYNPHGGRISSLNSLTLPVLSWLRLSAEKGVLYRNGLVAPHWNLNAHSIIYITR 365
Query  387  GRALIQVVNCNGERVFDGELQEGRVLIVPQNFVVAAR-SQSDNFEYVSFKTNDTPMIGTL 445
            G    QVV   G  VFDG ++EG+++IVPQN+VVA R SQ + +E++SFKTND  M   L
Sbjct  366  GSGRFQVVGHTGRSVFDGVVREGQLIIVPQNYVVAKRASQDEGLEWISFKTNDNAMTSQL 425
Query  446  AGANSLLNALPEEVIQHTFNLKSQQARQIKNN 477
            AG  S + A+PEEV+   + +   +AR++K N
Sbjct  426  AGRLSAIRAMPEEVVMTAYQVSRDEARRLKYN 457

Sequence Alignment: 30. Allergen Name: Zan b 2.02 Sequence ID: QYU76044

 Score = 98.6 bits 542,  Expect = 7e-22
 Identities = 169/380 44%, Positives = 256/380 67%, Gaps = 35/380 9%
Query  48   EGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGC 107
            E G+ E W+ NN  +QCA VA+ R  + +N L  P+YTN  +  Y+ QG+GI G ++PGC
Sbjct  1    EAGVTEFWDQNNPQLQCANVAVFRHRIQKNGLLVPAYTNTAELFYVVQGRGIHGAVFPGC 60
Query  108  PSTFEEPQQPQQ-RGQSSRPQDRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSII 166
            P T+++ QQ Q  + Q SR QD+HQK+   REGD+IA+PTG A W+YNN  + +V V+++
Sbjct  61   PETYQDQQQQQSYQSQGSRSQDQHQKVRQIREGDIIALPTGAAHWIYNNGGSQLVLVALV 120
Query  167  DTNSLENQLDQMPRRFYLAGNQEQEFLKYQQEQ--GGHQSQKGKHQQEEENEGGSILSGF 224
            D  + +NQLDQ  R+FYL GN + E+    Q Q  GG+Q  +G          G++++GF
Sbjct  121  DVGNSDNQLDQYFRKFYLGGNPQPELQGTSQRQQGGGYQGSQGGGGGSRR---GNMFNGF 177
Query  225  TLEFLEHAFSVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEE 284
               +L  AF+V+ ++ + LQ       +G IV V+  + V+ P      QR QE+E+E+E
Sbjct  178  DERLLADAFNVNPELIRRLQ--RPQMQRGIIVRVEEEFRVLSP------QRGQEQEQEQE 229
Query  285  DEKPQCKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTA 344
             +          C            NG++ET CTM+LRHNI   S  D+YNP+ G VTT 
Sbjct  230  QD----------CD-----------NGVEETFCTMKLRHNINDPSRADVYNPRGGRVTTV 268
Query  345  TSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDG 404
              +++P L WL+LSAE G+L +NA+  PH+NLN +SI+Y   G   +Q+V+ NG  VF+G
Sbjct  269  NRFNLPVLRWLQLSAEKGNLYQNALTSPHWNLNCHSIVYITRGSGRMQIVSENGNDVFNG 328
Query  405  ELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEV 459
            E++EG+++++PQ F V  ++ +  +E+++FKTND  M   LAG  S++ ALP +V
Sbjct  329  EIREGQLIVIPQGFAVVKKASNRGLEWIAFKTNDNAMTNQLAGRVSVMRALPLDV 383

