The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

MAKLVLLLSAFAFLILAANASIYRATVEVEGENLSSGQSCQKQFEEQQKFKHCQMYVQQE
VQKSQDGHSLTARINQRQQCFKQCCQELQEVDKKCRCQNLEQMVKRQQQQGQFRGEKLQE
LYETASELPRMCNISPSQGCQFSSPYWSY
Sequence Info Allergen Name Length Opt Bits Score E Value
DQ631675 Pis v 1.0101 149 1019 85.7 5.6e-19
AAL91665 Ana o 3 138 659 60.2 2.5e-11
ACO56333 Cor a 14.0101 147 385 40.9 1.8e-05
AAM54365 Jug n 1 161 386 41.0 1.8e-05
AAB41308 Jug r 1 139 362 39.2 5.3e-05
AAO32314 Car i 1.0101 143 342 37.8 0.00014
AAK15088 Ses i 1 153 321 36.4 0.00042
CAA38363 Ber e 1 154 316 36.0 0.00054
P01089 Ric c 1 258 311 36.0 0.00092
P04403 Ber e 1 146 297 34.6 0.0013
AAA33010 Ber e 1 146 297 34.6 0.0013
Q39649 Cuc ma 5.0101 141 294 34.4 0.0015
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pis v 1.0101 Sequence ID: DQ631675

 Score = 85.7 bits 1019,  Expect = 6e-19
 Identities = 149/149 100%, Positives = 149/149 100%, Gaps = 0/149 0%
Query  1    MAKLVLLLSAFAFLILAANASIYRATVEVEGENLSSGQSCQKQFEEQQKFKHCQMYVQQE 60
            MAKLVLLLSAFAFLILAANASIYRATVEVEGENLSSGQSCQKQFEEQQKFKHCQMYVQQE
Sbjct  1    MAKLVLLLSAFAFLILAANASIYRATVEVEGENLSSGQSCQKQFEEQQKFKHCQMYVQQE 60
Query  61   VQKSQDGHSLTARINQRQQCFKQCCQELQEVDKKCRCQNLEQMVKRQQQQGQFRGEKLQE 120
            VQKSQDGHSLTARINQRQQCFKQCCQELQEVDKKCRCQNLEQMVKRQQQQGQFRGEKLQE
Sbjct  61   VQKSQDGHSLTARINQRQQCFKQCCQELQEVDKKCRCQNLEQMVKRQQQQGQFRGEKLQE 120
Query  121  LYETASELPRMCNISPSQGCQFSSPYWSY 149
            LYETASELPRMCNISPSQGCQFSSPYWSY
Sbjct  121  LYETASELPRMCNISPSQGCQFSSPYWSY 149

Sequence Alignment: 2. Allergen Name: Ana o 3 Sequence ID: AAL91665

 Score = 60.2 bits 659,  Expect = 2e-11
 Identities = 97/138 70%, Positives = 121/138 87%, Gaps = 8/138 5%
Query  1    MAKLVLLLSAFAFLILAANASIYRATVEVEGENLSSGQSCQKQFEEQQKFKHCQMYVQQE 60
            MAK++LLLSAFA L+L ANASIYRA VEVE E+    QSCQ+QFEEQQ+F++CQ YV+QE
Sbjct  1    MAKFLLLLSAFAVLLLVANASIYRAIVEVE-EDSGREQSCQRQFEEQQRFRNCQRYVKQE 59
Query  61   VQKSQDGHSLTARINQRQQCFKQCCQELQEVDKKCRCQNLEQMVKRQQQQGQFRGEKLQE 120
            VQ+         R NQRQ+ +++CCQELQEVD++CRCQNLEQMV++ QQQ Q +GE+++E
Sbjct  60   VQRG-------GRYNQRQESLRECCQELQEVDRRCRCQNLEQMVRQLQQQEQIKGEEVRE 112
Query  121  LYETASELPRMCNISPSQGCQFSSPY 146
            LYETASELPR+C+ISPSQGCQF S Y
Sbjct  113  LYETASELPRICSISPSQGCQFQSSY 138