Sequence Alignment: 31. Allergen Name: Ber e 2 Sequence ID: AAO38859

 Score = 93.2 bits 510,  Expect = 3e-20
 Identities = 201/457 43%, Positives = 299/457 65%, Gaps = 46/457 10%
Query  1    MAKL-VFSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEGGLIETWNPNN 59
            MAKL ++SL  +L+  CC+A    EQ +  EC+IQ+L A +P  R+E+E G+ E W+  +
Sbjct  1    MAKLFLLSLGIFLLFHCCLAIE-YEQEELYECRIQRLTAQEPQYRLEAEAGVSEVWDYTD 59
Query  60   KPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEPQQPQ- 118
            + F+CAGVA  R T+    L  P YTN P+  Y+ QG+GI+G++ PGCP TF+   Q Q 
Sbjct  60   QQFRCAGVAALRNTIRPQGLLLPVYTNAPKLYYVTQGRGILGVLMPGCPETFQSMSQFQG 119
Query  119  ---QRGQSSRPQDRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQL 175
               Q  +  R QD+HQK++++++GD+IA+P GVA W YN+ D  +V V +  T S  NQL
Sbjct  120  SREQEEERGRFQDQHQKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTVLVQHTASDLNQL 179
Query  176  DQMPRRFYLAGNQEQEFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHA--F 233
            DQ PR F+LAGN +    + Q+++G     +G +Q   +N    ++ GF +E L     F
Sbjct  180  DQNPRHFFLAGNIQ----RSQKQRGERYGLRGGQQILADN----VFKGFNMEALADVLGF 231
Query  234  SVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGK 293
             +D + A+ ++GE++   +G IV V+ GL VI+PP      R +EE E++E         
Sbjct  232  GMDTETARKVRGEDD--QRGHIVRVEQGLKVIRPP------RIREELEQQEG-------- 275
Query  294  DKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALS 353
                    G       NG++ETIC+  + +NI   +  D YNP+AG +TT  SL  P L+
Sbjct  276  --------GGY-----NGLEETICSATFIQNIDNPAEADFYNPRAGRLTTVNSLKVPILT 322
Query  354  WLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEGRVLI 413
            +L+LSA  G L +NAM  P + LNANS++YA+ G A +Q+V+  GE VFD  L+EG++++
Sbjct  323  FLQLSAMKGVLYENAMMAPLWRLNANSVVYAVRGEARVQIVDHRGETVFDDNLREGQMVV 382
Query  414  VPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQ 473
            VPQNFVV  ++ S  FE+V F TND  +  T AG  S L  +P  V+ + + L  ++AR+
Sbjct  383  VPQNFVVVKQAGSRGFEWVVFNTNDNALFSTAAGRTSPLRGIPVGVLANAYRLSQEEARR 442
Query  474  IKNNNPFKFLVPP-QESQKRAVA 495
            IK N     L  P   S+ RA A
Sbjct  443  IKLNRDEAVLFQPGSRSRGRASA 465

Sequence Alignment: 32. Allergen Name: Fag e 1 Sequence ID: Q9XFM4

 Score = 86.7 bits 471,  Expect = 3e-18
 Identities = 175/449 38%, Positives = 288/449 64%, Gaps = 82/449 18%
Query  4    LVFSLCFLLFSGCCFAF-----SSREQPQ------QNECQIQKLNALKPDNRIESEGGLI 52
            L FSLC++++S C   +       R +P+      Q++C IQ+L A +P  R+ SE G+ 
Sbjct  7    LSFSLCLMVLS-CSAQLLPWQKGQRSRPHHGHQQFQHQCDIQRLTASEPSRRVRSEAGVT 65
Query  53   ETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTF- 111
            E W+ +   F+CAG    R  +    L  PSY+N P   +++QG+G+ G++ PGCP TF 
Sbjct  66   EIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYSNAPYITFVEQGRGVQGVVVPGCPETFQ 125
Query  112  -----EEPQ-QPQQR------GQSSRPQ-----------------------------DRH 130
                 E P+ Q  QR      G+SSR                               D+H
Sbjct  126  SGSEFEYPRSQRDQRSRQSESGESSRGDQRSRQSESEESSRGDQRSRQSESEEFSRGDQH 185
Query  131  QKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQ 190
            QKI+  R+GD+I  P GV  W +NN D  ++++++ D NS++NQLD+  R F+LAG  +Q
Sbjct  186  QKIFRIRDGDVIPSPAGVVQWTHNNGDNDLISITLYDANSFQNQLDENVRNFFLAGQSKQ 245
Query  191  ----EFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAF-SVDKQIAKNLQG 245
                   + Q  + G   Q  + Q +E     +ILSGF  E L+  F +VD++    L+G
Sbjct  246  SREDRRSQRQTREEGSDRQSRESQDDEALLEANILSGFEDEILQEIFRNVDQETISKLRG 305
Query  246  ENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRPRGSQS 305
            EN  + +G IV  +          D + + P+E EEE + E    +G      R RG   
Sbjct  306  EN--DQRGFIVQAR----------DLKLRVPEEYEEELQRE----RG-----DRKRGGSG 344
Query  306  KSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSAEFGSLR 365
            +S  NG+++  C +++R+N+ + S  D++NP+AG + T  S ++P L +++LSA+   L 
Sbjct  345  RS--NGLEQAFCNLKFRQNVNRPSRADVFNPRAGRINTVDSNNLPILEFIQLSAQHVVLY 402
Query  366  KNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVVAARSQ 425
            KNA++ P +NLNA+S +Y   G   +QVV   G  VFD  +Q G++L+VPQ F V  ++ 
Sbjct  403  KNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKAG 462
Query  426  SDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKN 476
             + +E+V +K +D  +   +AG  S+L A+P EV+ +++++ +++A ++KN
Sbjct  463  REGLEWVELKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFRLKN 513