Sequence Alignment: 3. Allergen Name: Cor a 14.0101 Sequence ID: ACO56333

 Score = 40.9 bits 385,  Expect = 2e-05
 Identities = 60/136 44%, Positives = 98/136 72%, Gaps = 16/136 11%
Query  1    MAKLVLLLSAFAFLILAANASIYRATV-------EVEGENLSSGQSCQKQFEEQQKFKHC 53
            MA+L  L + FA L+L A+A+ +R T+       ++  +    G+SC++Q + QQ + +C
Sbjct  1    MARLATLAALFAALLLVAHAAAFRTTITTVDVDEDIVNQQGRRGESCREQAQRQQNLNQC 60
Query  54   QMYVQQEVQK-SQDGHSLTARINQRQQCFKQCCQELQEVDKKCRCQNLEQMVKRQQQQGQ 112
            Q Y++Q+ Q  S DG +      Q+QQ ++QCCQ+L+++D++CRC+ L Q V   QQQG+
Sbjct  61   QRYMRQQSQYGSYDGSN-----QQQQQELEQCCQQLRQMDERCRCEGLRQAV--MQQQGE 113
Query  113  FRGEKLQELYETASELPRMCNISPSQGCQFSS 144
             RGE+++E+ ETA +LP  C +SP Q C+  S
Sbjct  114  MRGEEMREVMETARDLPNQCRLSP-QRCEIRS 144

Sequence Alignment: 4. Allergen Name: Jug n 1 Sequence ID: AAM54365

 Score = 41.0 bits 386,  Expect = 2e-05
 Identities = 58/133 43%, Positives = 99/133 74%, Gaps = 15/133 11%
Query  1    MAKLVLLLSAFAFLILAANASIYRATV---EVEGENLSS----GQSCQKQFEEQQKFKHC 53
            MA+L  L + +  L++ ANA+ +R T+   E++ E++ +    G+ CQ+Q + QQ + HC
Sbjct  16   MARLATLAALLVALLFVANAAAFRTTITTMEID-EDIDNPRRRGEGCQEQIQRQQNLNHC 74
Query  54   QMYVQQEVQKSQDGHSLTARINQRQQCFKQCCQELQEVDKKCRCQNLEQMVKRQQQQGQF 113
            Q Y++Q  Q    G+      NQRQ+ F+QCCQ+L +++++C+C+ L Q V+RQQQQ  +
Sbjct  75   QYYLRQ--QSRSGGYDED---NQRQH-FRQCCQQLSQIEEQCQCEGLRQAVRRQQQQQGL 128
Query  114  RGEKLQELYETASELPRMCNISPSQGCQ 141
            RGE+++E+ ++A +LP+ C IS SQ C+
Sbjct  129  RGEEMEEMVQSARDLPKECGIS-SQRCE 155

Sequence Alignment: 5. Allergen Name: Jug r 1 Sequence ID: AAB41308

 Score = 39.2 bits 362,  Expect = 5e-05
 Identities = 54/120 45%, Positives = 92/120 76%, Gaps = 15/120 12%
Query  14   LILAANASIYRATV---EVEGENLSS----GQSCQKQFEEQQKFKHCQMYVQQEVQKSQD 66
            L++ ANA+ +R T+   E++ E++ +    G+ C++Q + QQ + HCQ Y++Q  Q    
Sbjct  7    LLFVANAAAFRTTITTMEID-EDIDNPRRRGEGCREQIQRQQNLNHCQYYLRQ--QSRSG 63
Query  67   GHSLTARINQRQQCFKQCCQELQEVDKKCRCQNLEQMVKRQQQQGQFRGEKLQELYETAS 126
            G+      NQRQ+ F+QCCQ+L ++D++C+C+ L Q+V+RQQQQ  +RGE+++E+ ++A 
Sbjct  64   GYD---EDNQRQH-FRQCCQQLSQMDEQCQCEGLRQVVRRQQQQQGLRGEEMEEMVQSAR 119
Query  127  ELPRMCNISPSQGCQ 141
            +LP  C IS SQ C+
Sbjct  120  DLPNECGIS-SQRCE 133