Sequence Alignment: 33. Allergen Name: Fag e 1 Sequence ID: BAA21758

 Score = 86.7 bits 471,  Expect = 4e-18
 Identities = 170/465 36%, Positives = 295/465 63%, Gaps = 113/465 24%
Query  4    LVFSLCFLLFSGCCFAF-----SSREQP----QQ--NECQIQKLNALKPDNRIESEGGLI 52
            L FSLC++++S C   +       R +P    QQ  ++C +Q+L A +P  R+ SE G+ 
Sbjct  7    LSFSLCLMVLS-CSAQLLPWRKGQRSRPHRGHQQFHHQCDVQRLTASEPSRRVRSEAGVT 65
Query  53   ETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFE 112
            E W+ +   F+CAG    R  +    L  PSY+N P   +++QG+G+ G++ PGCP TF+
Sbjct  66   EIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYSNAPYITFVEQGRGVQGVVVPGCPETFQ 125
Query  113  ---EPQQPQ-QRGQSSRPQ----------------------------------------- 127
               E + PQ QR Q SR                                           
Sbjct  126  SESEFEYPQSQRDQRSRQSESEESSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQR 185
Query  128  ---------------------------DRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPV 160
                                       D+HQKI+  R+GD+I  P GV  W +N+ D  +
Sbjct  186  TRQSESEEFSRGDQRTRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDNDL 245
Query  161  VAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFL-KYQQEQGGHQSQKGKHQQEEENEG-- 217
            +++++ D NS++NQLD   R F+LAG  +Q    +  Q Q   +    + ++ +++E   
Sbjct  246  ISITLYDANSFQNQLDGNVRNFFLAGQSKQSREDRRSQRQTREEGSDRQSRESDDDEALL 305
Query  218  -GSILSGFTLEFLEHAF-SVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQR 275
              +IL+GF  E L+  F +VD++    L+G+N+   +G IV  +          D + + 
Sbjct  306  EANILTGFQDEILQEIFRNVDQETISKLRGDND--QRGFIVQAR----------DLKLRV 353
Query  276  PQEEEEEEEDEKPQCKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYN 335
            P+E EEE + E+    G      R RG   +S  NG+++  C +++++N+ + S  D++N
Sbjct  354  PEEYEEELQRER----G-----DRKRGGSGRS--NGLEQAFCNLKFKQNVNRPSRADVFN 402
Query  336  PQAGSVTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVN 395
            P+AG + T  S ++P L +++LSA+   L KNA++ P +NLNA+S +Y   G   +QVV 
Sbjct  403  PRAGRINTVNSNNLPILEFIQLSAQHVVLYKNAILGPRWNLNAHSALYVTRGEGRVQVVG 462
Query  396  CNGERVFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNAL 455
              G  VFD  +Q G++L+VPQ F V  ++  + +E+V +K +D  +   +AG  S+L A+
Sbjct  463  DEGRSVFDDNVQRGQILVVPQGFAVVLKAGREGLEWVELKNDDNAITSPIAGKTSVLRAI 522
Query  456  PEEVIQHTFNLKSQQARQIKNN-NPFKFLVPPQESQKR 492
            P EV+ +++++ +++A ++KN     + ++P Q   ++
Sbjct  523  PVEVLANSYDISTKEAFRLKNGRQEVEVFLPFQSRDEK 560

Sequence Alignment: 34. Allergen Name: Ses i 6.0101 Sequence ID: Q9XHP0

 Score = 81.9 bits 441,  Expect = 8e-17
 Identities = 169/439 38%, Positives = 276/439 62%, Gaps = 56/439 12%
Query  3    KLVFSLCFLLFSGCCFAFSSREQ--PQQNECQIQKLNALKPDNRIESEGGLIETWNPNNK 60
            K++++L + L+     A  +RE    Q  +C+ Q+++  +P  RI+SEGG  E W+   +
Sbjct  5    KFLLALSLSLLVSAAIA-QTREPRLTQGQQCRFQRISGAQPSLRIQSEGGTTELWDERQE 63
Query  61   PFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFE--EPQQPQ 118
             FQCAG+   R T+  N L  P+Y   P+ +YI++G+G+  ++ PGC  T++    Q+  
Sbjct  64   QFQCAGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQGLISIMVPGCAETYQVHRSQRTM 123
Query  119  QRGQSSRPQDR------HQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLE 172
            +R ++S  QDR      HQK++ +R+GD++A+P+G A W YN+    +VAVSI D N L 
Sbjct  124  ERTEASEQQDRGSVRDLHQKVHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSINDVNHLS 183
Query  173  NQLDQMPRRFYLAGNQEQEFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHA 232
            NQLDQ  R FYLAG            + G Q Q+ +  Q   N    I+  F  E+L  A
Sbjct  184  NQLDQKFRAFYLAGGVP---------RSGEQEQQAR--QTFHN----IFRAFDAELLSEA 228
Query  233  FSVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKG 292
            F+V ++  + +Q E   E++G IV  +  ++ +         RP EEE E+E        
Sbjct  229  FNVPQETIRRMQSEE--EERGLIVMARERMTFV---------RPDEEEGEQE-------- 269
Query  293  KDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPAL 352
               H    RG Q     NG++ET CTM++R N+      DI++ QAG V       +P L
Sbjct  270  ---H----RGRQLD---NGLEETFCTMKFRTNVESRREADIFSRQAGRVHVVDRNKLPIL 319
Query  353  SWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEGRVL 412
             ++ LSAE G+L  NA+  P +++  ++I+Y   G A +QVV+ NG+ + +  + +G ++
Sbjct  320  KYMDLSAEKGNLYSNALVSPDWSMTGHTIVYVTRGDAQVQVVDHNGQALMNDRVNQGEMF 379
Query  413  IVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQAR 472
            +VPQ +   AR+ ++ FE+V+FKT  +PM   LAG  S++ A+P +VI +++ +   QA+
Sbjct  380  VVPQYYTSTARAGNNGFEWVAFKTTGSPMRSPLAGYTSVIRAMPLQVITNSYQISPNQAQ 439
Query  473  QIKNNNPFK-FLVPP 486
             +K N   + FL+ P
Sbjct  440  ALKMNRGSQSFLLSP 454