Sequence Alignment: 6. Allergen Name: Car i 1.0101 Sequence ID: AAO32314

 Score = 37.8 bits 342,  Expect = 0.0001
 Identities = 56/130 43%, Positives = 98/130 75%, Gaps = 18/130 13%
Query  1    MAKLVLLLSAFAFLILAANASIYRATV---EVEGENLSS----GQSCQKQFEEQQKFKHC 53
            MA++  LL A+ F+   ANA+ +R T+   E++ E++ +    G+SC++Q + QQ +  C
Sbjct  1    MARVAALLVALLFV---ANAAAFRTTITTMEID-EDIDNPRRRGESCREQIQRQQYLNRC 56
Query  54   QMYVQQEVQKSQDGHSLTARINQRQQCFKQCCQELQEVDKKCRCQNLEQMVKRQQQQGQF 113
            Q Y++Q  Q    G+      NQRQ+ F+QCCQ+L +++++C+C+ L Q V++QQQ+   
Sbjct  57   QDYLRQ--QCRSGGYDED---NQRQH-FRQCCQQLSQMEEQCQCEGLRQAVRQQQQEEGI 110
Query  114  RGEKLQELYETASELPRMCNISPSQGCQ 141
            RGE+++E+ + AS+LP+ C IS S+ C+
Sbjct  111  RGEEMEEMVQCASDLPKECGIS-SRSCE 137

Sequence Alignment: 7. Allergen Name: Ses i 1 Sequence ID: AAK15088

 Score = 36.4 bits 321,  Expect = 0.0004
 Identities = 52/138 37%, Positives = 91/138 65%, Gaps = 14/138 10%
Query  1    MAKLVLLLSAFAFLILA-ANASIYRATVE---VEGENLSSGQSCQKQFEEQQKFKHCQMY 56
            MAK + L + +   ++A A+A+ Y  TV    ++ E     Q C++Q++ +Q F+ CQ Y
Sbjct  1    MAKKLALAAVLLVAMVALASATTYTTTVTTTAIDDEANQQSQQCRQQLQGRQ-FRSCQRY 59
Query  57   VQQEVQKSQDGHS------LTARINQRQQCFKQCCQELQEVDKKCRCQNLEQMVKRQQQQ 110
            + Q   +S  G        ++    Q +Q ++ CCQ+L+ VD++CRC+ + Q V++QQQ+
Sbjct  60   LSQ--GRSPYGGEEDEVLEMSTGNQQSEQSLRDCCQQLRNVDERCRCEAIRQAVRQQQQE 117
Query  111  GQFRGEKLQELYETASELPRMCNISPSQGCQF 142
            G ++  + Q++Y+ A +LPR CN+ P Q CQF
Sbjct  118  GGYQEGQSQQVYQRARDLPRRCNMRPQQ-CQF 148

Sequence Alignment: 8. Allergen Name: Ber e 1 Sequence ID: CAA38363

 Score = 36.0 bits 316,  Expect = 0.0005
 Identities = 48/138 34%, Positives = 91/138 65%, Gaps = 9/138 6%
Query  1    MAKLVLLLSAFAFLILAANASIYRATV----EVEGENLSSG---QSCQKQFEEQQKFKHC 53
            MAK+ ++ +A+  L++   A+ +R TV    E E E    G   Q C++Q E QQ++ HC
Sbjct  1    MAKMSVVAAALLALLVLGQATAFRTTVTTTLEEEQEENPRGRSEQQCREQMERQQQLNHC 60
Query  54   QMYVQQEVQKSQDGHSLTARINQRQQCFKQCCQELQEVDKKCRCQNLEQMVKRQQQQGQF 113
            +MY++Q++++S   +    R  +  + + +CC++L+ +D+ CRC+ L  M++RQ+++ ++
Sbjct  61   RMYLRQQMEESPYQNPRPLRRGEEPH-LDECCEQLERMDEMCRCEGLRMMLRRQREEMEL 119
Query  114  RGEKLQELYETASELPRMCNISPSQGC 140
            +GE++Q +   A  L   CN+SP Q C
Sbjct  120  QGEQMQRIMRKAENLLSRCNLSP-QRC 145

Sequence Alignment: 9. Allergen Name: Ric c 1 Sequence ID: P01089

 Score = 36.0 bits 311,  Expect = 0.0009
 Identities = 40/101 39%, Positives = 72/101 71%, Gaps = 6/101 5%
Query  36   SGQSCQKQFEEQQKFKHCQMYVQQEVQKSQDGHSLTARINQRQQCFKQCCQELQEVDKKC 95
            S Q C+ Q +EQQ +++CQ Y++Q+V  S  G     R + +++ ++ CC  L+++  +C
Sbjct  158  SQQGCRGQIQEQQNLRQCQEYIKQQV--SGQG---PRRSDNQERSLRGCCDHLKQMQSQC 212
Query  96   RCQNLEQMVKRQQQQGQFRGEKLQELYETASELPRMCNISPSQGCQF 142
            RC+ L Q +++QQ QGQ++G+ + E + TA+ LP MC +SP++ C+F
Sbjct  213  RCEGLRQAIEQQQSQGQLQGQDVFEAFRTAANLPSMCGVSPTE-CRF 258