Sequence Alignment: 35. Allergen Name: Fag e 1 Sequence ID: BAA21760

 Score = 82.0 bits 442,  Expect = 8e-17
 Identities = 172/445 38%, Positives = 279/445 62%, Gaps = 56/445 12%
Query  4    LVFSLCFLLFSGCCFA-------------FSSREQPQ-QNECQIQKLNALKPDNRIESEG 49
            L FSLC++++S  C A                R+Q Q Q++C IQ+L A +P  R+ SE 
Sbjct  7    LSFSLCLMVLS--CSAQLWPWQKGQGSRPHHGRQQHQFQHQCDIQRLTASEPSRRVRSEA 64
Query  50   GLIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPS 109
            G+ E W+ +   F+C G    R  +    L  PSY+N P   +++QG+G+ G++ PGCP 
Sbjct  65   GVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLPSYSNAPYITFVEQGRGVQGVVIPGCPE 124
Query  110  TFE---EPQQPQ-QRGQSSRPQ---------DRHQKIYNFREGDLIAVPTGVAWWMYNNE 156
            TF+   E + PQ QRG+ SR           D+HQKI+  REGD+I  P GV  W +N+ 
Sbjct  125  TFQSDSEFEYPQSQRGRHSRQSESEEESSRGDQHQKIFRIREGDVIPSPAGVVQWTHNDG 184
Query  157  DTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQEQGGHQSQKGKHQQEEENE 216
            +  +++V+++D NS   QLD+  R F+LAG  ++E     +E+G  + Q  +   +E   
Sbjct  185  NDDLISVTLLDANSYHKQLDENVRSFFLAGQSQRE----TREEGSDR-QSRESDDDEALL 239
Query  217  GGSILSGFTLEFLEHAF-SVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQR 275
            G +ILSGF  E L   F  VD++    L+GEN  + +G IV  +          D + + 
Sbjct  240  GANILSGFQDEILHELFRDVDRETISKLRGEN--DQRGFIVQAQ----------DLKLRV 287
Query  276  PQEEEEEEEDEKPQCKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYN 335
            PQ+ EEE E E    +G      R RG     R NG+++  C +++R N    ++  ++N
Sbjct  288  PQDFEEEYERE----RG-----DRRRGQGGSGRSNGVEQGFCNLKFRRNFNTPTNTYVFN 338
Query  336  PQAGSVTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVN 395
            P+AG + T  S  +P L +L+LSA+   L KNA+  P +NLNA+S +Y   G   +QVV 
Sbjct  339  PRAGRINTVNSNSLPILEFLQLSAQHVVLYKNAIIGPRWNLNAHSALYVTRGEGRVQVVG 398
Query  396  CNGERVFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNAL 455
              G+ VFD ++Q G++L+VPQ F V  ++  + +E+V +K +   +   + G  S+L A+
Sbjct  399  DEGKSVFDDKVQRGQILVVPQGFAVVLKAGREGLEWVELKNSGNAITSPIGGRTSVLRAI 458
Query  456  PEEVIQHTFNLKSQQARQIKN 476
            P EV+ +++++ +++A ++KN
Sbjct  459  PVEVLANSYDISTKEAYKLKN 479

Sequence Alignment: 36. Allergen Name: Gly m Bd28K Sequence ID: BAB21619

 Score = 45.3 bits 217,  Expect = 9e-06
 Identities = 96/360 26%, Positives = 177/360 49%, Gaps = 77/360 21%
Query  73   TLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEPQQPQQRGQSSRPQDRHQK 132
            ++   +L  P Y +    I+I++G+  +G IY        + +  ++R            
Sbjct  74   SMEPKSLFVPQYLDSNLIIFIRRGEAKLGFIY--------DDELAERR------------ 113
Query  133  IYNFREGDLIAVPTGVAWWMYN-NEDTPVVAVSIID-TNSLENQLDQMPRRFYLAGNQEQ 190
               ++ GDL  +P+G A+++ N  E   +  +  ID + SL  +  Q    FY+ G    
Sbjct  114  ---LKTGDLYMIPSGSAFYLVNIGEGQRLHVICSIDPSTSLGLETFQ---SFYIGG---- 163
Query  191  EFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFS-----VDKQIAKNLQG 245
                      G  S+             S+LSGF    LE AF+     V++  +K L G
Sbjct  164  ----------GANSH-------------SVLSGFEPAILETAFNESRTVVEEIFSKELDG 200
Query  246  ENEGEDKGAIVTVKGGLSVIKPPTDEQQ-QRPQEEEEEEEDEKPQCKGKDKHCQRPRGSQ 304
                 D     ++   +  +K    EQQ ++  +++EE+E+EK   +   K  +   G  
Sbjct  201  PIMFVDDSHAPSLWTKFLQLKKDDKEQQLKKMMQDQEEDEEEKQTSRSWRKLLETVFGKV 260
Query  305  SKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSAEFGSL 364
            ++   N   +T  +    +N+      D  N    S       ++P LS   +   +  L
Sbjct  261  NEKIEN--KDTAGSPA-SYNLYDDKKADFKNAYGWSKALHGG-EYPPLSEPDIGVLLVKL 316
Query  365  RKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVVAARS 424
               +M+ PH N  ++     L+G   +++   NG R    ++++G V++VP+ F     +
Sbjct  317  SAGSMLAPHVNPISDEYTIVLSGYGELHIGYPNGSRAMKTKIKQGDVFVVPRYFPFCQVA 376
Query  425  QSDN-FEYVSFKTN---DTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNN-- 478
              D  +E+  F T+   + P    LAGA SLL  L    +   F +     R+  +    
Sbjct  377  SRDGPLEFFGFSTSARKNKPQF--LAGAASLLRTLMGPELSAAFGVSEDTLRRAVDAQHE 434
Query  479  ----PFKFLVPPQESQK 491
                P  +  PP+ + K
Sbjct  435  AVILPSAWAAPPENAGK 451

Sequence Alignment: 37. Allergen Name: Coc n 1.0101 Sequence ID: A0A0S3B0K0

 Score = 42.7 bits 201,  Expect = 6e-05
 Identities = 75/302 24%, Positives = 137/302 45%, Gaps = 31/302 10%
Query  175  LDQMP--RRFYLAGNQEQEFLKYQQEQGGHQSQK--GKHQQEEENEGG----SILSGFTL 226
            +D +P    FY+  + + E L         +S +  G + Q     GG    S+LSGF  
Sbjct  138  VDAIPAGSSFYIVNSDKSERLHIICSIDTLESMEYYGAYPQSFYVGGGVLPRSVLSGFDA 197
Query  227  EFLEHAFSVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTD---EQQQRPQEEEEEE 283
              L  AF+V     + +     G   G I+ + G  +  +       + ++R  +E+E +
Sbjct  198  STLSAAFNVSSDQLEMILNSQRG---GPIIRLNGEAAEQRDYLSSIMQLKERMVQEKEMD 254
Query  284  EDEKPQCKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQT-SSPDIYNPQA---- 338
             D+  + + ++      R    KS     D   C ++ +H + ++  S ++Y+ +     
Sbjct  255  SDDDDEAEQEEDDVWTWR-CLLKSLLGKGD---CRVQRKHKLAHSPGSYNLYDTEPSYQN 310
Query  339  --GSVTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNC 396
              G        D+ AL    L   + +L+  AM+ PH N  A      L G   IQVV  
Sbjct  311  DYGYSIAIDGHDYSALKHSNLGVYLVNLKAGAMLSPHVNPTATEYGIILRGSGTIQVVFP 370
Query  397  NGERVFDGELQEGRVLIVPQNF-VVAARSQSDNFEYVSFKTN---DTPMIGTLAGANSLL 452
            NG    + ++ EG V+ +P+ F      S    +E+  F T+   + P    L G +SLL
Sbjct  371  NGTAAMNAKVSEGDVFWIPRYFPFCQIASDGAPLEFFGFTTSARKNRPQF--LVGKSSLL 428
Query  453  NALPEEVIQHTFNLKSQQARQIKNNNPFKFLVP 485
            +++    +   F +  +Q  +I        ++P
Sbjct  429  HSMRGPELAAAFGVSEEQLERIVKAQREAVILP 461