Sequence Alignment: 10. Allergen Name: Ber e 1 Sequence ID: P04403

 Score = 34.6 bits 297,  Expect = 0.001
 Identities = 47/130 36%, Positives = 85/130 65%, Gaps = 10/130 7%
Query  1    MAKLVLLLSAFAFLILAANASIYRATVE---VEGENLSSGQSCQKQFEEQQKFKHCQMYV 57
            MAK+ +  +A+  L+   +A+ +RATV    VE EN    + C++Q + QQ + HC+MY+
Sbjct  1    MAKISVAAAALLVLMALGHATAFRATVTTTVVEEENQ---EECREQMQRQQMLSHCRMYM 57
Query  58   QQEVQKSQDGHSLTARINQRQQCFKQCCQELQEVDKKCRCQNLEQMVKR-QQQQGQFRGE 116
            +Q++++S   +    R     +   +CC++L+ +D+ CRC+ L  M+ R QQ++ Q RGE
Sbjct  58   RQQMEESP--YQTMPRRGMEPH-MSECCEQLEGMDESCRCEGLRMMMMRMQQEEMQPRGE 114
Query  117  KLQELYETASELPRMCNISP 136
            +++ +   A  +P  CN+SP
Sbjct  115  QMRRMMRLAENIPSRCNLSP 134

Sequence Alignment: 11. Allergen Name: Ber e 1 Sequence ID: AAA33010

 Score = 34.6 bits 297,  Expect = 0.001
 Identities = 47/130 36%, Positives = 85/130 65%, Gaps = 10/130 7%
Query  1    MAKLVLLLSAFAFLILAANASIYRATVE---VEGENLSSGQSCQKQFEEQQKFKHCQMYV 57
            MAK+ +  +A+  L+   +A+ +RATV    VE EN    + C++Q + QQ + HC+MY+
Sbjct  1    MAKISVAAAALLVLMALGHATAFRATVTTTVVEEENQ---EECREQMQRQQMLSHCRMYM 57
Query  58   QQEVQKSQDGHSLTARINQRQQCFKQCCQELQEVDKKCRCQNLEQMVKR-QQQQGQFRGE 116
            +Q++++S   +    R     +   +CC++L+ +D+ CRC+ L  M+ R QQ++ Q RGE
Sbjct  58   RQQMEESP--YQTMPRRGMEPH-MSECCEQLEGMDESCRCEGLRMMMMRMQQEEMQPRGE 114
Query  117  KLQELYETASELPRMCNISP 136
            +++ +   A  +P  CN+SP
Sbjct  115  QMRRMMRLAENIPSRCNLSP 134

Sequence Alignment: 12. Allergen Name: Cuc ma 5.0101 Sequence ID: Q39649

 Score = 34.4 bits 294,  Expect = 0.002
 Identities = 46/138 33%, Positives = 82/138 59%, Gaps = 7/138 5%
Query  1    MAKLVLLLSAFAFLILAANASIYRAT---VEVEGENLSSGQSCQKQFEEQQKFKHCQMYV 57
            MA+L  +++ FA  +L A+A  YR T   VEVE       + C +Q   +++++ C+ Y+
Sbjct  1    MARLTSIIALFAVALLVADAYAYRTTITTVEVEENRQGREERC-RQMSAREELRSCEQYL 59
Query  58   QQEVQKSQDGHSLTARINQRQQCFKQCCQELQEVDKKCRCQNLEQMVKRQQQQGQFRGEK 117
            +Q+ +       +     +    F +CC+EL+ VD++CRC  LE++ + +Q+Q   RG++
Sbjct  60   RQQSRDVLQMRGIENPWRREGGSFDECCRELKNVDEECRCDMLEEIAREEQRQA--RGQE 117
Query  118  LQELYETASELPRMCNISPSQGCQF 142
             +++ + A  LP MC I P Q C F
Sbjct  118  GRQMLQKARNLPSMCGIRP-QRCDF 141

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.