Sequence Alignment: 38. Allergen Name: Cor a 11 Sequence ID: AAL86739

 Score = 36.8 bits 165,  Expect = 0.003
 Identities = 87/300 29%, Positives = 152/300 50%, Gaps = 84/300 28%
Query  120  RGQSSRPQDRHQK--IYNFREGDLIAVPTGVAWWMYN-NEDTPVVAVSIIDTNSLENQLD 176
            +G+++    R +K   +N   GD+I +P G   +M N +E+  +  V I+   S   +++
Sbjct  127  KGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIVKILQPVSAPGHFE 186
Query  177  QMPRRFYLAGNQEQEFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVD 236
                 FY AG ++ E                           S    F+ E LE A+ V 
Sbjct  187  A----FYGAGGEDPE---------------------------SFYRAFSWEVLEAALKVR 215
Query  237  KQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKH 296
            ++  + + GE   + KG         S++K   ++ +   Q EE           G  + 
Sbjct  216  REQLEKVFGE---QSKG---------SIVKASREKIRALSQHEE-----------GPPR- 251
Query  297  CQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLR 356
               P G +S    N          L H       P   N Q G +  A   D   L  L 
Sbjct  252  -IWPFGGESSGPIN----------LLH-----KHPSQSN-QFGRLYEAHPDDHKQLQDLD 294
Query  357  LSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVV-----NCNGE-RVFDGELQEGR 410
            L   F ++ K +M  P+YN  A  I   + G  + ++      + +G  +     L+ G 
Sbjct  295  LMVSFANITKGSMAGPYYNSRATKISVVVEGEGFFEMACPHLSSSSGSYQKISARLRRGV 354
Query  411  VLIVPQNFVVAA-RSQSDNFEYVSFKTNDTPMIG-TLAGANSLLNALPEEVIQHTFNLKS 468
            V++ P    VA   SQ++N++ + F+ N        LAG  +++N +  +  +  FNL S
Sbjct  355  VFVAPAGHPVAVIASQNNNLQVLCFEVNAHGNSRFPLAGKGNIVNEFERDAKELAFNLPS 414
Query  469  QQARQIKNNNPFKFLVP-PQESQK 491
            ++  +I  N    F+ P P + Q+
Sbjct  415  REVERIFKNQDQAFFFPGPNKQQE 438

Sequence Alignment: 39. Allergen Name: Gly m 5.0201 Sequence ID: Q9FZP9

 Score = 36.0 bits 161,  Expect = 0.006
 Identities = 84/292 28%, Positives = 153/292 52%, Gaps = 84/292 28%
Query  134  YNFREGDLIAVPTGVAWWMYN-NEDTPVVAVSI-IDTNSLENQLDQMPRRFYLAGNQEQE 191
            YN++ GD + VP G  +++ N + D  +  +++ I  N         P RF      E  
Sbjct  231  YNLQSGDALRVPAGTTYYVVNPDNDENLRMITLAIPVNK--------PGRF------ESF 276
Query  192  FLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVD-KQIAKNLQGENEGE 250
            FL   Q Q                   S L GF+   LE ++    ++I K L G  EG+
Sbjct  277  FLSSTQAQQ------------------SYLQGFSKNILEASYDTKFEEINKVLFGREEGQ 318
Query  251  DKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRPRGSQSKSRRN 310
             +G                   ++R QE    E  +K Q +   KH      ++S SR+ 
Sbjct  319  QQG-------------------EERLQESVIVEISKK-QIRELSKH------AKSSSRK- 351
Query  311  GIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSAEFGSLRKNAMF 370
                TI +     N+ ++  P IY+ + G +   T    P L  L +      + + A+F
Sbjct  352  ----TISSEDKPFNL-RSRDP-IYSNKLGKLFEITPEKNPQLRDLDVFLSVVDMNEGALF 405
Query  371  VPHYNLNANSIIYALNGRALIQVVNCNGE-------------RVFDGELQEGRVLIVPQN 417
            +PH+N  A  ++    G A I++V    +             R +  EL E  ++++P  
Sbjct  406  LPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAG 465
Query  418  FVVAARSQSDNFEYVSFKTN-DTPMIGTLAGA-NSLLNALPEEVIQHTFNLKSQQARQIK 475
            + V   + SD + + +F  N +      LAG+ +++++ +P +V +  F   ++    + 
Sbjct  466  YPVVVNATSD-LNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENLI 524
Query  476  NNNPFKFLVPPQESQK 491
             +    ++V  Q  QK
Sbjct  525  KSQSESYFVDAQPQQK 540

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.